Adding upstream version 2.10.34.upstream/2.10.34upstream

Signed-off-by: Daniel Baumann <daniel.baumann@progress-linux.org>

1 files changed, 21166 insertions, 0 deletions

diff --git a/ChangeLog.pre-2-2 b/ChangeLog.pre-2-2
new file mode 100644
index 0000000..2703e81
--- /dev/null
+++ b/ChangeLog.pre-2-2
@@ -0,0 +1,21166 @@
+2004-12-19  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.2.0 release.
+
+2004-12-18  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimprotatetool.c (gimp_rotate_tool_dialog): fixed label.
+
+2004-12-18  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/resize-dialog.c: free the dialog's private data
+	struct using a weak reference, not in a "destroy" handler.  Should
+	fix bug #161472.
+
+	* app/dialogs/print-size-dialog.c
+	* app/dialogs/scale-dialog.c: same change here.
+
+2004-12-18  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/quit-dialog.c: marked a message for translation that
+	had been forgotten. Fixes bug #161596.
+
+2004-12-17  Sven Neumann  <sven@gimp.org>
+
+	* autogen.sh: check for gtk-doc.m4, depend on intltool > 0.31.
+
+2004-12-17  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpmovetool.c (gimp_move_tool_cursor_update): don't
+	use the rect-select cursor if the tool is in move-layer mode.
+	Spotted by Joao S. O. Bueno, bug #161465.
+
+2004-12-17  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimpcurvestool.c: Kill some nonsensical code that
+	tried to set control points in a free form curve based on the
+	image coordinates (huh?). Update the Graph after adding a point.
+	Untabbified.
+
+2004-12-17  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_pick_color):
+	take drawable offsets into account. Fixes bug #161508.
+
+2004-12-17  Sven Neumann  <sven@gimp.org>
+
+	* docs/gimp-remote.1.in
+	* docs/gimp.1.in
+	* docs/gimptool.1.in: minor tweaks.
+
+2004-12-17  Simon Budig  <simon@gimp.org>
+
+	* data/images/gimp-splash.png: Added new splash by
+	Bill Luhtala <bluhtala@telus.net>.
+
+	* data/images/gimp-logo.png: Added new Image for the about dialog
+	by Philip Lafleur <deathpudding@gmail.com>.
+
+	* app/dialogs/about-dialog.c: Adjusted text colors and placement
+	to the new image.
+
+	* data/images/gimp2_0_logo.png
+	* data/images/gimp2_0_splash.png: Added for historical reasons.
+
+	* data/images/gimp_logo.png: Removed (renamed to gimp-logo.png)
+	* data/images/Makefile.am: changed accordingly.
+
+2004-12-16  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/core/gimpgradient-load.c: reject .ggr files whose 
+	segments don't properly span the range 0-1.
+	Fixes bug #161430.
+	
+2004-12-16  Manish Singh  <yosh@gimp.org>
+
+	* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_set_property): Cast
+	result of g_value_dup_object() to GIMP_CONTEXT().
+
+2004-12-16  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/script-fu/scripts/circuit.scm: don't try to
+	desaturate a grayscale layer, fixes bug #161470.
+
+2004-12-16  Sven Neumann  <sven@gimp.org>
+
+	* INSTALL: updated location of fontconfig sources.
+
+2004-12-16  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpconfig-dump.c
+	* docs/gimp-remote.1.in
+	* docs/gimp.1.in
+	* docs/gimprc.5.in: hyphens revisited.
+
+2004-12-16  Sven Neumann  <neumann@jpk.com>
+
+	* app/config/gimpconfig-dump.c (dump_gimprc_manpage): escape hyphens.
+
+	* docs/gimp.1.in: documented the way that splash images are choosen.
+
+	* docs/gimprc.5.in: regenerated.
+
+2004-12-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/actions.c (action_data_get_*): get gimp, display or
+	image from a context only if it isn't NULL. Fixes warnings and
+	crashes when dragging around some dockables (the dockables'
+	context temporarily becomes NULL while dragging).
+
+	Reordered checks for the passed "data" to be consistent across the
+	various functions.
+
+	Removed assertions which said "#warning: remove me before 2.2"
+
+2004-12-16  Sven Neumann  <neumann@jpk.com>
+
+	* app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog):
+	added a note on how to use the dialog, copied from the GNOME keyboard
+	shortcuts editor.
+
+2004-12-15  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/text_tool.pdb: let gimp_text() and
+	gimp_text_fontname() succeed but return -1 if no layer was created.
+	Fixes bug #161272.
+
+	* app/pdb/text_tool_cmds.c
+	* libgimp/gimptexttool_pdb.c: regenerated.
+
+2004-12-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable-preview.[ch]: added utility function
+	gimp_drawable_preview_bytes() and use it. Some cleanup,
+	untabified.
+
+	* app/widgets/gimpviewrendererdrawable.c: use
+	gimp_drawable_preview_bytes() instead of duplicating its code.
+
+2004-12-15  Michael Natterer  <mitch@gimp.org>
+	    Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdrawable-preview.c (gimp_drawable_preview_scale):
+	fixed RGBA resampling by using premultiplied values for the
+	intermediate accumulation buffer. Fixes bugs #72880 and #72881.
+
+2004-12-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-proc-frame.[ch]: added "gint ref_count" to
+	the PlugInProcFrame struct. Added new functions
+	plug_in_proc_frame_ref/unref().
+
+	(plug_in_proc_frame_new): set the ref_count to 1.
+
+	* app/plug-in/plug-in.[ch] (plug_in_proc_frame_push): return the
+	new proc_frame.
+
+	(plug_in_proc_frame_pop): use unref() instead of free().
+
+	* app/plug-in/plug-in-run.c (plug_in_temp_run): ref the proc_frame
+	while running its main loop. Removed the call to
+	plug_in_proc_frame_pop().
+
+	* app/plug-in/plug-in-message.c (plug_in_handle_temp_proc_return):
+	call plug_in_proc_frame_pop() immediately after
+	plug_in_main_loop_quit() so the proc_frame goes away from the
+	stack and can't be used accidentially if the core is too busy to
+	return to the main loop before the next command arrives on the
+	wire. Really fixes bug #161114 this time.
+
+2004-12-14  Simon Budig  <simon@gimp.org>
+
+	* app/vectors/gimpstroke.[ch]: Changed the "gradient" parameter
+	to "slope" to make it more clear what the returned result is (which
+	was wrong earlier).
+	* tools/pdbgen/pdb/paths.pdb: changed accordingly
+
+	* app/pdb/paths_cmds.c
+	* libgimp/gimppaths_pdb.[ch]: regenerated.
+
+	Fixes bug #161274.
+
+2004-12-14  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/imagemap/imap_selection.c: don't use 
+	gtk_tree_selection_get_selected with GTK_SELECTION_MULTIPLE. Should
+	finally fix bug #149157.
+
+2004-12-14  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpstock.c (gimp_stock_init): documented.
+
+2004-12-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_misc.c (make_toolbar_radio_icon): don't
+	call gtk_radio_tool_button_new_with_stock_from_widget() with a
+	NULL widget. Fixes bug #161210.
+
+2004-12-14  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: added GIMP_API_VERSION to the generated gimpversion.h.
+
+	* libgimpbase/gimpenv.c (gimp_toplevel_directory): use
+	GIMP_API_VERSION instead of GIMP_MACRO_VERSION.GIMP_MINOR_VERSION
+	when building a path to test the plug-in executable path against.
+
+2004-12-14  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/drawable.pdb: added gimp_drawable_sub_thumbnail()
+	to enable plug-ins avoiding #142074-alike bugs if they need to.
+
+	* app/pdb/drawable_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpdrawable_pdb.[ch]: regenerated.
+
+	* libgimp/gimpdrawable.[ch]
+	* libgimp/gimppixbuf.[ch]: wrap it with the same convenience
+	APIs as gimp_drawable_thumbnail().
+
+	* libgimp/gimp.def
+	* libgimp/gimpui.def: changed accordingly.
+
+2004-12-13  Sven Neumann  <sven@gimp.org>
+
+	* HACKING
+	* autogen.sh
+	* configure.in: switched to using gtkdocize for the build of the
+	API docs.
+
+2004-12-13  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/imagemap/imap_selection.c: don't try do to anything when
+	selection is empty. Fixes bug #149157.
+
+2004-12-13  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/imagemap/imap_misc.[ch]
+	* plug-ins/imagemap/imap_selection.[ch]
+	* plug-ins/imagemap/imap_toolbar.[ch]
+	* plug-ins/imagemap/imap_tools.[ch]: removed need for 
+	GTK_DISABLE_DEPRECATED. Looking at #149157 next...
+
+2004-12-13  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpcroptool.c: don't show the Crop tool window if
+	Shift is being pressed on the initial button_press event.
+
+2004-12-13  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/pygimp/gimpfu.py: display PF_RADIO options vertically
+	instead of horizontally, as suggested by Joao S. O. Bueno Calligaris.
+	Fixes bug #160546.
+	
+2004-12-13  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/gfig/gfig.c: make the "gfig" layer parasites persistent,
+	so that they will be saved in xcf files.  Stop printing "GFig
+	parasite found" message.
+	
+2004-12-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimppdbdialog.[ch]: don't forget the context we
+	were created with but rmember it as pdb_dialog->caller_context.
+
+	* app/widgets/gimpbrushselect.c
+	* app/widgets/gimpfontselect.c
+	* app/widgets/gimpgradientselect.c
+	* app/widgets/gimppaletteselect.c
+	* app/widgets/gimppatternselect.c: use the caller_context when
+	calling the temp_proc so the temp_proc's stack frame doesn't
+	contain the dialog's private context (which is just a scratch
+	model for the container views) but the plug-in's real context
+	which is fully initialized. Fixes bug #161114.
+
+2004-12-13  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablecombobox.c: fixed gtk-doc comment.
+
+2004-12-13  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-style.c: let objects keep their own fill_style
+	context.
