diff options
author | Daniel Baumann <daniel.baumann@progress-linux.org> | 2024-04-28 13:14:23 +0000 |
---|---|---|
committer | Daniel Baumann <daniel.baumann@progress-linux.org> | 2024-04-28 13:14:23 +0000 |
commit | 73df946d56c74384511a194dd01dbe099584fd1a (patch) | |
tree | fd0bcea490dd81327ddfbb31e215439672c9a068 /src/cmd/internal/objabi | |
parent | Initial commit. (diff) | |
download | golang-1.16-73df946d56c74384511a194dd01dbe099584fd1a.tar.xz golang-1.16-73df946d56c74384511a194dd01dbe099584fd1a.zip |
Adding upstream version 1.16.10.upstream/1.16.10upstream
Signed-off-by: Daniel Baumann <daniel.baumann@progress-linux.org>
Diffstat (limited to 'src/cmd/internal/objabi')
-rw-r--r-- | src/cmd/internal/objabi/autotype.go | 38 | ||||
-rw-r--r-- | src/cmd/internal/objabi/flag.go | 201 | ||||
-rw-r--r-- | src/cmd/internal/objabi/flag_test.go | 26 | ||||
-rw-r--r-- | src/cmd/internal/objabi/funcdata.go | 47 | ||||
-rw-r--r-- | src/cmd/internal/objabi/funcid.go | 100 | ||||
-rw-r--r-- | src/cmd/internal/objabi/head.go | 109 | ||||
-rw-r--r-- | src/cmd/internal/objabi/line.go | 125 | ||||
-rw-r--r-- | src/cmd/internal/objabi/line_test.go | 50 | ||||
-rw-r--r-- | src/cmd/internal/objabi/path.go | 63 | ||||
-rw-r--r-- | src/cmd/internal/objabi/path_test.go | 33 | ||||
-rw-r--r-- | src/cmd/internal/objabi/reloctype.go | 291 | ||||
-rw-r--r-- | src/cmd/internal/objabi/reloctype_string.go | 83 | ||||
-rw-r--r-- | src/cmd/internal/objabi/stack.go | 33 | ||||
-rw-r--r-- | src/cmd/internal/objabi/symkind.go | 79 | ||||
-rw-r--r-- | src/cmd/internal/objabi/symkind_string.go | 41 | ||||
-rw-r--r-- | src/cmd/internal/objabi/typekind.go | 40 | ||||
-rw-r--r-- | src/cmd/internal/objabi/util.go | 201 |
17 files changed, 1560 insertions, 0 deletions
diff --git a/src/cmd/internal/objabi/autotype.go b/src/cmd/internal/objabi/autotype.go new file mode 100644 index 0000000..f9d17a3 --- /dev/null +++ b/src/cmd/internal/objabi/autotype.go @@ -0,0 +1,38 @@ +// Derived from Inferno utils/6l/l.h and related files. +// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h +// +// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. +// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) +// Portions Copyright © 1997-1999 Vita Nuova Limited +// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) +// Portions Copyright © 2004,2006 Bruce Ellis +// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) +// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others +// Portions Copyright © 2009 The Go Authors. All rights reserved. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package objabi + +// Auto.name +const ( + A_AUTO = 1 + iota + A_PARAM + A_DELETED_AUTO +) diff --git a/src/cmd/internal/objabi/flag.go b/src/cmd/internal/objabi/flag.go new file mode 100644 index 0000000..3fd73f3 --- /dev/null +++ b/src/cmd/internal/objabi/flag.go @@ -0,0 +1,201 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +import ( + "bytes" + "flag" + "fmt" + "io" + "io/ioutil" + "log" + "os" + "strconv" + "strings" +) + +func Flagcount(name, usage string, val *int) { + flag.Var((*count)(val), name, usage) +} + +func Flagfn1(name, usage string, f func(string)) { + flag.Var(fn1(f), name, usage) +} + +func Flagprint(w io.Writer) { + flag.CommandLine.SetOutput(w) + flag.PrintDefaults() +} + +func Flagparse(usage func()) { + flag.Usage = usage + os.Args = expandArgs(os.Args) + flag.Parse() +} + +// expandArgs expands "response files" arguments in the provided slice. +// +// A "response file" argument starts with '@' and the rest of that +// argument is a filename with CR-or-CRLF-separated arguments. Each +// argument in the named files can also contain response file +// arguments. See Issue 18468. +// +// The returned slice 'out' aliases 'in' iff the input did not contain +// any response file arguments. +// +// TODO: handle relative paths of recursive expansions in different directories? +// Is there a spec for this? Are relative paths allowed? +func expandArgs(in []string) (out []string) { + // out is nil until we see a "@" argument. + for i, s := range in { + if strings.HasPrefix(s, "@") { + if out == nil { + out = make([]string, 0, len(in)*2) + out = append(out, in[:i]...) + } + slurp, err := ioutil.ReadFile(s[1:]) + if err != nil { + log.Fatal(err) + } + args := strings.Split(strings.TrimSpace(strings.Replace(string(slurp), "\r", "", -1)), "\n") + for i, arg := range args { + args[i] = DecodeArg(arg) + } + out = append(out, expandArgs(args)...) + } else if out != nil { + out = append(out, s) + } + } + if out == nil { + return in + } + return +} + +func AddVersionFlag() { + flag.Var(versionFlag{}, "V", "print version and exit") +} + +var buildID string // filled in by linker + +type versionFlag struct{} + +func (versionFlag) IsBoolFlag() bool { return true } +func (versionFlag) Get() interface{} { return nil } +func (versionFlag) String() string { return "" } +func (versionFlag) Set(s string) error { + name := os.Args[0] + name = name[strings.LastIndex(name, `/`)+1:] + name = name[strings.LastIndex(name, `\`)+1:] + name = strings.TrimSuffix(name, ".exe") + + // If there's an active experiment, include that, + // to distinguish go1.10.2 with an experiment + // from go1.10.2 without an experiment. + p := Expstring() + if p == DefaultExpstring() { + p = "" + } + sep := "" + if p != "" { + sep = " " + } + + // The go command invokes -V=full to get a unique identifier + // for this tool. It is assumed that the release version is sufficient + // for releases, but during development we include the full + // build ID of the binary, so that if the compiler is changed and + // rebuilt, we notice and rebuild all packages. + if s == "full" { + if strings.HasPrefix(Version, "devel") { + p += " buildID=" + buildID + } + } + + fmt.Printf("%s version %s%s%s\n", name, Version, sep, p) + os.Exit(0) + return nil +} + +// count is a flag.Value that is like a flag.Bool and a flag.Int. +// If used as -name, it increments the count, but -name=x sets the count. +// Used for verbose flag -v. +type count