+
+2004-12-13  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimage-convert.c: applied patch from Adam D. Moss with
+	more fixed dither improvements (bug #161123).
+
+2004-12-13  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/splash.c: restrict splash image to screen size to guard us
+	from insanely large splash images.
+
+2004-12-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdock.c (gimp_dock_delete_event): invert logic so
+	everything except GTK_RESPONSE_OK keeps the dock open
+	(e.g. hitting escape).
+
+2004-12-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable-preview.c (gimp_drawable_get_sub_preview):
+	added precondition check for the coords of the src area. Some
+	cleanup and simplification.
+
+	* app/widgets/gimpviewrendererdrawable.c
+	(gimp_view_renderer_drawable_render): don't request sub-previews
+	of area outside the drawable and don't reuqest previews of zero
+	width or height. Fixes crashes with the new preview code.
+
+2004-12-12  Sven Neumann  <sven@gimp.org>
+
+	Applied patch from Adam D. Moss (bug #161113):
+	
+	* app/core/gimpimage-convert.c: Use a slower but much nicer
+	technique for finding the two best colours to dither between when
+	using fixed/positional dither methods.  Makes positional dither
+	much less lame.
+
+2004-12-12  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/film.c (film): push a context around code that
+	changes the foreground color.
+
+2004-12-12  Sven Neumann  <sven@gimp.org>
+
+	* app/batch.c (batch_run): changed handling of the 'gimp -b -'
+	command-line. It used to spawn three instances of Script-Fu, two
+	should be more than enough.
+
+2004-12-12  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/widgets/gimpdataeditor.c: make Revert button insensitive
+	because revert is not yet implemented (bug #152259).
+	
+2004-12-12  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpdock.c: show a confirmation dialog if a dock
+	with multiple tabs is being closed. Sorry for the new strings,
+	they were carefully copied from gnome-terminal.
+
+2004-12-12  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/pnm.c: make export do the right thing when
+	saving as .pgm or .ppm.  Fixes bug #160045.
+	
+2004-12-12  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimp.def: added gimp_edit_copy_visible.
+
+	* plug-ins/script-fu/scripts/copy-visible.scm: deprecated.
+
+2004-12-12  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/winclipboard.c: applied patch from Brion Vibber
+	that adds an alpha channel to the pasted layer. Fixes bug #148601.
+
+2004-12-12  Sven Neumann  <sven@gimp.org>
+
+	* app/base/tile-manager-crop.c: removed trailing whitespace.
+
+	* plug-ins/imagemap/imap_selection.c: need to define
+	GTK_DISABLE_DEPRECATED for gtk_toolbar_append_space().
+
+2004-12-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint-funcs/paint-funcs.[ch]: added new function
+	copy_region_nocow() as a workaround for the fact that sharing
+	tiles with the projection is heavily broken.
+
+	* app/base/tile-manager.c (tile_invalidate): added a warning when
+	entering the code path that breaks badly.
+
+	* app/core/gimp-edit.[ch]: added gimp_edit_copy_visible(), using
+	the non-COW copying function above.
+
+	* app/widgets/gimphelp-ids.h: added GIMP_HELP_COPY_VISIBLE.
+
+	* app/actions/edit-actions.c
+	* app/actions/edit-commands.[ch]: added action & callback for
+	"edit-copy-visible".
+
+	* menus/image-menu.xml.in: added "edit-copy-visible" to the image
+	menu.
+
+	* tools/pdbgen/pdb/edit.pdb: added gimp_edit_copy_visible()
+	PDB wrapper.
+
+	* app/pdb/edit_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpedit_pdb.[ch]: regenerated.
+
+	* plug-ins/script-fu/scripts/copy-visible.scm: removed all code
+	and made it a backward compat wrapper around gimp-edit-copy-visible.
+	Fixes bug #138662.
+
+2004-12-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable-preview.c (gimp_drawable_preview_private):
+	implement it using gimp_drawable_get_sub_preview(). Removes
+	massive code duplication introduced by yesterday's fix.
+
+2004-12-11  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/copy-visible.scm: Apply the layer mask
+	when copying a single layer with a layer mask. Fixes bug #138662.
+
+	* plug-ins/script-fu/scripts/t-o-p-logo.scm: Removed ' character.
+
+2004-12-11  Sven Neumann  <sven@gimp.org>
+
+	* INSTALL
+	* NEWS
+	* README: updates for the GIMP 2.2.0 release.
+
+2004-12-11  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/unsharp.c: got rid of a global variable.
+
+	* plug-ins/common/bumpmap.c (dialog_bumpmap_callback): more changes
+	to restore the gimp-2.0 behaviour.
+
+2004-12-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable-preview.[ch]: added new function
+	gimp_drawable_get_sub_preview() which returns a scaled preview of
+	a part of a drawable.
+
+	(gimp_drawable_preview_scale): made it work with srcPR.x and
+	srcPR.y being != 0.
+
+	* app/core/gimpimage-preview.c (gimp_image_get_new_preview)
+	* app/widgets/gimpviewrendererdrawable.c
+	(gimp_view_renderer_drawable_render): if the area of the drawable
+	preview is more than 4 times larger than the drawable itself (evil
+	heuristic, but seems to work fine), use above function to get a
+	sub-preview of the drawable instead of getting an insanely large
+	preview of the whole drawable just to use a small part of it.
+	Fixes bug #142074.
+
+	* app/core/gimpimage-preview.c (gimp_image_get_new_preview):
+	optimized by skipping layers which do not intersect with the
+	canvas.
+
+2004-12-11  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/bumpmap.c (dialog_bumpmap_callback): do actually
+	change the bumpmap drawable. Fixes bug #160985, hopefully without
+	reopening bug #158494.
+
+2004-12-11  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: set version to 2.2.0.
+
+	* tools/Makefile.am
+	* tools/authorsgen/Makefile.am
+	* tools/authorsgen/authorsgen.pl
+	* tools/authorsgen/contributors: removed authorsgen, a perl script
+	that used to be used to create AUTHORS and authors.h.
+
+	* Makefile.am
+	* authors.dtd
+	* authors.xml: added a simple XML file that lists authors and
+	contributors and a DTD to validate it.
+
+	* authors.xsl: a stylesheet to generate AUTHORS from authors.xml.
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/authors.xsl: a stylesheet to generate authors.h from
+	authors.xml.
+
+	* app/dialogs/authors.h: regenerated.
+
+	* app/dialogs/about-dialog.c: added a const modifier.
+
+2004-12-09  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/widgets/gimphistogrameditor.c: make histogram editor,
+	and therefore histogram dialog, use the selection.  Should
+	resolve bug #72959.
+
+	* app/core/gimpdrawable-histogram.h: remove trailing whitespace.
+	
+2004-12-10  Manish Singh  <yosh@gimp.org>
+
+	* app/widgets/gimpdatafactoryview.c
+	* app/widgets/gimpitemtreeview.c: #include <string.h> for strcmp()
+
+2004-12-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdatafactoryview.c
+	(gimp_data_factory_view_tree_name_edited)
+	* app/widgets/gimpitemtreeview.c
+	(gimp_item_tree_view_name_edited)
+	* app/widgets/gimptemplateview.c
+	(gimp_template_view_tree_name_edited): call gimp_object_set_name()
+	or gimp_item_rename() only if the item's name has actually changed
+	and restore the old text otherwise. Fixes one instance of "name is
+	not updated correctly after editing" for which I blamed GTK+ in
+	bug #145463 :-) The other instances should be fixed in GTK+ HEAD
+	and are imho unfixable with GTK+ 2.4.
+
+2004-12-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainertreeview.c
+	(gimp_container_tree_view_clear_items): clear all viewable cell
+	renderers so they don't keep pointers to layers/masks which don't
+	exist any more. Fixes the additional problem in bug #148852 but
+	not the bug itself.
+
+2004-12-09  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/core/gimpbrushpipe.c (gimp_brush_pipe_select_brush):
+	Don't initialize a new random number generator every time a brush
+	is selected from a pipe.  Fixes bug #148205).
+	
+2004-12-09  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/cartoon.c: marked the menu entry for translation
+	(reported by Zigomar)
+
+2004-12-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/print-size-dialog.c
+	* app/widgets/gimpsizebox.c: set a focus_chain on the size_entries
+	so the focus order is width->height->chain->unitmenu and not
+	width->chain->height->unitmenu.
+
+	* app/widgets/gimptemplateeditor.c: changed focus_chain code to
+	work like above (cosmetics).
+
+2004-12-09  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/splash.c (splash_update): only expose the area of the
+	window that actually changed.
+
+	* app/plug-in/plug-in-rc.c (plug_in_rc_write): changed the header
+	and footer to be more in line with the other rc files.
+
+2004-12-08  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/dialogs/print-size-dialog.c (print_size_dialog_size_changed):
+	Previous fix only worked if units were inches -- now seems to
+	work for all units. (fixes #159273 ?)
+
+2004-12-08  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/randomize.c:  Changed algorithm for Pick and
+	Slur to treat all channels within a pixel in the same way;
+	intended to fix bug #72852.
+	
+2004-12-08  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/dialogs/print-size-dialog.c (print_size_dialog_size_changed):
+	fixed kludgy use of size entry, seems to fix bug #159273.
+
+2004-12-08  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpuimanager.[ch]: renamed
+	gimp_ui_manager_get_action() to gimp_ui_manager_find_action().
+
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimppaletteeditor.c
+	* app/widgets/gimptoolbox.c
+	* app/widgets/gimptooloptionseditor.c
+	* app/display/gimpdisplayshell-close.c: changed accordingly.
+
+	(this change is quite useless as it stands, but will help keeping
+	the diff between 2.2 and 2.3 small as soon as we're branched).
+
+	* app/widgets/gimpcolormapeditor.c
+	(gimp_colormap_preview_button_press): invoke the "edit-color", not
+	"new-color" action upon double click.
+
+	(palette_editor_select_entry): update the ui manager after
+	selecting the entry so the entry-specific actions become sensitive
+	if there was no entry selected before.
+
+2004-12-08  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimppropwidgets.[ch]: added new prop_widget
+	gimp_prop_int_combo_box_new() which takes a pre-built GimpIntStore
+	and allows to create views on int properties with arbitrary sets
+	of values (not just enums).
+
+	* app/widgets/gimpcontrollereditor.c
+	(gimp_controller_editor_constructor): added support for generic
+	combo boxes controlled exclusively by controller properties: if an
+	int property "foo" is followed by an object property "foo-values"
+	and the contained object is a GimpIntStore, use that store as
+	model for selecting "foo"'s values using
+	gimp_prop_int_combo_box_new().
+
+	(Allows for more flexible controller configuration, the actual use
+	case in the midi controller is still work in progress).
+
+2004-12-06  Sven Neumann  <sven@gimp.org>
+
+	* tools/authorsgen/contributors: removed duplicate entry for Roman.
+
+	* AUTHORS
+	* app/dialogs/authors.h: regenerated.
+
+2004-12-06  Roman Joost	<romanofski@gimp.org>
+
+	* tools/authorsgen/contributors: added Róman Joost to
+	contributors
+
+2004-12-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimptransformtool.c: applied patch from Sven Neumann
+	which removes code that prevents layers with mask from being
+	transformed.
+
+	* app/tools/gimptransformtool.[ch]: added "gboolean mask_empty"
+	parameter to GimpTransformTool::transform(). Needed because the
+	selection gets cleared by cutting from the drawable and we need
+	the selection's state before that cutting.
+
+	(gimp_transform_tool_doit): pass "mask_empty" to
+	GimpTransformTool::transform():
+
+	* app/tools/gimptransformtool.c (gimp_transform_tool_real_transform)
+	* app/tools/gimpfliptool.c (gimp_flip_tool_transform): when
+	transforming a layer with mask and there is no selection,
+	transform the mask just as if it was a linked item.
+	Fixes bug #143837 and bug #159697.
+
+2004-12-05  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimp-transform-utils.c (gimp_transform_matrix_flip_free):
+	applied patch from Joao S. O. Bueno that fixes bug #160339.
+
+2004-12-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/help/domain.c
+	* plug-ins/help/gimp-help-lookup.c
+	* plug-ins/help/help.[ch]: if the help files are not installed,
+	uninstall the temporary procedure and quit. Fixes bug #160258.
+
+2004-12-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/lic.c: applied patch from Joao S. O. Bueno that
+	sets a lower limit for the filter length (bug #160121). The patch
+	also makes the plug-in work on drawables with alpha channel.
+
+2004-12-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/wmf.c: applied patch from Karine Proot that
+	limits the size of the preview in the WMF loader (bug #133521).
+
+2004-12-04  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-arc.c
+	* plug-ins/gfig/gfig-arc.h
+	* plug-ins/gfig/gfig-bezier.c
+	* plug-ins/gfig/gfig-bezier.h
+	* plug-ins/gfig/gfig-circle.c
+	* plug-ins/gfig/gfig-circle.h
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-dobject.h
+	* plug-ins/gfig/gfig-ellipse.c
+	* plug-ins/gfig/gfig-ellipse.h
+	* plug-ins/gfig/gfig-line.c
+	* plug-ins/gfig/gfig-line.h
+	* plug-ins/gfig/gfig-poly.c
+	* plug-ins/gfig/gfig-poly.h
+	* plug-ins/gfig/gfig-preview.c
+	* plug-ins/gfig/gfig-spiral.c
+	* plug-ins/gfig/gfig-spiral.h
+	* plug-ins/gfig/gfig-star.c
+	* plug-ins/gfig/gfig-star.h: updating a object is now a virtual
+	function.
+
+2004-12-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage-undo-push.c (undo_pop_layer): when removing
+	the floating selection, call gimp_drawable_invalidate_boundary()
+	*before* setting gimage->floating_sel to NULL because otherwise
+	gimp_display_shell_selection_invis() won't clear the correct
+	selection bounds and leave garbage on screen. Fixes bug #160247.
+
+2004-12-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/tool-options-actions.c
+	(tool_options_actions_update_presets): don't forget to initialize
+	the "value_variable" boolean of GimpEnumActionEntry. Fixes myriads
+	of warnings about wrong values for boolean properties.
+
+	* app/actions/file-actions.c (file_actions_setup): same
+	here. Fixes nothing but is cleaner.
+
+2004-12-02  Simon Budig  <simon@gimp.org>
+
+	* app/vectors/gimpvectors.c: Fixed stupid typo that caused
+	distorted vectors on scaling after resizing. Spotted by
+	Joao S. O. Bueno.
+
+	Fixes bug #157852.
+
+2004-12-01  Sven Neumann  <sven@gimp.org>
+
+	* autogen.sh: rephrased the warning that is shown when the
+	intltool check fails.
+
+2004-12-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpuimanager.c (gimp_ui_manager_ui_get): improved
+	error message about missing XML files.
+
+2004-12-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-appearance.c
+	* app/display/gimpdisplayshell.c
+	* app/widgets/gimpdockable.c
+	* app/widgets/gimptexteditor.c
+	* app/widgets/gimptoolbox.c: check if gimp_ui_manager_ui_get()
+	actually returns something. Prevents crashes caused by missing
+	ui manager xml files. Fixes bug #159346.
+
+2004-12-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimptoolview.c (gimp_tool_view_select_item): no need
+	to update the ui manager here, the parent class already does it.
+
+2004-11-30  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/README: removed some very obsolete stuff.
+
+	* plug-ins/gfig/gfig-arc.c
+	* plug-ins/gfig/gfig-arc.h
+	* plug-ins/gfig/gfig-bezier.c
+	* plug-ins/gfig/gfig-bezier.h
+	* plug-ins/gfig/gfig-circle.c
+	* plug-ins/gfig/gfig-circle.h
+	* plug-ins/gfig/gfig-dobject.c: small cleanups
+
+2004-11-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/themes.c (themes_init): use gtk_rc_parse() instead of
+	gtk_rc_add_default_file() to add ~/.gimp-2.2/themerc to the list
+	of files parsed by GTK+ because the latter works only before
+	gtk_init(). Fixes bug #155963.
+
+2004-11-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/print-size-dialog.c: reordered prototypes to match
+	order of implementations.
+
+2004-11-30  Sven Neumann  <sven@gimp.org>
+
+	* app/sanity.c: we check for the same version of freetype on all
+	platforms, no need for an ifdef here.
+
+2004-11-30  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpexport.c: some more HIG-ification tweaks to the
+	Export dialogs.
+
+2004-11-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpactiongroup.c
+	(gimp_action_group_set_action_color)
+	(gimp_action_group_set_action_color): allow to set color and
+	viewable to NULL, GimpAction handles this nicely. Fixes warnings
+	some foo_actions_update() functions were triggering.
+
+2004-11-30  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/*[ch]: code cleanup
+
+2004-11-29  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/display.pdb: make it work as documented (fail
+	if the new_image already has a display). Also fail if the
+	old_image doesn't have any display (changed docs accordingly).
+	On success, take over the initial reference count of the new
+	image, just as the gimp_display_new() PDB wrapper does.
+	Fixes bug #159051.
+
+	* app/pdb/display_cmds.c
+	* libgimp/gimpdisplay_pdb.c: regenerated.
+
+2004-11-29  Sven Neumann  <sven@gimp.org>
+
+	* app/file/file-save.c (file_save_as): when the image filename
+	changes, forget the filename that was last used with "save-a-copy".
+
+2004-11-29  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback):
+	change the "update" property and notify listeners (in particular
+	GimpDrawablePreview) before invalidating the preview. Plug-ins
+	might (needlessly) look at the property to decide whether they
+	need to redraw. Fixes bug #159816.
+
+	* plug-ins/common/unsharp.c (preview_update): no need to look at
+	the value of the "Preview" toggle. GimpPreview takes care this.
+
+2004-11-29  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: issue a repaint after the
+	"show previous", "show next" and "show all" callbacks.
+
+	* plug-ins/gfig/gfig-style.c: fixed some comments.
+
+2004-11-29  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_preview.c
+	* plug-ins/imagemap/imap_selection.c: undeprecated.
+
+2004-11-28  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dobject.c: copy the style of the object when
+	pushing it to the undo stack, so undoing works as expected.
+
+2004-11-28  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-style.c
+	* plug-ins/gfig/gfig-style.h: create a new function to get the current
+	style instead of using a global pointer for this
+	(gfig_context_get_current_style ())
+
+	* plug-ins/gfig/gfig-circle.c
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig.h: use this function everywhere it is needed. And
+	remove the current_style field from GfigContext.
+
+	(unrelated):
+	* plug-ins/FractalExplorer/Dialogs.h
+	* plug-ins/FractalExplorer/FractalExplorer.c: small cleanups
+
+2004-11-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-style.[ch]
+	* plug-ins/gfig/gfig.h: removed unused stack of styles. Removed
+	gimp_style from GFigContext.
+
+2004-11-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig.c (run): push a context for GFig.
+
+2004-11-28  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.[ch]
+	* plug-ins/gfig/gfig-dobject.c: renamed undo_water_mark to undo_level.
+	Fixed the style handling when clearing the whole thing and undoing in
+	some very particular cases. The undo part should certainly be redone
+	to some extent.
+
+	Btw, this is the revision 1.10000 of the ChangeLog, yeah!
+
+2004-11-28  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/gfig/gfig-style.c: make sure PaintType is saved and
+	loaded with the style.
+	
+2004-11-28  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: correctly initializes the paint_type
+	field of the default style.
+
+	* plug-ins/gfig/gfig-style.c: don't print an useless error message
+	where no-one can see it when loading an other with no style but use
+	the default style instead.
+
+2004-11-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.[ch]
+	* plug-ins/gfig/gfig-dobject.c: moved Undo and Clear to the Edit
+	menu.  Added a utility function to set the sensitivity of an action
+	by name. Cleaned up action callbacks.
+
+	* plug-ins/gfig/gfig-style.c: minor cleanup.