int + +func (c *count) String() string { + return fmt.Sprint(int(*c)) +} + +func (c *count) Set(s string) error { + switch s { + case "true": + *c++ + case "false": + *c = 0 + default: + n, err := strconv.Atoi(s) + if err != nil { + return fmt.Errorf("invalid count %q", s) + } + *c = count(n) + } + return nil +} + +func (c *count) Get() interface{} { + return int(*c) +} + +func (c *count) IsBoolFlag() bool { + return true +} + +func (c *count) IsCountFlag() bool { + return true +} + +type fn1 func(string) + +func (f fn1) Set(s string) error { + f(s) + return nil +} + +func (f fn1) String() string { return "" } + +// DecodeArg decodes an argument. +// +// This function is public for testing with the parallel encoder. +func DecodeArg(arg string) string { + // If no encoding, fastpath out. + if !strings.ContainsAny(arg, "\\\n") { + return arg + } + + // We can't use strings.Builder as this must work at bootstrap. + var b bytes.Buffer + var wasBS bool + for _, r := range arg { + if wasBS { + switch r { + case '\\': + b.WriteByte('\\') + case 'n': + b.WriteByte('\n') + default: + // This shouldn't happen. The only backslashes that reach here + // should encode '\n' and '\\' exclusively. + panic("badly formatted input") + } + } else if r == '\\' { + wasBS = true + continue + } else { + b.WriteRune(r) + } + wasBS = false + } + return b.String() +} diff --git a/src/cmd/internal/objabi/flag_test.go b/src/cmd/internal/objabi/flag_test.go new file mode 100644 index 0000000..935b9c2 --- /dev/null +++ b/src/cmd/internal/objabi/flag_test.go @@ -0,0 +1,26 @@ +// Copyright 2020 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +import "testing" + +func TestDecodeArg(t *testing.T) { + t.Parallel() + tests := []struct { + arg, want string + }{ + {"", ""}, + {"hello", "hello"}, + {"hello\\n", "hello\n"}, + {"hello\\nthere", "hello\nthere"}, + {"hello\\\\there", "hello\\there"}, + {"\\\\\\n", "\\\n"}, + } + for _, test := range tests { + if got := DecodeArg(test.arg); got != test.want { + t.Errorf("decodoeArg(%q) = %q, want %q", test.arg, got, test.want) + } + } +} diff --git a/src/cmd/internal/objabi/funcdata.go b/src/cmd/internal/objabi/funcdata.go new file mode 100644 index 0000000..faa2863 --- /dev/null +++ b/src/cmd/internal/objabi/funcdata.go @@ -0,0 +1,47 @@ +// Copyright 2013 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +// This file defines the IDs for PCDATA and FUNCDATA instructions +// in Go binaries. +// +// These must agree with ../../../runtime/funcdata.h and +// ../../../runtime/symtab.go. + +const ( + PCDATA_UnsafePoint = 0 + PCDATA_StackMapIndex = 1 + PCDATA_InlTreeIndex = 2 + + FUNCDATA_ArgsPointerMaps = 0 + FUNCDATA_LocalsPointerMaps = 1 + FUNCDATA_StackObjects = 2 + FUNCDATA_InlTree = 3 + FUNCDATA_OpenCodedDeferInfo = 4 + + // ArgsSizeUnknown is set in Func.argsize to mark all functions + // whose argument size is unknown (C vararg functions, and + // assembly code without an explicit specification). + // This value is generated by the compiler, assembler, or linker. + ArgsSizeUnknown = -0x80000000 +) + +// Special PCDATA values. +const ( + // PCDATA_UnsafePoint values. + PCDATA_UnsafePointSafe = -1 // Safe for async preemption + PCDATA_UnsafePointUnsafe = -2 // Unsafe for async preemption + + // PCDATA_Restart1(2) apply on a sequence of instructions, within + // which if an async preemption happens, we should back off the PC + // to the start of the sequence when resuming. + // We need two so we can distinguish the start/end of the sequence + // in case that two sequences are next to each other. + PCDATA_Restart1 = -3 + PCDATA_Restart2 = -4 + + // Like PCDATA_Restart1, but back to function entry if async preempted. + PCDATA_RestartAtEntry = -5 +) diff --git a/src/cmd/internal/objabi/funcid.go b/src/cmd/internal/objabi/funcid.go new file mode 100644 index 0000000..1d098ee --- /dev/null +++ b/src/cmd/internal/objabi/funcid.go @@ -0,0 +1,100 @@ +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +// A FuncID identifies particular functions that need to be treated +// specially by the runtime. +// Note that in some situations involving plugins, there may be multiple +// copies of a particular special runtime function. +// Note: this list must match the list in runtime/symtab.go. +type FuncID uint8 + +const ( + FuncID_normal FuncID = iota // not a special function + FuncID_runtime_main + FuncID_goexit + FuncID_jmpdefer + FuncID_mcall + FuncID_morestack + FuncID_mstart + FuncID_rt0_go + FuncID_asmcgocall + FuncID_sigpanic + FuncID_runfinq + FuncID_gcBgMarkWorker + FuncID_systemstack_switch + FuncID_systemstack + FuncID_cgocallback + FuncID_gogo + FuncID_externalthreadhandler + FuncID_debugCallV1 + FuncID_gopanic + FuncID_panicwrap + FuncID_handleAsyncEvent + FuncID_asyncPreempt + FuncID_wrapper // any autogenerated code (hash/eq algorithms, method wrappers, etc.) +) + +// Get the function ID for the named function in the named file. +// The function should be package-qualified. +func GetFuncID(name string, isWrapper bool) FuncID { + if isWrapper { + return FuncID_wrapper + } + switch name { + case "runtime.main": + return FuncID_runtime_main + case "runtime.goexit": + return FuncID_goexit + case "runtime.jmpdefer": + return FuncID_jmpdefer + case "runtime.mcall": + return FuncID_mcall + case "runtime.morestack": + return FuncID_morestack + case "runtime.mstart": + return FuncID_mstart + case "runtime.rt0_go": + return FuncID_rt0_go + case "runtime.asmcgocall": + return FuncID_asmcgocall + case "runtime.sigpanic": + return FuncID_sigpanic + case "runtime.runfinq": + return FuncID_runfinq + case "runtime.gcBgMarkWorker": + return FuncID_gcBgMarkWorker + case "runtime.systemstack_switch": + return FuncID_systemstack_switch + case "runtime.systemstack": + return FuncID_systemstack + case "runtime.cgocallback": + return FuncID_cgocallback + case "runtime.gogo": + return FuncID_gogo + case "runtime.externalthreadhandler": + return FuncID_externalthreadhandler + case "runtime.debugCallV1": + return FuncID_debugCallV1 + case "runtime.gopanic": + return