+
+2004-11-28  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-arc.c
+	* plug-ins/gfig/gfig-bezier.c
+	* plug-ins/gfig/gfig-circle.c
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-ellipse.c
+	* plug-ins/gfig/gfig-line.c
+	* plug-ins/gfig/gfig-poly.c
+	* plug-ins/gfig/gfig-spiral.c
+	* plug-ins/gfig/gfig-star.c: made the class name uppercase since it is
+	used to parse a gfig file.
+
+2004-11-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: make sure that widgets in the Grid
+	and Preferences dialogs are only accessed while the dialogs exist.
+
+2004-11-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: made the Grid and Preferences
+	dialogs singletons and declared them as transient to the GFig
+	window. Don't let them run their own main loop.
+
+2004-11-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: added a Close menu item to the
+	menubar. Removed help buttons from popup dialogs. Set the same
+	default directory in load and save filechoosers.
+
+2004-11-27  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/pdb/drawable_transform.pdb: escape utf8 as hex, to
+	avoid perl trying to be so smart that it's stupid.
+
+	* app/pdb/drawable_transform_cmds.c: regenerated.
+
+2004-11-27  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/jpeg.c (save_image): thumbnail buffer variable
+	declarations should be guarded under HAVE_EXIF.
+
+2004-11-27  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/plug-ins/colorxhtml.py: s/colorhtml/colorxhtml/,
+	so it doesn't clash with the perl version.
+
+	* plug-ins/pygimp/plug-ins/Makefile.am: reflect filename change.
+
+2004-11-27  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/jpeg.c: delay the creation of the display for
+	the export image preview until the user requests a preview. Fixes
+	bug #159376.
+
+2004-11-27  Øyvind Kolås  <pippin@gimp.org>
+
+	* libgimp/gimpexport.c: minor layout adjustments for HIG compliance.
+
+2004-11-27  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/spyrogimp.scm: Force number of teeth
+	to be integer values. Changed default for Outer teeth to give a
+	more interesting image. Detabified file. Fixes bug #158448. 
+
+2004-11-27  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc):
+	don't look at the menu path to determine if the script is
+	image-based. Instead look at the number of parameters we are being
+	called with.
+
+2004-11-27  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpinkoptions-gui.c: made the Size scale logarithmic
+	as suggested in bug #159632.
+
+2004-11-27  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/tiff.c (save_image): tell the user that we can't
+	handle indexed images with alpha channel (bug #159600).
+
+2004-11-27  Sven Neumann  <sven@gimp.org>
+
+	* app/main.c
+	* app/widgets/gimpenumstore.h
+	* app/widgets/gimpunitstore.c
+	* plug-ins/common/retinex.c: applied patch by Tim Mooney that
+	removes extraneous ;
+
+2004-11-27  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/wmf.c (run): applied patch by Tim Mooney that
+	increase the size of values[] to accomodate the use of
+	file_wmf_load_thumb (bug #159601).
+
+2004-11-27  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/drawable.pdb: minor change to the PDB docs.
+
+	* libgimp/gimpdrawable_pdb.c
+	* tools/pdbgen/pdb/drawable.pdb: regenerated.
+
+2004-11-27  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/winicon/icosave.c
+	* plug-ins/winicon/main.[ch]: moved code around.
+
+2004-11-26  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/dog.c: make sure the preview image type matches
+	the source image type.
+
+2004-11-26  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/winicon/icosave.c: don't fiddle with the source image,
+	a save plug-in should save, nothing else.
+
+	* plug-ins/winicon/main.[ch]: handle all sorts of image types.
+	Fixes bug #157803.
+
+2004-11-26  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/drawable.pdb: fixed docs for
+	gimp_drawable_type_with_alpha().
+
+	* app/pdb/drawable_cmds.c
+	* libgimp/gimpdrawable_pdb.c: regenerated.
+
+2004-11-26  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/winicon/main.[ch] (ico_image_get_reduced_buf)
+	* plug-ins/winicon/icodialog.c
+	* plug-ins/winicon/icoload.c
+	* plug-ins/winicon/icosave.c: fixed drawable handling. This
+	plug-in is still a complete mess and needs a lot more work.
+
+2004-11-26  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimppaintoptions-gui.c (gimp_paint_options_gui): only
+	show the Incremental toggle for tools that use it (bug #159306).
+
+2004-11-26  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdocumentlist.c (gimp_document_list_deserialize):
+	don't add documents w/o a name to the list. Fixes bug #159510.
+
+	* app/core/gimpdrawable.c (gimp_drawable_resize): extended the
+	check to take the offsets into account as well.
+
+2004-11-25  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/dog.c: Add the temporary layers to the image, so
+	things work. Fixes bug #158895.
+
+	* plug-ins/common/iwarp.c: Fix same naughtiness as above. There's
+	other naughtiness still though.
+
+	* plug-ins/common/sunras.c: use gboolean for byte2bit invert argument.
+
+2004-11-25  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/jpeg.c: Use a jpeg_error_mgr that lives within
+	PreviewPersistent, instead of an automatic variable in save_image.
+	Fixes bug #159076.
+
+2004-11-25  Simon Budig  <simon@gimp.org>
+
+	* modules/controller_linux_input.c: Add some sample code to retrieve
+	the name of the connected MIDI device (ALSA).
+	Do not set the "name" when connected to Alsa, since snd_seq_name()
+	returns an uninteresting name.
+
+2004-11-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/gui.c (gui_display_changed): if the active display
+	becomes NULL (e.g. by closing a view), don't leave the user
+	context with an image but no display. Instead, try to find another
+	display of the same image and if that fails set the image to NULL.
+
+	Prevents the various foo_actions_update() functions from being
+	called with a NULL display while there is still an active image in
+	the context.
+
+	Fixes bug #159304.
+
+	(Removed #warning about being misplaced from that function because
+	it's a typical piece of ugly glue code that belongs exactly here).
+
+2004-11-24  Simon Budig  <simon@gimp.org>
+
+	* modules/controller_linux_input.c: Accept >= 0 return values of the
+	ioctl() to figure out the device name. Apparently it is the number of
+	bytes written to the string, so we might omit the strlen() following,
+	but I don't like to rely on that...
+
+2004-11-24  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcontroller.[ch]: guarded the whole header
+	with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION because it's no
+	fixed API yet. Added a "state" property bacause "name" was abused
+	as the controller's state. Added "help_domain" to the controller
+	class.
+
+	* libgimpwidgets/gimpwidgets.h: don't include gimpcontroller.h
+
+	* modules/controller_linux_input.c
+	* modules/controller_midi.c: set the "name" property to the name
+	retrieved from the device, or to a default string if no name is
+	available. Store the status in the "state" property. Added and
+	changed some strings, but it's better to have the controller
+	strings untranslated than to have no tooltips at all or misleading
+	labels.
+
+	* app/widgets/gimpcontrollerkeyboard.c
+	* app/widgets/gimpcontrollerwheel.c: set default strings for both.
+
+	* app/widgets/gimpcontrollereditor.c: added a GUI for the "state"
+	property.
+
+	* app/widgets/gimpcontrollerkeyboard.h
+	* app/widgets/gimpcontrollerwheel.h
+	* app/widgets/gimpcontrollerinfo.c
+	* app/widgets/gimpcontrollers.c: #define
+	GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION (just as in all files
+	above).
+
+	* app/widgets/gimphelp-ids.h: added the IDs of all controller
+	modules and also of all other modules. The defines are not
+	actually used, but this file is the canonical place to collect all
+	the core's help IDs.
+
+2004-11-23  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimp-templates.[ch]
+	* app/dialogs/user-install-dialog.c: merge the migrated user
+	templaterc with the system templaterc so the users who have used
+	gimp-2.0 before get our changes to the default templates.
+
+2004-11-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpwidgets-utils.[ch]: added new function
+	gimp_toggle_button_set_visible() which can be used as "toggled"
+	callback on a GtkToggleButton and sets a widget (in)visible
+	according to the toggle's "active" state.
+
+	* app/tools/gimpblendoptions.c
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimpselectionoptions.c: use it to hide (rather than
+	just insensitize) the seldomly used "Feather edges", "Autoshrink
+	selection", "Adaptive supersampling", "Fade out" and "Use color
+	from gradient" widgets when their enabling toggle is unchecked.
+	Makes the affected tool options much less crowded and noisy in
+	their default appearance. Fixes bug #159008.
+
+2004-11-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/menus/plug-in-menus.c (plug_in_menus_add_proc): create
+	dynamic sub-menus using a separate, ui-manager-global merge_id
+	instead of the procedure's merge_id. Has the effect that the ui
+	manager keeps around these sub-menus forever, even if the
+	procedure that initially registered them is unregistered.
+	Fixes menu ordering after Script-Fu->Refresh.
+
+2004-11-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpparasitelist.c: cosmetics, untabified.
+
+	* libgimpbase/gimpparasiteio.[ch]: added g_return_if_fail()'s
+	to all functions. 
+
+	(gimp_pixpipe_params_parse): changed "gchar*" param to "const
+	gchar*" (sortof API change, but these files are most probably only
+	used by GIMP itself). Still uses strtok() on the internal copy,
+	but at least not on the passed string.
+
+	* plug-ins/common/csource.c
+	* plug-ins/common/gif.c
+	* plug-ins/common/gih.c
+	* plug-ins/common/jpeg.c
+	* plug-ins/common/png.c
+	* plug-ins/common/tiff.c: use parasite getters instead of
+	accessing the scruct members directly. Always use g_strndup()
+	instead of just g_strdup() to get strings stored in parasites
+	because there is no guarantee that they are nul-terminated.
+
+2004-11-23  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_file.c (do_file_save_as_dialog): do
+	actually use a save dialog here. Fixes bug #159194.
+
+2004-11-23  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdrawable.c (gimp_drawable_resize): do nothing if
+	the size doesn't change. This keeps text layers from being
+	modified when an image is cropped and the layer is entirely inside
+	the cropped area.
+
+	* menus/image-menu.xml.in: put the Quit item back for now. We
+	should think about this again in the next development cycle.
+
+2004-11-22  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/copy-visible.scm: Fixed incorrect
+	comparison in if statement. Partial(?) fix for bug #138662. 
+
+2004-11-22  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/Makefile.am
+	* plug-ins/pygimp/pygimp-logo.png: New pygimp logo, by Carol Spears.
+
+	* plug-ins/pygimp/gimpfu.py: Use new external logo file, some layout
+	tweaks.
+
+2004-11-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_init):
+	always create the event mapping table. Fixes tons of warnings and
+	non-functional controller mapping dialog when an empty controller
+	was deserialized from controllerrc. Spotted by drc.
+
+2004-11-22  Sven Neumann  <sven@gimp.org>
+
+	* app/app_procs.c (app_exit_after_callback): call base_exit()
+	before quitting the application using exit(). Fixes bug #159019.
+
+	* app/base/tile-swap.c: moved the warning about a non-empty swap
+	file into #ifdef GIMP_UNSTABLE ... #endif.
+
+2004-11-22  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: correctly initialize the Antialising
+	check box.  Reported by Zigomar.
+
+2004-11-22  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.c: sort the SFMenu structs
+	by their menu_paths *and* the procedure's menu_labels. Fixes menu
+	item sorting after "Refresh".
+
+2004-11-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimptextoptions.[ch] (gimp_text_options_editor_new):
+	added a "menu_factory" parameter instead of trying to get it from
+	the toplevel GimpDock (which does not exists if the tool options
+	dialog does not exist). Fixes bug #159071.
+
+	* app/tools/gimptexttool.c (gimp_text_tool_editor): pass the
+	menu_factory.
+
+	* app/dialogs/dialogs.c (dialogs_init): pass the global menu
+	factory also when constructing the "toplevel" dialog factory so
+	the above works.
+
+2004-11-22  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpbase/gimputils.c (gimp_any_to_utf8): use g_strndup()
+	instead of g_strdup() if a length was passed.
+
+	* app/dialogs/info-window.c: g_strndup() the comment parasite's
+	data and pass -1 as length to gimp_any_to_utf8() so we don't
+	encounter the questionable (buggy?) behavior of g_utf8_validate()
+	to fail upon finding '\0' within the "length" passed.
+	Fixes bug #159051.
+
+2004-11-22  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/struc.c: applied patch from Wolfgang Hofer
+	which makes the plug-in use its procedure name for
+	storing the "last_vals" struct. Fixes bug #159028.
+
+	* plug-ins/common/tileit.c: ditto. Fixes bug #159029.
+
+2004-11-22  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-line.c: fixed a stupid bug which made all lines
+	half-selected.
+
+2004-11-22  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/file-open-location-dialog.c: changed border-size of
+	GimpContainerEntry to 0.
+
+2004-11-21  Sven Neumann  <sven@gimp.org>
+
+	* tools/gimp-remote.c: added --no-splash command-line option that
+	is passed to gimp. Addresses Debian bug report #277989.
+
+	* docs/gimp-remote.1.in: document the new option.
+
+2004-11-21  Manish Singh  <yosh@gimp.org>
+
+	* configure.in: reverted previous change, as not all the lv.pos are
+	in CVS yet.
+
+2004-11-21  Peteris Krisjanis  <pecisk@gmail.com>
+
+	* configure.in: Added Latvian (lv) language support to ALL_LINGUAS.
+
+2004-11-21  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/erase-rows.scm: Applied patch from BM
+	which makes the script work layers that have their top-left corner
+	at a position other than the top-left corner of the image.
+	Fixes bug #158863.
+
+2004-11-21  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-arc.c
+	* plug-ins/gfig/gfig-bezier.c
+	* plug-ins/gfig/gfig-circle.c
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-ellipse.c
+	* plug-ins/gfig/gfig-line.c
+	* plug-ins/gfig/gfig-poly.c
+	* plug-ins/gfig/gfig-spiral.c
+	* plug-ins/gfig/gfig-star.c
+	* plug-ins/gfig/gfig.h: makes which object is selected more obvious by
+	using filled handles for the selected object.  Not perfect, but
+	certainly a good hint.
+
+2004-11-21  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-preview.c: call gfig_grid_colours() in the
+	realize callback of the preview, so the gray gc of the grid works
+	again. Reported by Zigomar.
+
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-preview.h
+	* plug-ins/gfig/gfig-spiral.h
+	* plug-ins/gfig/gfig-star.h
+	* plug-ins/gfig/notes.txt: small cosmetics fixes.
+
+2004-11-21  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/compose.c
+	* plug-ins/common/decompose.c: transfer the image resolution to
+	newly created images.
+
+2004-11-21  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gimpressionist/Brushes/snow1.pgm: reverted a change
+	that Hans Breuer committed here, probably accidentally.
+
+	* plug-ins/script-fu/script-fu.c
+	* plug-ins/script-fu/siod-wrapper.c: reverted Hans's changes. There
+	is indeed a Script-Fu server on Win32.
+
+2004-11-21  Sven Neumann  <sven@gimp.org>
+
+	* menus/image-menu.xml.in: removed "Quit" from the image menu.
+
+2004-09-21  Hans Breuer  <hans@breuer.org>
+
+	* app/dialogs/makefile.msc : [new file]
+	  app/dialogs/Makefile.am : added to EXTRA_DIST
+
+	* **/makefile.msc app/gimpcore.def : updated
+
+	* app/gimp.rc : let wilber be first
+
+	* app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either
+
+	* libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib
+
+	* libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32
+
+	* plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h
+
+	* plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/script-fu.c :
+	there is no script-fu-server on win32
+
+2004-11-21  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* plug-ins/script-fu/scripts/addborder.scm: first resize the
+	image, then add the border layer and then fill it
+
+2004-11-20  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.c: Need to call gettext in
+	script-fu_menu_compare. Spotted by Sven. Removed obsolete #define's.
+
+2004-11-20  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.c: renamed variable
+	"script_list" to "script_tree" because it's a GTree.
+
+	(script_fu_remove_script): g_list_free() the right list (don't
+	leak all lists of scripts at the tree leaves).
+
+2004-11-20  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.2-pre2 release.
+
+2004-11-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/glob.c: added an (optional) parameter that
+	allows to request the output in the filesystem encoding.
+
+2004-11-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.c (script_fu_menu_compare):
+	compare the menu paths, not the struct pointers.
+
+2004-11-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/glob.c: added a naive glob() implementation
+	which handles the most common use case and is certainly better
+	than nothing. Closes bug #143661 again.
+
+2004-11-19  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimp.c: converted a g_warning() to g_printerr().
+
+2004-11-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/xpm.c: just some minor code cleanup.
+
+2004-11-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-style.c: combined two "Stroke" labels into a
+	single one.
+
+2004-11-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/noisify.c: applied a (modified) patch that adds
+	the possibility to correlate the noise with the signal. Adds the
+	new PDB procedure "plug_in_scatter_rgb". Fixes bug #158700.
+
+	* plug-ins/helpbrowser/dialog.c: set a reasonable default size.
+
+2004-11-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/postscript.c (skip_ps) (ps_close): fixed use of
+	fread(). Unfortunately this slowed down the plug-in again.
+	Disabled the code that reads the pipe to the end. This brings it
+	back to speed. Seems to work fine for me, let's see if this causes
+	problems for anyone...
+
+2004-11-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/selection-round.scm: moved into the
+	<Image>/Select/Modify menu now that we can safely use placeholders
+	from Script-Fu.
+
+2004-11-19  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/lib.pl
+	* tools/pdbgen/stddefs.pdb: added support for deprecated procedures
+	without any replacement.
+
+	* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): added
+	a special warning for procedures without replacement.
+
+	* tools/pdbgen/pdb/drawable.pdb: deprecated drawable_set_image()
+	without any replacement and made it a nop (which fails if the
+	passed image is different from the drawable's image). It's not
+	needed any longer since 2.0 and moreover dangerous to use.
+
+	* app/pdb/drawable_cmds.c
+	* libgimp/gimpdrawable_pdb.[ch]: regenerated.
+
+	* app/core/gimpitem.c (gimp_item_set_image): replaced assertion
+	for gimp_item_is_floating() by !gimp_item_is_attached(). The
+	former warned when adding a layer with already added mask to the
+	image (which is a perfectly valid operation).
+
+2004-11-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/wmf.c: added a thumbnail load procedure
+	(bug #158193).
+
+2004-11-18  Michael Natterer  <mitch@gimp.org>
+
+	Script-Fu string cleanup/simplification: apply the same fix for
+	menu path translation that was done for plug-ins a while ago.
+
+	* plug-ins/script-fu/script-fu.c (script_fu_auxillary_init): use
+	gimp_plugin_menu_register() on the "Refresh" temp_proc.
+
+	* plug-ins/script-fu/scripts/*.scm: ported all scripts to use
+	script-fu-menu-register and pass just the menu label in
+	script-fu-register. Cleaned up all register calls to share a
+	somewhat similar formatting.
+
+2004-11-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/postscript.c: changed the default to load only
+	the first page of the document and added a tooltip describing how
+	to specify what pages to get.
+
+2004-11-18  Sven Neumann  <sven@gimp.org>
+
+	* app/file/file-open.c (file_open_thumbnail): fixed check for
+	number of return values.
+
+2004-11-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/postscript.c: speed up loading of multi-page
+	documents significantly by skipping in large chunks instead of using
+	fgetc() to crawl through the stream.
+
+2004-11-18  Sven Neumann  <sven@gimp.org>
+
+	* app/file/file-open.c (file_open_thumbnail): check the number of
+	return values. Only retrieve width and height if the thumbnail
+	load procedure does actually provide this information.
+
+	* plug-ins/common/postscript.c: added a procedure to load a
+	thumbnail.  For now it only renders the first page of the
+	document at low resolution. It should be extended to load an
+	embedded thumbnail if one is available.