FuncID_gopanic + case "runtime.panicwrap": + return FuncID_panicwrap + case "runtime.handleAsyncEvent": + return FuncID_handleAsyncEvent + case "runtime.asyncPreempt": + return FuncID_asyncPreempt + case "runtime.deferreturn": + // Don't show in the call stack (used when invoking defer functions) + return FuncID_wrapper + case "runtime.runOpenDeferFrame": + // Don't show in the call stack (used when invoking defer functions) + return FuncID_wrapper + case "runtime.reflectcallSave": + // Don't show in the call stack (used when invoking defer functions) + return FuncID_wrapper + } + return FuncID_normal +} diff --git a/src/cmd/internal/objabi/head.go b/src/cmd/internal/objabi/head.go new file mode 100644 index 0000000..48ff292 --- /dev/null +++ b/src/cmd/internal/objabi/head.go @@ -0,0 +1,109 @@ +// Derived from Inferno utils/6l/l.h and related files. +// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h +// +// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. +// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) +// Portions Copyright © 1997-1999 Vita Nuova Limited +// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) +// Portions Copyright © 2004,2006 Bruce Ellis +// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) +// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others +// Portions Copyright © 2009 The Go Authors. All rights reserved. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package objabi + +import "fmt" + +// HeadType is the executable header type. +type HeadType uint8 + +const ( + Hunknown HeadType = iota + Hdarwin + Hdragonfly + Hfreebsd + Hjs + Hlinux + Hnetbsd + Hopenbsd + Hplan9 + Hsolaris + Hwindows + Haix +) + +func (h *HeadType) Set(s string) error { + switch s { + case "aix": + *h = Haix + case "darwin", "ios": + *h = Hdarwin + case "dragonfly": + *h = Hdragonfly + case "freebsd": + *h = Hfreebsd + case "js": + *h = Hjs + case "linux", "android": + *h = Hlinux + case "netbsd": + *h = Hnetbsd + case "openbsd": + *h = Hopenbsd + case "plan9": + *h = Hplan9 + case "illumos", "solaris": + *h = Hsolaris + case "windows": + *h = Hwindows + default: + return fmt.Errorf("invalid headtype: %q", s) + } + return nil +} + +func (h *HeadType) String() string { + switch *h { + case Haix: + return "aix" + case Hdarwin: + return "darwin" + case Hdragonfly: + return "dragonfly" + case Hfreebsd: + return "freebsd" + case Hjs: + return "js" + case Hlinux: + return "linux" + case Hnetbsd: + return "netbsd" + case Hopenbsd: + return "openbsd" + case Hplan9: + return "plan9" + case Hsolaris: + return "solaris" + case Hwindows: + return "windows" + } + return fmt.Sprintf("HeadType(%d)", *h) +} diff --git a/src/cmd/internal/objabi/line.go b/src/cmd/internal/objabi/line.go new file mode 100644 index 0000000..0733b65 --- /dev/null +++ b/src/cmd/internal/objabi/line.go @@ -0,0 +1,125 @@ +// Copyright 2009 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +import ( + "os" + "path/filepath" + "strings" +) + +// WorkingDir returns the current working directory +// (or "/???" if the directory cannot be identified), +// with "/" as separator. +func WorkingDir() string { + var path string + path, _ = os.Getwd() + if path == "" { + path = "/???" + } + return filepath.ToSlash(path) +} + +// AbsFile returns the absolute filename for file in the given directory, +// as rewritten by the rewrites argument. +// For unrewritten paths, AbsFile rewrites a leading $GOROOT prefix to the literal "$GOROOT". +// If the resulting path is the empty string, the result is "??". +// +// The rewrites argument is a ;-separated list of rewrites. +// Each rewrite is of the form "prefix" or "prefix=>replace", +// where prefix must match a leading sequence of path elements +// and is either removed entirely or replaced by the replacement. +func AbsFile(dir, file, rewrites string) string { + abs := file + if dir != "" && !filepath.IsAbs(file) { + abs = filepath.Join(dir, file) + } + + abs, rewritten := ApplyRewrites(abs, rewrites) + if !rewritten && hasPathPrefix(abs, GOROOT) { + abs = "$GOROOT" + abs[len(GOROOT):] + } + + if abs == "" { + abs = "??" + } + return abs +} + +// ApplyRewrites returns the filename for file in the given directory, +// as rewritten by the rewrites argument. +// +// The rewrites argument is a ;-separated list of rewrites. +// Each rewrite is of the form "prefix" or "prefix=>replace", +// where prefix must match a leading sequence of path elements +// and is either removed entirely or replaced by the replacement. +func ApplyRewrites(file, rewrites string) (string, bool) { + start := 0 + for i := 0; i <= len(rewrites); i++ { + if i == len(rewrites) || rewrites[i] == ';' { + if new, ok := applyRewrite(file, rewrites[start:i]); ok { + return new, true + } + start = i + 1 + } + } + + return file, false +} + +// applyRewrite applies the rewrite to the path, +// returning the rewritten path and a boolean +// indicating whether the rewrite applied at all. +func applyRewrite(path, rewrite string) (string, bool) { + prefix, replace := rewrite, "" + if j := strings.LastIndex(rewrite, "=>"); j >= 0 { + prefix, replace = rewrite[:j], rewrite[j+len("=>"):] + } + + if prefix == "" || !hasPathPrefix(path, prefix) { + return path, false + } + if len(path) == len(prefix) { + return replace, true + } + if replace == "" { + return path[len(prefix)+1:], true + } + return replace + path[len(prefix):], true +} + +// Does s have t as a path prefix? +// That is, does s == t or does s begin with t followed by a slash? +// For portability, we allow ASCII case folding, so that hasPathPrefix("a/b/c", "A/B") is true. +// Similarly, we allow slash folding, so that hasPathPrefix("a/b/c", "a\\b") is true. +// We do not allow full Unicode case folding, for fear of causing more confusion +// or harm than good. (For an example of the kinds of things that can go wrong, +// see http://article.gmane.org/gmane.linux.kernel/1853266.) +func hasPathPrefix(s string, t string) bool { + if len(t) > len(s) { + return false + } + var i int + for i = 0; i < len(t); i++ { + cs := int(s[i]) + ct := int(t[i]) + if 'A' <= cs && cs <= 'Z' { + cs += 'a' - 'A' + } + if 'A' <= ct && ct <= 'Z' { + ct += 'a' - 'A' + } + if cs == '\\' { + cs = '/' + } + if ct == '\\' { + ct = '/' + } + if cs != ct { + return false + } + } + return i >= len(s) || s[i] == '/' || s[i] == '\\' +} diff --git a/src/cmd/internal/objabi/line_test.go b/src/cmd/internal/objabi/line_test.go new file mode 100644 index 0000000..1fa0ff1 --- /dev/null +++ b/src/cmd/internal/objabi/line_test.go @@ -0,0 +1,50 @@ +// Copyright 2019 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +import ( + "path/filepath" + "runtime" + "testing" +) + +// On Windows, "/foo" is reported as a relative path +// (it is relative to the current drive letter), +// so we need add a drive letter to test absolute path cases. +func drive() string { + if runtime.GOOS == "windows" { + return "c:" + } + return "" +} + +var absFileTests = []struct { + dir string + file string + rewrites string + abs string +}{ + {"/d", "f", "", "/d/f"}, + {"/d", drive() + "/f", "", drive() + "/f"}, + {"/d", "f/g", "", "/d/f/g"}, + {"/d", drive() + "/f/g", "", drive() + "/f/g"}, + + {"/d", "f", "/d/f", "??"}, + {"/d", "f/g", "/d/f", "g"}, + {"/d", "f/g", "/d/f=>h", "h/g"}, + {"/d", "f/g", "/d/f=>/h", "/h/g"}, + {"/d", "f/g", "/d/f=>/h;/d/e=>/i", "/h/g"}, + {"/d", "e/f", "/d/f=>/h;/d/e=>/i", "/i/f"}, +} + +func TestAbsFile(t *testing.T) { + for _, tt := range absFileTests { + abs := filepath.FromSlash(AbsFile(filepath.FromSlash(tt.dir), filepath.FromSlash(tt.file), tt.rewrites)) + want := filepath.FromSlash(tt.abs) + if abs != want { + t.Errorf("AbsFile(%q, %q, %q) = %q, want %q", tt.dir, tt.file, tt.rewrites, abs, want) + } + } +} diff --git a/src/cmd/internal/objabi/path.go b/src/cmd/internal/objabi/path.go new file mode 100644 index 0000000..fd1c998 --- /dev/null +++ b/src/cmd/internal/objabi/path.go @@ -0,0 +1,63 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +import "strings" + +// PathToPrefix converts raw string to the prefix that will be used in the +// symbol table. All control characters, space, '%' and '"', as well as +// non-7-bit clean bytes turn into %xx. The period needs escaping only in the +// last segment of the path, and it makes for happier users if we escape that as +// little as possible. +func PathToPrefix(s string) string { + slash := strings.LastIndex(s, "/") + // check for chars that need escaping + n := 0 + for r := 0; r < len(s); r++ { + if c := s[r]; c <= ' ' || (c == '.' && r > slash) || c == '%' || c == '"' || c >= 0x7F { + n++ + } + } + + // quick exit + if n == 0 { + return s + } + + // escape + const hex = "0123456789abcdef" + p := make([]byte, 0, len(s)+2*n) + for r := 0; r < len(s); r++ { + if c := s[r]; c <= ' ' || (c == '.' && r > slash) || c == '%' || c == '"' || c >= 0x7F { + p = append(p, '%', hex[c>>4], hex[c&0xF]) + } else { + p = append(p, c) + } + } + + return string(p) +} + +// IsRuntimePackagePath examines 'pkgpath' and returns TRUE if it +// belongs to the collection of "runtime-related" packages, including +// "runtime" itself, "reflect", "syscall", and the +// "runtime/internal/*" packages. The compiler and/or assembler in +// some cases need to be aware of when they are building such a +// package, for example to enable features such as ABI selectors in +// assembly sources. +func IsRuntimePackagePath(pkgpath string) bool { + rval := false + switch pkgpath { + case "runtime": + rval = true + case "reflect": + rval = true + case "syscall": + rval = true + default: + rval = strings.HasPrefix(pkgpath, "runtime/internal") + } + return rval +} diff --git a/src/cmd/internal/objabi/path_test.go b/src/cmd/internal/objabi/path_test.go new file mode 100644 index 0000000..05d7fb4 --- /dev/null +++ b/src/cmd/internal/objabi/path_test.go @@ -0,0 +1,33 @@ +// Copyright 2017 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +import "testing" + +func TestPathToPrefix(t *testing.T) { + tests := []struct { + Path string + Expected string + }{{"foo/bar/v1", "foo/bar/v1"}, + {"foo/bar/v.1", "foo/bar/v%2e1"}, + {"f.o.o/b.a.r/v1", "f.o.o/b.a.r/v1"}, + {"f.o.o/b.a.r/v.1", "f.o.o/b.a.r/v%2e1"}, + {"f.o.o/b.a.r/v..1", "f.o.o/b.a.r/v%2e%2e1"}, + {"f.o.o/b.a.r/v..1.", "f.o.o/b.a.r/v%2e%2e1%2e"}, + {"f.o.o/b.a.r/v%1", "f.o.o/b.a.r/v%251"}, + {"runtime", "runtime"}, + {"sync/atomic", "sync/atomic"}, + {"golang.org/x/tools/godoc", "golang.org/x/tools/godoc"}, + {"foo.bar/baz.quux", "foo.bar/baz%2equux"}, + {"", ""}, + {"%foo%bar", "%25foo%25bar"}, + {"\x01\x00\x7F☺", "%01%00%7f%e2%98%ba"}, + } + for _, tc := range tests { + if got := PathToPrefix(tc.Path); got != tc.Expected { + t.Errorf("expected PathToPrefix(%s) = %s, got %s", tc.Path, tc.Expected, got) + } + } +} diff --git a/src/cmd/internal/objabi/reloctype.go b/src/cmd/internal/objabi/reloctype.go new file mode 100644 index 0000000..649f690 --- /dev/null +++ b/src/cmd/internal/objabi/reloctype.go @@ -0,0 +1,291 @@ +// Derived from Inferno utils/6l/l.h and related files. +// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h +// +// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. +// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) +// Portions Copyright © 1997-1999 Vita Nuova Limited +// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) +// Portions Copyright © 2004,2006 Bruce Ellis +// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) +// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others +// Portions Copyright © 2009 The Go Authors. All rights reserved. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package objabi + +type RelocType int16 + +//go:generate stringer -type=RelocType +const ( + R_ADDR RelocType = 1 + iota + // R_ADDRPOWER relocates a pair of "D-form" instructions (instructions with 16-bit + // immediates in the low half of the instruction word), usually addis followed by + // another add or a load, inserting the "high adjusted" 16 bits of the address of + // the referenced symbol into the immediate field of the first instruction and the + // low 16 bits into that of the second instruction. + R_ADDRPOWER + // R_ADDRARM64 relocates an adrp, add pair to compute the address of the + // referenced symbol. + R_ADDRARM64 + // R_ADDRMIPS (only used on mips/mips64) resolves to the low 16 bits of an external + // address, by encoding it into the instruction. + R_ADDRMIPS + // R_ADDROFF resolves to a 32-bit offset from the beginning of the section + // holding the data being relocated to the referenced symbol. + R_ADDROFF + // R_WEAKADDROFF resolves just like R_ADDROFF but is a weak relocation. + // A weak relocation does not make the symbol it refers to reachable, + // and is only honored by the linker if the symbol is in some other way + // reachable. + R_WEAKADDROFF + R_SIZE + R_CALL + R_CALLARM + R_CALLARM64 + R_CALLIND + R_CALLPOWER + // R_CALLMIPS (only used on mips64) resolves to non-PC-relative target address + // of a CALL (JAL) instruction, by encoding the address into the instruction. + R_CALLMIPS + // R_CALLRISCV marks RISC-V CALLs for stack checking. + R_CALLRISCV + R_CONST + R_PCREL + // R_TLS_LE, used on 386, amd64, and ARM, resolves to the offset of the + // thread-local symbol from the thread local base and is used to implement the + // "local exec" model for tls access (r.Sym is not set on intel platforms but is + // set to a TLS symbol -- runtime.tlsg -- in the linker when externally linking). + R_TLS_LE + // R_TLS_IE, used 386, amd64, and ARM resolves to the PC-relative offset to a GOT + // slot containing the offset from the thread-local symbol from the thread local + // base and is used to implemented the "initial exec" model for tls access (r.Sym + // is not set on intel platforms but is set to a TLS symbol -- runtime.tlsg -- in + // the linker when externally linking). + R_TLS_IE + R_GOTOFF + R_PLT0 + R_PLT1 + R_PLT2 + R_USEFIELD + // R_USETYPE resolves to an *rtype, but no relocation is created. The + // linker uses this as a signal that the pointed-to type information + // should be linked into the final binary, even if there are no other + // direct references. (This is used for types reachable by reflection.) + R_USETYPE + // R_USEIFACE marks a type is converted to an interface in the function this + // relocation is applied to. The target is a type descriptor. + // This is a marker relocation (0-sized), for the linker's reachabililty + // analysis. + R_USEIFACE + // R_USEIFACEMETHOD marks an interface method that is used in the function + // this relocation is applied to. The target is an interface type descriptor. + // The addend is the offset of the method in the type descriptor. + // This is a marker relocation (0-sized), for the linker's reachabililty + // analysis. + R_USEIFACEMETHOD + // R_METHODOFF resolves to a 32-bit offset from the beginning of the section + // holding the data being relocated to the referenced symbol. + // It is a variant of R_ADDROFF used when linking from the uncommonType of a + // *rtype, and may be set to zero by the linker if it determines the method + // text is unreachable by the linked program. + R_METHODOFF + R_POWER_TOC + R_GOTPCREL + // R_JMPMIPS (only used on mips64) resolves to non-PC-relative target address + // of a JMP instruction, by encoding the address into the instruction. + // The stack nosplit check ignores this since it is not a function call. + R_JMPMIPS + + // R_DWARFSECREF resolves to the offset of the symbol from its section. + // Target of relocation must be size 4 (in current implementation). + R_DWARFSECREF + + // R_DWARFFILEREF resolves to an index into the DWARF .debug_line + // file table for the specified file symbol. Must be applied to an + // attribute of form DW_FORM_data4. + R_DWARFFILEREF + + // Platform dependent relocations. Architectures with fixed width instructions + // have the inherent issue that a 32-bit (or 64-bit!) displacement cannot be + // stuffed into a 32-bit instruction, so an address needs to be spread across + // several instructions, and in turn this requires a sequence of relocations, each + // updating a part of an instruction. This leads to relocation codes that are + // inherently processor specific. + + // Arm64. + + // Set a MOV[NZ] immediate field to bits [15:0] of the offset from the thread + // local base to the thread local variable defined by the referenced (thread + // local) symbol. Error if the offset does not fit into 16 bits. + R_ARM64_TLS_LE + + // Relocates an ADRP; LD64 instruction sequence to load the offset between + // the thread local base and the thread local variable defined by the + // referenced (thread local) symbol from the GOT. + R_ARM64_TLS_IE + + // R_ARM64_GOTPCREL relocates an adrp, ld64 pair to compute the address of the GOT + // slot of the referenced symbol. + R_ARM64_GOTPCREL + + // R_ARM64_GOT resolves a GOT-relative instruction sequence, usually an adrp + // followed by another ld instruction. + R_ARM64_GOT + + // R_ARM64_PCREL resolves a PC-relative addresses instruction sequence, usually an + // adrp followed by another add instruction. + R_ARM64_PCREL + + // R_ARM64_LDST8 sets a LD/ST immediate value to bits [11:0] of a local address. + R_ARM64_LDST8 + + // R_ARM64_LDST16 sets a LD/ST immediate value to bits [11:1] of a local address. + R_ARM64_LDST16 + + // R_ARM64_LDST32 sets a LD/ST immediate value to bits [11:2] of a local address. + R_ARM64_LDST32 + + // R_ARM64_LDST64 sets a LD/ST immediate value to bits [11:3] of a local address. + R_ARM64_LDST64 + + // R_ARM64_LDST128 sets a LD/ST immediate value to bits [11:4] of a local address. + R_ARM64_LDST128 + + // PPC64. + + // R_POWER_TLS_LE is used to implement the "local exec" model for tls + // access. It resolves to the offset of the thread-local symbol from the + // thread pointer (R13) and inserts this value into the low 16 bits of an + // instruction word. + R_POWER_TLS_LE + + // R_POWER_TLS_IE is used to implement the "initial exec" model for tls access. It + // relocates a D-form, DS-form instruction sequence like R_ADDRPOWER_DS. It + // inserts to the offset of GOT slot for