+
+	* plug-ins/common/jpeg.c
+	* plug-ins/common/svg.c: no need to register a menu label for the
+	thumbnail loaders. Allocate the return_vals array large enough to
+	hold all return values.
+
+2004-11-18  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpenumaction.[ch]: added boolean property
+	"value-variable" which specifies if the GimpEnumAction::selected()
+	signal may be emitted with arbirtary values (value-variable = TRUE)
+	or *only* with enum_action->value (value-variable = FALSE).
+
+	* app/widgets/gimpactiongroup.[ch]: added "gboolean
+	value_variable" to GimpEnumActionEntry and set it in
+	gimp_action_group_add_enum_actions().
+
+	* app/actions/channels-actions.c
+	* app/actions/colormap-editor-actions.c
+	* app/actions/context-actions.c
+	* app/actions/drawable-actions.c
+	* app/actions/edit-actions.c
+	* app/actions/error-console-actions.c
+	* app/actions/gradient-editor-actions.c
+	* app/actions/image-actions.c
+	* app/actions/layers-actions.c
+	* app/actions/palette-editor-actions.c
+	* app/actions/plug-in-actions.c
+	* app/actions/vectors-actions.c
+	* app/actions/view-actions.c: set "variable" to FALSE for all enum
+	actions except those which are used with the GIMP_ACTION_SELECT_SET
+	voodoo.
+
+	* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
+	fall back to gtk_action_activate() if the action specified in a
+	GIMP_CONTROLLER_EVENT_VALUE mapping is not variable. Enables
+	triggering of enum actions from GIMP_CONTROLLER_EVENT_VALUE events
+	(like midi note-on and note-off).
+
+2004-11-18  Michael Natterer  <mitch@gimp.org>
+
+	* acinclude.m4: pasted the complete alsa.m4 so compiling from
+	CVS doesn't require alsa.m4 to be installed.
+
+	* configure.in: check for alsa >= 1.0.0 and define HAVE_ALSA
+	if found.
+
+	* modules/Makefile.am: build controller_midi with ALSA_CFLAGS
+	and ALSA_LIBS.
+
+	* modules/controller_midi.c: s/HAVE_ALSALIB_H/HAVE_ALSA/.
+
+2004-11-18  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/compressor.c (compressors): added back the
+	.xcf.gz and .xcf.bz2 extensions because they are the only way
+	to figure the special nature of this plug-in's extensions.
+
+	* app/widgets/gimpfileprocview.[ch]: keep a list of "meta
+	extensions" (extensions which have a '.' themselves).
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
+	try to replace the whole extension if the last extension is one of
+	the meta extensions kept by GimpFileProcView. Fixes bug #158377.
+
+2004-11-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/maze/maze.[ch]
+	* plug-ins/maze/maze_face.c: removed the extra help button from
+	the Maze plug-in. Fixes bug #158605.
+
+2004-11-18  Michael Natterer  <mitch@gimp.org>
+
+	The following fixes have no visible effect because nobody
+	uses gimp_plugin_menu_register() on temp_procs yet:
+
+	* app/actions/plug-in-actions.[ch]: added
+	plug_in_actions_add_path() which just adds the actions needed for
+	a given menu math, but not the procedure action itself.
+
+	* app/gui/gui-vtable.c (gui_menus_create_entry): create the
+	menu_path's actions using above function so adding of submenus to
+	existing ui managers works.
+
+	* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register_invoker):
+	don't add a menu if "no_interface" is TRUE.
+
+	* app/pdb/plug_in_cmds.c: regenerated.
+
+	* plug-ins/script-fu/script-fu-scripts.c: pass untranslated
+	menu_paths to the core, not translated ones. Don't store the
+	scripts directly in the "script_list" tree but use a list of
+	scripts per key because there can be identical keys for different
+	scripts now. Fixed sorting of menu entries and menus.
+
+2004-11-18  Simon Budig  <simon@gimp.org>
+
+	* modules/controller_midi.c: implemented support for ALSA-midi,
+	currently disabled. Needs a configure-check and proper linking
+	against libasound.
+
+2004-11-17  Dave Neary  <bolsh@gimp.org>
+
+	* plug-ins/common/bumpmap.c: Fixed initialisation issue
+	that was crashing the plug-in on repeat runs. Fixes bug
+	#158494.
+
+2004-11-17  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/print-size-dialog.c: added missing callbacks for the
+	size entries. Needs some more work though...
+
+2004-11-17  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/dbbrowser/Makefile.am: make libgimpprocbrowser a libtooled
+	library.
+
+	* plug-ins/dbbrowser/gimpprocbrowser.[ch]: add a user_data pointer
+	for GimpProcBrowserApplyCallback.
+
+	* plug-ins/dbbrowser/gimpprocbrowser.c: only convert the name to
+	scheme style if scheme_names in the proc info pane too.
+
+	* plug-ins/dbbrowser/procedure-browser.c
+	* plug-ins/script-fu/script-fu-console.c: pass NULL as user_data.
+
+	* plug-ins/script-fu/Makefile.am: reference libgimpprocbrowser.la.
+
+	* plug-ins/pygimp/Makefile.am
+	* plug-ins/pygimp/procbrowser.c: new module, which wraps
+	libgimprocbrowser.
+
+	* plug-ins/pygimp/gimpmodule.c
+	* plug-ins/pygimp/pygimp.h
+	* plug-ins/pygimp/pygimp-pdb.c: export GimpPDBFunction so other
+	modules can use it.
+
+	* plug-ins/pygimp/plug-ins/pdbbrowse.py
+	* plug-ins/pygimp/plug-ins/gimpcons.py: use gimpprocbrowser.
+
+2004-11-17  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c: added a utility
+	function to reduce code duplication.
+
+2004-11-17  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.[ch]
+	* plug-ins/script-fu/siod-wrapper.c: appled patch from Kevin
+	Cozens which adds (script-fu-menu-register) and allows scripts to
+	register their menu_paths the same undeprecated way as plug-ins.
+	Fixes bug #158117.
+
+	* plug-ins/script-fu/scripts/test-sphere.scm: example how to use
+	the new API. Doesn't change strings because test-shpere.scm is an
+	untranslated example script.
+
+2004-11-17  Michael Natterer  <mitch@gimp.org>
+
+	Made plug-in menu registration work the same way for ordinary and
+	temporary procedures. Addresses bug #158117.
+
+	* app/core/gimp-gui.[ch]: added "const gchar *menu_path" to
+	gimp_menus_create_entry().
+
+	* app/gui/gui-vtable.c (gui_menus_create_entry): if menu_path is
+	NULL, behave as before and create an action and its menu entries
+	for all the procedure's menu_paths. If it is non-NULL, skip action
+	creation and create a menu entry just for that path.
+
+	* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add): call
+	gimp_menus_create_entry() with a NULL menu path and call it if
+	proc_def->menu_paths *or* proc_def->menu_label is non-NULL, so
+	it creates at least the procedure's action, even if it has
+	no menu_path (yet).
+
+	* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): check both
+	the list of procs and temp_procs when trying to register the
+	entry.  Allow ordinary procedures and extensions to install stuff
+	at query() and init() time and allow temp_procs to install stuff
+	at any time.
+
+	* app/pdb/plug_in_cmds.c: regenerated.
+
+2004-11-17  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/dbbrowser/gimpprocbox.c
+	* plug-ins/dbbrowser/gimpprocbrowser.[ch]
+	* plug-ins/dbbrowser/gimpprocview.c: some cleanup in preparation
+	of moving it to a more public place.
+
+	* plug-ins/dbbrowser/procedure-browser.c
+	* plug-ins/script-fu/script-fu-console.c: changed accordingly.
+
+2004-11-17  Sven Neumann  <sven@gimp.org>
+
+	* Makefile.am (DISTCHECK_CONFIGURE_FLAGS): removed --enable-gtk-doc
+	here since it only causes 'make distcheck' to break earlier as usual.
+
+2004-11-17  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/rcm/Makefile.am
+	* plug-ins/rcm/rcm_callback.c
+	* plug-ins/rcm/rcm_dialog.c
+	* plug-ins/rcm/rcm_stock.[ch]: applied a patch from Karine Proot
+	that replaces the XPM icons with stock icons (bug #140202).
+
+	* plug-ins/rcm/pixmaps/*.xpm: removed.
+
+	* plug-ins/Lighting/lighting_stock.c
+	* plug-ins/MapObject/mapobject_stock.c
+	* plug-ins/gfig/gfig-stock.c: fixed a common but harmless mistake
+	in the icon factory code.
+
+2004-11-16  Manish Singh  <yosh@gimp.org>
+
+	* app/widgets/gimpvectorstreeview.c: Hide SVG drop g_print under
+	be_verbose.
+
+2004-11-16  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/gimpui.py: Handle placeholder defaults for gimp
+	objects (bug #158392). Patch by Joao S. O. Bueno.
+
+2004-11-16  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/gimpui.py: Use img.name if filename is not
+	available (bug #158392). Patch by Joao S. O. Bueno.
+
+2004-11-16  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/gimpfu.py
+	* plug-ins/pygimp/gimpui.py: Add a palette selector (bug #155325).
+	Patch by Joao S. O. Bueno.
+
+2004-11-16  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/gimpfu.py: Fix -fu slider behavior (bug #155103).
+	Patch by Joao S. O. Bueno.
+	
+2004-11-16  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/glasstile.c: Remove unnecessary G_OBJECT() casts.
+
+2004-11-16  Manish Singh  <yosh@gimp.org>
+
+	* configure.in: 
+	* plug-ins/pygimp/Makefile.am: Compile pygimp with
+	-fno-strict-aliasing if the compiler supports it.
+
+	* plug-ins/pygimp/gimpui.py: Make "..." into "Browse..." for
+	everything but the filesel, for slightly more consistency with
+	script-fu. Addresses #124791.
+
+	* plug-ins/pygimp/gimpmodule.c: Wrapped
+	gimp_context_{get,set}_gradient and
+	gimp_gradient_get_{uniform,custom}_samples. Deprecated the deprecated
+	versions of these, and rewrote them in terms of the new functions.
+
+2004-11-17  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in.c (plug_in_close): replaced the
+	while(plug_in->temp_procs) "loop" which called
+	plug_in_proc_frame_quit() by a real for()-loop iterating over the
+	list of PlugInProcFrames, calling g_main_loop_quit() on each main
+	loop. The old version did not unroll the stack but looped
+	infinitely. Spotted by Yosh.
+
+2004-11-17  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_selection.c
+	* plug-ins/imagemap/imap_preferences.c: silent the compiler.
+
+2004-11-17  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/jpeg.c: applied (modified) patch from S. Mukund
+	which adds EXIF thumbnail loading and saving.
+	Fixes bugs #155761 and #158190.
+
+2004-11-16  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-arc.c
+	* plug-ins/gfig/gfig-bezier.c
+	* plug-ins/gfig/gfig-circle.c
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-ellipse.c
+	* plug-ins/gfig/gfig-line.c
+	* plug-ins/gfig/gfig-poly.c
+	* plug-ins/gfig/gfig-spiral.c
+	* plug-ins/gfig/gfig-star.c
+	* plug-ins/gfig/gfig-style.c
+	* plug-ins/gfig/gfig-style.h
+	* plug-ins/gfig/gfig-types.h
+	* plug-ins/gfig/gfig.h: added a toggle so we can now choose to stroke
+	the painting or not.
+
+2004-11-16  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: implemented the gradient fill, using a
+	shapeburst blend.  This is very slow, but I dont see how it could be
+	done otherwise.
+
+2004-11-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpfgbgeditor.c: get rid of the
+	gimp_fg_bg_editor_context_changed() callback and
+	g_signal_connect_swapped() gtk_widget_queue_draw() directly.
+
+2004-11-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpchanneltreeview.c: implement
+	GimpDockedInterface::set_context() and set the context of the
+	embedded GimpComponentEditor. Fixes NULL-context crashes in
+	action callbacks when invoked from the component editor.
+	Spotted by Jimmac.
+
+	Unrelated:
+
+	* app/widgets/gimpitemtreeview.c: get rid of the
+	gimp_item_tree_view_context_changed() callback and
+	g_signal_connect_swapped() gimp_item_tree_view_set_image()
+	directly.
+
+2004-11-16  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/jigsaw.c: added missing braces around initializer.
+
+2004-11-16  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/drawable_transform.pdb: renamed the new
+	drawable_foo_defaults() functions to drawable_foo_default() to be
+	consistent with paintbrush_default() and friends.
+
+	* tools/pdbgen/pdb/transform_tools.pdb
+	* libgimp/gimp.def: changed accordingly.
+
+	* app/pdb/drawable_transform_cmds.c
+	* app/pdb/transform_tools_cmds.c
+	* libgimp/gimpdrawabletransform_pdb.[ch]
+	* libgimp/gimptransformtools_pdb.c: regenerated.
+
+	* plug-ins/script-fu/scripts/coolmetal-logo.scm
+	* plug-ins/script-fu/scripts/image-structure.scm
+	* plug-ins/script-fu/scripts/text-circle.scm: follow the API change.
+
+2004-11-16  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpbaseconfig.c: increased default tile-cache-size
+	to 128MB.
+
+	* app/config/gimpcoreconfig.c: increased default undo size to 16MB.
+
+2004-11-16  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/image.pdb
+	* tools/pdbgen/pdb/selection.pdb: entirely removed the deprecated
+	functions "selection_clear", "image_set_cmap" and "image_get_cmap".
+
+	* app/pdb/procedural_db.c: and added them to the compat hash table
+	because they have undeprecated replacements with identical
+	signature.
+
+	* libgimp/gimpselection.[ch]: added gimp_selection_clear() here
+	instead because we need the symbol in libgimp.
+
+	* app/pdb/image_cmds.c
+	* app/pdb/internal_procs.c
+	* app/pdb/selection_cmds.c
+	* libgimp/gimpselection_pdb.[ch]: regenerated.
+
+2004-11-16  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dobject.h: renamed the DObject type to
+	GfigObject, according to our common type naming.  This type will
+	certainly become an abstract class in a near future.
+
+	* plug-ins/gfig/gfig-arc.c
+	* plug-ins/gfig/gfig-bezier.c
+	* plug-ins/gfig/gfig-bezier.h
+	* plug-ins/gfig/gfig-circle.c
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-ellipse.c
+	* plug-ins/gfig/gfig-line.c
+	* plug-ins/gfig/gfig-line.h
+	* plug-ins/gfig/gfig-poly.c
+	* plug-ins/gfig/gfig-poly.h
+	* plug-ins/gfig/gfig-spiral.c
+	* plug-ins/gfig/gfig-star.c
+	* plug-ins/gfig/gfig-types.h
+	* plug-ins/gfig/gfig.c
+	* plug-ins/gfig/gfig.h: changed accordingly.
+
+2004-11-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpitem-linked.[ch] (gimp_item_linked_get_list):
+	removed redundant "gimage" parameter.
+
+	* app/tools/gimpeditselectiontool.c: changed accordingly.
+
+2004-11-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpchannel-select.c
+	* app/core/gimpchannel.c
+	* app/core/gimpdrawable-desaturate.c
+	* app/core/gimpdrawable-equalize.c
+	* app/core/gimpdrawable-histogram.c
+	* app/core/gimpdrawable-invert.c
+	* app/core/gimpdrawable-levels.c
+	* app/core/gimpdrawable-offset.c
+	* app/core/gimpdrawable-stroke.c
+	* app/core/gimpdrawable-transform.c
+	* app/core/gimpdrawable.c
+	* app/core/gimpitem-linked.c
+	* app/core/gimpitem.c
+	* app/core/gimplayer.c
+	* app/core/gimpselection.c
+	* app/paint/gimppaintcore-stroke.c
+	* app/text/gimptextlayer.c: in all functions which somehow
+	(explicitely or implicitely) touch undo, either g_return_if_fail()
+	on gimp_item_is_attached() or simply don't push an undo step if
+	feasible (e.g. for simple stuff like layer opacity).
+
+	* tools/pdbgen/pdb/color.pdb
+	* tools/pdbgen/pdb/drawable.pdb
+	* tools/pdbgen/pdb/image.pdb
+	* tools/pdbgen/pdb/layer.pdb
+	* tools/pdbgen/pdb/paint_tools.pdb: let PDB wrappers fail
+	accordingly so they don't run into the assertions added above.
+
+	* app/pdb/color_cmds.c
+	* app/pdb/drawable_cmds.c
+	* app/pdb/image_cmds.c
+	* app/pdb/layer_cmds.c
+	* app/pdb/paint_tools_cmds.c: regenerated.
+
+2004-11-16  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/file-commands.c
+	* app/dialogs/file-save-dialog.c
+	* app/file/file-save.[ch]
+	* app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and
+	"set_image_clean" parameters into a single "save_a_copy"
+	parameter.  When saving a copy, attach the used URI to the image and
+	let the "Save a Copy" file chooser default to the last used value.
+
+2004-11-16  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/glossy.scm: fixed typo (bug #158425).
+
+2004-11-15  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig.c: added a blurb proposed by Alan Horkan.
+
+	* plug-ins/gfig/gfig-line.[ch]: smallish style fix.
+
+2004-11-15  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/images/stock-ellipse.png: better icon for the ellipse
+	tool (a lot more elliptical) by Jimmac and Zigomar.
+
+2004-11-15  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
+	limit the number of file extensions that are added to the file
+	filter menu to keep the file dialog from growing too wide.
+
+2004-11-15  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/display/gimpdisplayshell-preview.c: Further optimization of
+	perspective tool preview - never calculate the same vertex more
+	than once.
+
+2004-11-15  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc)
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
+	better fix for bug #158369.
+
+2004-11-15  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed):
+	return early if gimp_file_proc_view_get_proc() didn't return a file
+	procedure. Should fix bug #158369.
+
+2004-11-15  Øyvind Kolås  <pippin@gimp.org>
+
+	* docs/gimp.txt: removed, outdated.
+	* docs/make_todo: removed, unused.
+
+2004-11-15  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/print-size-dialog.c: started to redo this dialog
+	without using a GimpSizeBox. The widgets aren't connected, so it
+	isn't usable yet.
+	
+	* app/widgets/gimpprogressbox.c
+	* app/widgets/gimpprogressdialog.c
+	* app/widgets/gimpsizebox.c: trivial cleanups.
+
+	* data/images/gimp-splash.png: splash for 2.2-pre2, done by Jimmac.
+
+2004-11-14  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/image-commands.c: converted error messages that should
+	never appear to warnings.
+
+2004-11-14  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-dobject.h: fixed a crash (the one triggered by
+	this sequence: draw a line, delete it, redraw something), and
+	corrected some ui spacing.
+
+2004-11-14  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimppalette-import.c: applied a (slightly modified)
+	patch from Nickolay V. Shmyrev that changes the palette import
+	function to not only read palettes in the RIFF format but also
+	GIMP and Photoshop ACT palette files (bug #158297).
+
+2004-11-14  Sven Neumann  <sven@gimp.org>
+
+	* Makefile.am (EXTRA_DIST)
+	* MAINTAINERS
+	* PLUGIN_MAINTAINERS
+	* TODO.xml: removed these files from the tarball and from CVS.
+	Doesn't make sense to keep unmaintained files around that provide
+	outdated and in large parts wrong information.
+
+2004-11-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c (load_button_callback): use the
+	proper parent widget.
+
+2004-11-14  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-types.h: small UI tweaks, suggested by Sven.
+
+2004-11-14  Sven Neumann  <sven@gimp.org>
+
+	* configure.in
+	* plug-ins/rcm/Makefile.am
+	* plug-ins/rcm/images/Makefile.am
+	* plug-ins/rcm/images/rcm-360.png
+	* plug-ins/rcm/images/rcm-a-b.png
+	* plug-ins/rcm/images/rcm-ccw.png
+	* plug-ins/rcm/images/rcm-cw.png: added PNG versions of the XPM
+	icons used by the RCM plug-in. Added rules to build a header file
+	that can be used to get rid of the XPM files (bug #140202).