the thread-local symbol from the TOC (the + // GOT slot is filled by the dynamic linker with the offset of the thread-local + // symbol from the thread pointer (R13)). + R_POWER_TLS_IE + + // R_POWER_TLS marks an X-form instruction such as "MOVD 0(R13)(R31*1), g" as + // accessing a particular thread-local symbol. It does not affect code generation + // but is used by the system linker when relaxing "initial exec" model code to + // "local exec" model code. + R_POWER_TLS + + // R_ADDRPOWER_DS is similar to R_ADDRPOWER above, but assumes the second + // instruction is a "DS-form" instruction, which has an immediate field occupying + // bits [15:2] of the instruction word. Bits [15:2] of the address of the + // relocated symbol are inserted into this field; it is an error if the last two + // bits of the address are not 0. + R_ADDRPOWER_DS + + // R_ADDRPOWER_PCREL relocates a D-form, DS-form instruction sequence like + // R_ADDRPOWER_DS but inserts the offset of the GOT slot for the referenced symbol + // from the TOC rather than the symbol's address. + R_ADDRPOWER_GOT + + // R_ADDRPOWER_PCREL relocates two D-form instructions like R_ADDRPOWER, but + // inserts the displacement from the place being relocated to the address of the + // relocated symbol instead of just its address. + R_ADDRPOWER_PCREL + + // R_ADDRPOWER_TOCREL relocates two D-form instructions like R_ADDRPOWER, but + // inserts the offset from the TOC to the address of the relocated symbol + // rather than the symbol's address. + R_ADDRPOWER_TOCREL + + // R_ADDRPOWER_TOCREL relocates a D-form, DS-form instruction sequence like + // R_ADDRPOWER_DS but inserts the offset from the TOC to the address of the + // relocated symbol rather than the symbol's address. + R_ADDRPOWER_TOCREL_DS + + // RISC-V. + + // R_RISCV_PCREL_ITYPE resolves a 32-bit PC-relative address using an + // AUIPC + I-type instruction pair. + R_RISCV_PCREL_ITYPE + + // R_RISCV_PCREL_STYPE resolves a 32-bit PC-relative address using an + // AUIPC + S-type instruction pair. + R_RISCV_PCREL_STYPE + + // R_RISCV_TLS_IE_ITYPE resolves a 32-bit TLS initial-exec TOC offset + // address using an AUIPC + I-type instruction pair. + R_RISCV_TLS_IE_ITYPE + + // R_RISCV_TLS_IE_STYPE resolves a 32-bit TLS initial-exec TOC offset + // address using an AUIPC + S-type instruction pair. + R_RISCV_TLS_IE_STYPE + + // R_PCRELDBL relocates s390x 2-byte aligned PC-relative addresses. + // TODO(mundaym): remove once variants can be serialized - see issue 14218. + R_PCRELDBL + + // R_ADDRMIPSU (only used on mips/mips64) resolves to the sign-adjusted "upper" 16 + // bits (bit 16-31) of an external address, by encoding it into the instruction. + R_ADDRMIPSU + // R_ADDRMIPSTLS (only used on mips64) resolves to the low 16 bits of a TLS + // address (offset from thread pointer), by encoding it into the instruction. + R_ADDRMIPSTLS + + // R_ADDRCUOFF resolves to a pointer-sized offset from the start of the + // symbol's DWARF compile unit. + R_ADDRCUOFF + + // R_WASMIMPORT resolves to the index of the WebAssembly function import. + R_WASMIMPORT + + // R_XCOFFREF (only used on aix/ppc64) prevents garbage collection by ld + // of a symbol. This isn't a real relocation, it can be placed in anywhere + // in a symbol and target any symbols. + R_XCOFFREF +) + +// IsDirectCall reports whether r is a relocation for a direct call. +// A direct call is a CALL instruction that takes the target address +// as an immediate. The address is embedded into the instruction, possibly +// with limited width. An indirect call is a CALL instruction that takes +// the target address in register or memory. +func (r RelocType) IsDirectCall() bool { + switch r { + case R_CALL, R_CALLARM, R_CALLARM64, R_CALLMIPS, R_CALLPOWER, R_CALLRISCV: + return true + } + return false +} + +// IsDirectJump reports whether r is a relocation for a direct jump. +// A direct jump is a JMP instruction that takes the target address +// as an immediate. The address is embedded into the instruction, possibly +// with limited width. An indirect jump is a JMP instruction that takes +// the target address in register or memory. +func (r RelocType) IsDirectJump() bool { + switch r { + case R_JMPMIPS: + return true + } + return false +} + +// IsDirectCallOrJump reports whether r is a relocation for a direct +// call or a direct jump. +func (r RelocType) IsDirectCallOrJump() bool { + return r.IsDirectCall() || r.IsDirectJump() +} diff --git a/src/cmd/internal/objabi/reloctype_string.go b/src/cmd/internal/objabi/reloctype_string.go new file mode 100644 index 0000000..658a44f --- /dev/null +++ b/src/cmd/internal/objabi/reloctype_string.go @@ -0,0 +1,83 @@ +// Code generated by "stringer -type=RelocType"; DO NOT EDIT. + +package objabi + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[R_ADDR-1] + _ = x[R_ADDRPOWER-2] + _ = x[R_ADDRARM64-3] + _ = x[R_ADDRMIPS-4] + _ = x[R_ADDROFF-5] + _ = x[R_WEAKADDROFF-6] + _ = x[R_SIZE-7] + _ = x[R_CALL-8] + _ = x[R_CALLARM-9] + _ = x[R_CALLARM64-10] + _ = x[R_CALLIND-11] + _ = x[R_CALLPOWER-12] + _ = x[R_CALLMIPS-13] + _ = x[R_CALLRISCV-14] + _ = x[R_CONST-15] + _ = x[R_PCREL-16] + _ = x[R_TLS_LE-17] + _ = x[R_TLS_IE-18] + _ = x[R_GOTOFF-19] + _ = x[R_PLT0-20] + _ = x[R_PLT1-21] + _ = x[R_PLT2-22] + _ = x[R_USEFIELD-23] + _ = x[R_USETYPE-24] + _ = x[R_USEIFACE-25] + _ = x[R_USEIFACEMETHOD-26] + _ = x[R_METHODOFF-27] + _ = x[R_POWER_TOC-28] + _ = x[R_GOTPCREL-29] + _ = x[R_JMPMIPS-30] + _ = x[R_DWARFSECREF-31] + _ = x[R_DWARFFILEREF-32] + _ = x[R_ARM64_TLS_LE-33] + _ = x[R_ARM64_TLS_IE-34] + _ = x[R_ARM64_GOTPCREL-35] + _ = x[R_ARM64_GOT-36] + _ = x[R_ARM64_PCREL-37] + _ = x[R_ARM64_LDST8-38] + _ = x[R_ARM64_LDST16-39] + _ = x[R_ARM64_LDST32-40] + _ = x[R_ARM64_LDST64-41] + _ = x[R_ARM64_LDST128-42] + _ = x[R_POWER_TLS_LE-43] + _ = x[R_POWER_TLS_IE-44] + _ = x[R_POWER_TLS-45] + _ = x[R_ADDRPOWER_DS-46] + _ = x[R_ADDRPOWER_GOT-47] + _ = x[R_ADDRPOWER_PCREL-48] + _ = x[R_ADDRPOWER_TOCREL-49] + _ = x[R_ADDRPOWER_TOCREL_DS-50] + _ = x[R_RISCV_PCREL_ITYPE-51] + _ = x[R_RISCV_PCREL_STYPE-52] + _ = x[R_RISCV_TLS_IE_ITYPE-53] + _ = x[R_RISCV_TLS_IE_STYPE-54] + _ = x[R_PCRELDBL-55] + _ = x[R_ADDRMIPSU-56] + _ = x[R_ADDRMIPSTLS-57] + _ = x[R_ADDRCUOFF-58] + _ = x[R_WASMIMPORT-59] + _ = x[R_XCOFFREF-60] +} + +const _RelocType_name = "R_ADDRR_ADDRPOWERR_ADDRARM64R_ADDRMIPSR_ADDROFFR_WEAKADDROFFR_SIZER_CALLR_CALLARMR_CALLARM64R_CALLINDR_CALLPOWERR_CALLMIPSR_CALLRISCVR_CONSTR_PCRELR_TLS_LER_TLS_IER_GOTOFFR_PLT0R_PLT1R_PLT2R_USEFIELDR_USETYPER_USEIFACER_USEIFACEMETHODR_METHODOFFR_POWER_TOCR_GOTPCRELR_JMPMIPSR_DWARFSECREFR_DWARFFILEREFR_ARM64_TLS_LER_ARM64_TLS_IER_ARM64_GOTPCRELR_ARM64_GOTR_ARM64_PCRELR_ARM64_LDST8R_ARM64_LDST16R_ARM64_LDST32R_ARM64_LDST64R_ARM64_LDST128R_POWER_TLS_LER_POWER_TLS_IER_POWER_TLSR_ADDRPOWER_DSR_ADDRPOWER_GOTR_ADDRPOWER_PCRELR_ADDRPOWER_TOCRELR_ADDRPOWER_TOCREL_DSR_RISCV_PCREL_ITYPER_RISCV_PCREL_STYPER_RISCV_TLS_IE_ITYPER_RISCV_TLS_IE_STYPER_PCRELDBLR_ADDRMIPSUR_ADDRMIPSTLSR_ADDRCUOFFR_WASMIMPORTR_XCOFFREF" + +var _RelocType_index = [...]uint16{0, 6, 17, 28, 38, 47, 60, 66, 72, 81, 92, 101, 112, 122, 133, 140, 147, 155, 163, 171, 177, 183, 189, 199, 208, 218, 234, 245, 256, 266, 275, 288, 302, 316, 330, 346, 357, 370, 383, 397, 411, 425, 440, 454, 468, 479, 493, 508, 525, 543, 564, 583, 602, 622, 642, 652, 663, 676, 687, 699, 709} + +func (i RelocType) String() string { + i -= 1 + if i < 0 || i >= RelocType(len(_RelocType_index)-1) { + return "RelocType(" + strconv.FormatInt(int64(i+1), 10) + ")" + } + return _RelocType_name[_RelocType_index[i]:_RelocType_index[i+1]] +} diff --git a/src/cmd/internal/objabi/stack.go b/src/cmd/internal/objabi/stack.go new file mode 100644 index 0000000..05a1d4a --- /dev/null +++ b/src/cmd/internal/objabi/stack.go @@ -0,0 +1,33 @@ +// Copyright 2011 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +// For the linkers. Must match Go definitions. + +const ( + STACKSYSTEM = 0 + StackSystem = STACKSYSTEM + StackBig = 4096 + StackSmall = 128 +) + +const ( + StackPreempt = -1314 // 0xfff...fade +) + +// Initialize StackGuard and StackLimit according to target system. +var StackGuard = 928*stackGuardMultiplier() + StackSystem +var StackLimit = StackGuard - StackSystem - StackSmall + +// stackGuardMultiplier returns a multiplier to apply to the default +// stack guard size. Larger multipliers are used for non-optimized +// builds that have larger stack frames or for specific targets. +func stackGuardMultiplier() int { + // On AIX, a larger stack is needed for syscalls. + if GOOS == "aix" { + return 2 + } + return stackGuardMultiplierDefault +} diff --git a/src/cmd/internal/objabi/symkind.go b/src/cmd/internal/objabi/symkind.go new file mode 100644 index 0000000..6c99112 --- /dev/null +++ b/src/cmd/internal/objabi/symkind.go @@ -0,0 +1,79 @@ +// Derived from Inferno utils/6l/l.h and related files. +// https://bitbucket.org/inferno-os/inferno-os/src/master/utils/6l/l.h +// +// Copyright © 1994-1999 Lucent Technologies Inc. All rights reserved. +// Portions Copyright © 1995-1997 C H Forsyth (forsyth@terzarima.net) +// Portions Copyright © 1997-1999 Vita Nuova Limited +// Portions Copyright © 2000-2007 Vita Nuova Holdings Limited (www.vitanuova.com) +// Portions Copyright © 2004,2006 Bruce Ellis +// Portions Copyright © 2005-2007 C H Forsyth (forsyth@terzarima.net) +// Revisions Copyright © 2000-2007 Lucent Technologies Inc. and others +// Portions Copyright © 2009 The Go Authors. All rights reserved. +// +// Permission is hereby granted, free of charge, to any person obtaining a copy +// of this software and associated documentation files (the "Software"), to deal +// in the Software without restriction, including without limitation the rights +// to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +// copies of the Software, and to permit persons to whom the Software is +// furnished to do so, subject to the following conditions: +// +// The above copyright notice and this permission notice shall be included in +// all copies or substantial portions of the Software. +// +// THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +// IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +// FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +// AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +// LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +// OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN +// THE SOFTWARE. + +package objabi + +// A SymKind describes the kind of memory represented by a symbol. +type SymKind uint8 + +// Defined SymKind values. +// These are used to index into cmd/link/internal/sym/AbiSymKindToSymKind +// +// TODO(rsc): Give idiomatic Go names. +//go:generate stringer -type=SymKind +const ( + // An otherwise invalid zero value for the type + Sxxx SymKind = iota + // Executable instructions + STEXT + // Read only static data + SRODATA + // Static data that does not contain any pointers + SNOPTRDATA + // Static data + SDATA + // Statically data that is initially all 0s + SBSS + // Statically data that is initially all 0s and does not contain pointers + SNOPTRBSS + // Thread-local data that is initially all 0s + STLSBSS + // Debugging data + SDWARFCUINFO + SDWARFCONST + SDWARFFCN + SDWARFABSFCN + SDWARFTYPE + SDWARFVAR + SDWARFRANGE + SDWARFLOC + SDWARFLINES + // ABI alias. An ABI alias symbol is an empty symbol with a + // single relocation with 0 size that references the native + // function implementation symbol. + // + // TODO(austin): Remove this and all uses once the compiler + // generates real ABI wrappers rather than symbol aliases. + SABIALIAS + // Coverage instrumentation counter for libfuzzer. + SLIBFUZZER_EXTRA_COUNTER + // Update cmd/link/internal/sym/AbiSymKindToSymKind for new SymKind values. + +) diff --git a/src/cmd/internal/objabi/symkind_string.go b/src/cmd/internal/objabi/symkind_string.go new file mode 100644 index 0000000..1b1c394 --- /dev/null +++ b/src/cmd/internal/objabi/symkind_string.go @@ -0,0 +1,41 @@ +// Code generated by "stringer -type=SymKind"; DO NOT EDIT. + +package objabi + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[Sxxx-0] + _ = x[STEXT-1] + _ = x[SRODATA-2] + _ = x[SNOPTRDATA-3] + _ = x[SDATA-4] + _ = x[SBSS-5] + _ = x[SNOPTRBSS-6] + _ = x[STLSBSS-7] + _ = x[SDWARFCUINFO-8] + _ = x[SDWARFCONST-9] + _ = x[SDWARFFCN-10] + _ = x[SDWARFABSFCN-11] + _ = x[SDWARFTYPE-12] + _ = x[SDWARFVAR-13] + _ = x[SDWARFRANGE-14] + _ = x[SDWARFLOC-15] + _ = x[SDWARFLINES-16] + _ = x[SABIALIAS-17] + _ = x[SLIBFUZZER_EXTRA_COUNTER-18] +} + +const _SymKind_name = "SxxxSTEXTSRODATASNOPTRDATASDATASBSSSNOPTRBSSSTLSBSSSDWARFCUINFOSDWARFCONSTSDWARFFCNSDWARFABSFCNSDWARFTYPESDWARFVARSDWARFRANGESDWARFLOCSDWARFLINESSABIALIASSLIBFUZZER_EXTRA_COUNTER" + +var _SymKind_index = [...]uint8{0, 4, 9, 16, 26, 31, 35, 44, 51, 63, 74, 83, 95, 105, 114, 125, 134, 145, 154, 178} + +func (i SymKind) String() string { + if i >= SymKind(len(_SymKind_index)-1) { + return "SymKind(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _SymKind_name[_SymKind_index[i]:_SymKind_index[i+1]] +} diff --git a/src/cmd/internal/objabi/typekind.go b/src/cmd/internal/objabi/typekind.go new file mode 100644 index 0000000..990ff18 --- /dev/null +++ b/src/cmd/internal/objabi/typekind.go @@ -0,0 +1,40 @@ +// Copyright 2012 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +// Must match runtime and reflect. +// Included by cmd/gc. + +const ( + KindBool = 1 + iota + KindInt + KindInt8 + KindInt16 + KindInt32 + KindInt64 + KindUint + KindUint8 + KindUint16 + KindUint32 + KindUint64 + KindUintptr + KindFloat32 + KindFloat64 + KindComplex64 + KindComplex128 + KindArray + KindChan + KindFunc + KindInterface + KindMap + KindPtr + KindSlice + KindString + KindStruct + KindUnsafePointer + KindDirectIface = 1 << 5 + KindGCProg = 1 << 6 + KindMask = (1 << 5) - 1 +) diff --git a/src/cmd/internal/objabi/util.go b/src/cmd/internal/objabi/util.go new file mode 100644 index 0000000..a73ab47 --- /dev/null +++ b/src/cmd/internal/objabi/util.go @@ -0,0 +1,201 @@ +// Copyright 2015 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package objabi + +import ( + "fmt" + "log" + "os" + "strings" +) + +func envOr(key, value string) string { + if x := os.Getenv(key); x != "" { + return x + } + return value +} + +var ( + defaultGOROOT string // set by linker + + GOROOT = envOr("GOROOT", defaultGOROOT) + GOARCH = envOr("GOARCH", defaultGOARCH) + GOOS = envOr("GOOS", defaultGOOS) + GO386 = envOr("GO386", defaultGO386) + GOARM = goarm() + GOMIPS = gomips() + GOMIPS64 = gomips64() + GOPPC64 = goppc64() + GOWASM = gowasm() + GO_LDSO = defaultGO_LDSO + Version = version +) + +const ( + ElfRelocOffset = 256 + MachoRelocOffset = 2048 // reserve enough space for ELF relocations +) + +func goarm() int { + def := defaultGOARM + if GOOS == "android" && GOARCH == "arm" { + // Android arm devices always support GOARM=7. + def = "7" + } + switch v := envOr("GOARM", def); v { + case "5": + return 5 + case "6": + return 6 + case "7": + return 7 + } + // Fail here, rather than validate at multiple call sites. + log.Fatalf("Invalid GOARM value. Must be 5, 6, or 7.") + panic("unreachable") +} + +func gomips() string { + switch v := envOr("GOMIPS", defaultGOMIPS); v { + case "hardfloat", "softfloat": + return v + } + log.Fatalf("Invalid GOMIPS value. Must be hardfloat or softfloat.") + panic("unreachable") +} + +func gomips64() string { + switch v := envOr("GOMIPS64", defaultGOMIPS64); v { + case "hardfloat", "softfloat": + return v + } + log.Fatalf("Invalid GOMIPS64 value. Must be hardfloat or softfloat.") + panic("unreachable") +} + +func goppc64() int { + switch v := envOr("GOPPC64", defaultGOPPC64); v { + case "power8": + return 8 + case "power9": + return 9 + } + log.Fatalf("Invalid GOPPC64 value. Must be power8 or power9.") + panic("unreachable") +} + +type gowasmFeatures struct { + SignExt bool + SatConv bool +} + +func (f gowasmFeatures) String() string { + var flags []string + if f.SatConv { + flags = append(flags, "satconv") + } + if f.SignExt { + flags = append(flags, "signext") + } + return strings.Join(flags, ",") +} + +func gowasm() (f gowasmFeatures) { + for _, opt := range strings.Split(envOr("GOWASM", ""), ",") { + switch opt { + case "satconv": + f.SatConv = true + case "signext": + f.SignExt = true + case "": + // ignore + default: + log.Fatalf("Invalid GOWASM value. No such feature: " + opt) + } + } + return +} + +func Getgoextlinkenabled() string { + return envOr("GO_EXTLINK_ENABLED", defaultGO_EXTLINK_ENABLED) +} + +func init() { + for _, f := range strings.Split(goexperiment, ",") { + if f != "" { + addexp(f) + } + } + + // regabi is only supported on amd64. + if GOARCH != "amd64" { + Regabi_enabled = 0 + } +} + +// Note: must agree with runtime.framepointer_enabled. +var Framepointer_enabled = GOARCH == "amd64" || GOARCH == "arm64" && (GOOS == "linux" || GOOS == "darwin" || GOOS == "ios") + +func addexp(s string) { + // Could do general integer parsing here, but the runtime copy doesn't yet. + v := 1 + name := s + if len(name) > 2 && name[:2] == "no" { + v = 0 + name = name[2:] + } + for i := 0; i < len(exper); i++ { + if exper[i].name == name { + if exper[i].val != nil { + *exper[i].val = v + } + return + } + } + + fmt.Printf("unknown experiment %s\n", s) + os.Exit(2) +} + +var ( + Fieldtrack_enabled int + Preemptibleloops_enabled int + Staticlockranking_enabled int + Regabi_enabled int +) + +// Toolchain experiments. +// These are controlled by the GOEXPERIMENT environment +// variable recorded when the toolchain is built. +// This list is also known to cmd/gc. +var exper = []struct { + name string + val *int +}{ + {"fieldtrack", &Fieldtrack_enabled}, + {"preemptibleloops", &Preemptibleloops_enabled}, + {"staticlockranking", &Staticlockranking_enabled}, + {"regabi", &Regabi_enabled}, +} + +var defaultExpstring = Expstring() + +func DefaultExpstring() string { + return defaultExpstring +} + +func Expstring() string { + buf := "X" + for i := range exper { + if *exper[i].val != 0 { + buf += "," + exper[i].name + } + } + if buf == "X" { + buf += ",none" + } + return "X:" + buf[2:] +} |