+
+2004-11-14  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dialog.h
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-dobject.h
+	* plug-ins/gfig/gfig-types.h
+	* plug-ins/gfig/gfig.c
+	* plug-ins/gfig/gfig.h: replace the crappy DAllObjs struct by a GList.
+	Makes the code cleaner and less error prone.
+
+2004-11-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/pagecurl/pagecurl.c: applied a patch from Karine Proot
+	that replaces the XPM icons with pixbufs (bug #140202).
+
+	* plug-ins/pagecurl/curl[0-7].xpm: removed.
+
+2004-11-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gimpressionist/Makefile.am: fixed typo.
+
+	* plug-ins/pagecurl/Makefile.am
+	* plug-ins/pagecurl/curl[0-7].png: added PNG versions of the XPM
+	icons used by the PageCurl plug-in. Added rules to build a header
+	file that can be used to get rid of the XPM files (bug #140202).
+
+2004-11-14  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/display/gimpdisplayshell-preview.c: Eliminated about 396
+	floating-point divides per frame in the persective preview.
+
+2004-11-13  Manish Singh  <yosh@gimp.org>
+
+	Fix a bunch of warnings from Sparse:
+
+	* app/actions/dockable-commands.c
+	* app/actions/layers-actions.c
+	* app/actions/view-commands.c
+	* app/base/pixel-surround.c
+	* app/config/gimpconfig-utils.c
+	* app/config/gimpscanner.c
+	* app/core/gimpbrushgenerated.c
+	* app/core/gimpcontainer.c
+	* app/core/gimpimage.c
+	* app/dialogs/palette-import-dialog.c
+	* app/file/gimprecentlist.c
+	* app/plug-in/plug-in-params.c
+	* app/text/gimptext-compat.c
+	* app/text/gimptext-parasite.c
+	* app/vectors/gimpbezierstroke.c
+	* app/vectors/gimpstroke.c
+	* app/widgets/gimpcellrendereraccel.c
+	* app/widgets/gimpselectiondata.c
+	* app/xcf/xcf.c
+	* libgimp/gimp.c
+	* libgimpthumb/gimpthumb-utils.c
+	* libgimpthumb/gimpthumbnail.c
+	* modules/cdisplay_proof.c
+	* plug-ins/Lighting/lighting_ui.c
+	* plug-ins/common/csource.c
+	* plug-ins/common/glasstile.c
+	* plug-ins/common/nova.c 
+	* plug-ins/common/pcx.c
+	* plug-ins/common/pnm.c
+	* plug-ins/common/randomize.c
+	* plug-ins/common/screenshot.c
+	* plug-ins/common/sel_gauss.c
+	* plug-ins/common/spheredesigner.c
+	* plug-ins/common/wind.c 
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gimpressionist/gimpressionist.c
+	* plug-ins/ifscompose/ifscompose.c
+	* plug-ins/print/gimp_main_window.c
+	* plug-ins/print/print.c: Cleanup integer vs. pointer confusion.
+
+	* app/base/temp-buf.c
+	* app/dialogs/about-dialog.c
+	* plug-ins/common/bumpmap.c
+	* plug-ins/common/jigsaw.c
+	* plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups.
+
+	* app/config/gimpconfig-deserialize.c
+	* app/config/gimpconfig-path.c
+	* app/config/gimpconfigwriter.c
+	* app/core/gimpgradient.c
+	* app/tools/gimpdrawtool.c
+	* plug-ins/common/nlfilt.c
+	* plug-ins/common/unsharp.c
+	* plug-ins/common/zealouscrop.c: Define inline functions before they
+	are used.
+
+	* app/core/gimpdrawable-blend.c: PixelRegion definition was changed
+	some time ago, but the initialization here didn't change. Fix it.
+
+	* app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to
+	assign token twice in a row.
+
+	* libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No
+	need to initialize file_data, since the code fills out all the fields.
+
+	* plug-ins/common/CML_explorer.c
+	* plug-ins/common/vpropagate.c: Declare function pointers fully.
+
+	* plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed,
+	we assume we can use the "inline" keyword always.
+
+	* plug-ins/common/psd_save.c
+	* plug-ins/common/vinvert.c
+	* plug-ins/gfig/gfig-arc.c
+	* plug-ins/gfig/gfig-bezier.c
+	* plug-ins/gfig/gfig-circle.c
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-ellipse.c
+	* plug-ins/gfig/gfig-line.c
+	* plug-ins/gfig/gfig-poly.c
+	* plug-ins/gfig/gfig-spiral.c
+	* plug-ins/gfig/gfig-star.c
+	* plug-ins/gfig/gfig.c
+	* plug-ins/gimpressionist/orientmap.c
+	* plug-ins/gimpressionist/placement.c
+	* plug-ins/gimpressionist/sizemap.c
+	* plug-ins/imagemap/imap_grid.c
+	* plug-ins/imagemap/imap_main.c
+	* plug-ins/imagemap/imap_preferences.c
+	* plug-ins/imagemap/imap_settings.c
+	* plug-ins/maze/maze.c
+	* plug-ins/sel2path/curve.c
+	* plug-ins/sel2path/fit.c
+	* plug-ins/sel2path/pxl-outline.c
+	* plug-ins/sel2path/spline.c
+	* plug-ins/xjt/xjt.c: Functions with no args should be declared
+	with (void).
+
+	* plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet
+	the compiler.
+
+2004-11-14  Sven Neumann  <sven@gimp.org>
+
+	* themes/Default/images/Makefile.am
+	* themes/Default/images/stock-center-16.png
+	* themes/Default/images/stock-center-24.png
+	* themes/Default/images/stock-print-resolution-16.png
+	* themes/Default/images/stock-print-resolution-24.png: new icons
+	drawn by Jimmac.
+
+	* libgimpwidgets/gimpstock.[ch]: registered the new icons.
+
+	* app/actions/image-actions.c
+	* app/dialogs/print-size-dialog.c
+	* app/dialogs/resize-dialog.c
+	* plug-ins/ifscompose/ifscompose.c: use them.
+
+2004-11-14  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: bumped version to 2.2-pre2.
+
+2004-11-13  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/pdb/image.pdb: Adapted Sven's code into pdbgen so
+	that gimp_image_set_filename() validates that it is called with
+	a filename in the filesystem encoding which can safely be converted
+	to UTF-8 and back. Fixes #153751.
+
+	* app/pdb/image_cmds.c
+	* libgimp/gimpimage_pdb.c: Regenerated.
+
+2004-11-13  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/print-size-dialog.[ch]: new files for the Print Size
+	dialog that was missing. Still work in progress...
+
+	* app/actions/image-actions.c
+	* app/actions/image-commands.[ch]
+	* app/widgets/gimphelp-ids.h
+	* menus/image-menu.xml.in: integrate the new dialog.
+
+2004-11-13  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/selection.pdb: deprecate gimp_selection_clear()
+	in favor of gimp_selection_none(). Fixes bug #156765.
+
+	* app/pdb/selection_cmds.c
+	* libgimp/gimpselection_pdb.[ch]: regenerated.
+
+2004-11-13  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/gfig/gfig.c
+	* plug-ins/gfig/gfig-dialog.c: Changed gimp_selection_clear() to
+	gimp_selection_none() (bug #156765).
+
+2004-11-13  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/gimp-headers.scm
+	* plug-ins/script-fu/scripts/gimp-labels.scm
+	* plug-ins/script-fu/scripts/news-text.scm
+	* plug-ins/script-fu/scripts/speed-text.scm: Changed calls to
+	gimp-selection-clear to use gimp-selection-none in preparation
+	for the deprecation of -clear. (bug #156765)
+
+2004-11-13  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/image.pdb: document the fact that
+	gimp_image_get_filename() returns the filename in the filesystem
+	encoding. Fixed gimp_image_get_name() to actually return the name
+	in UTF-8 encoding.
+
+	* app/pdb/image_cmds.c
+	* libgimp/gimpimage_pdb.c: Regenerated.
+
+	* app/vectors/gimpbezierstroke.h: formatting.
+
+2004-11-13  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimagefile.[ch]
+	* app/file/file-open.c
+	* app/file/file-save.c: pass the MIME type from the save procedure
+	to gimp_imagefile_save_thumbnail() so that it can be stored with
+	the thumbnail.
+
+	* tools/pdbgen/pdb/fileops.pdb
+	* app/pdb/fileops_cmds.c: changed accordingly.
+
+2004-11-13  Sven Neumann  <sven@gimp.org>
+
+	* app/plug-in/plug-in-proc-def.[ch]
+	* app/plug-in/plug-in-rc.c
+	* app/plug-in/plug-ins.[ch]: allow to associate a procedure for
+	thumbnail loading with any file load procedure.
+
+	* tools/pdbgen/pdb/fileops.pdb: export this functionality to the
+	PDB as gimp_register_thumbnail_loader().
+
+	* app/pdb/fileops_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpfileops_pdb.[ch]: regenerated.
+
+	* app/core/gimpimagefile.c
+	* app/file/file-open.[ch]: when creating a thumbnail for an image
+	file, use a thumbnail load procedure if available.
+
+	* plug-ins/common/svg.c: added "file_svg_load_thumb", a procedure
+	that allows to load a small preview of the SVG image.
+
+2004-11-13  DindinX  <dindinx@gimp.org>
+
+	* app/actions/layers-actions.c: added back <control>H as a shortcut
+	for "Anchor Layer".  Spotted by Bruno Ronzani.
+
+2004-11-13  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/retinex.c: use a GimpAspectPreview instead of a
+	GimpDrawablePreview. Fixes bug #157915. Also fixed the funny behaviour
+	of the progress bar.
+
+2004-11-13  Sven Neumann  <sven@gimp.org>
+
+	* libgimpbase/gimputils.c (gimp_strip_uline): changed based on a
+	patch by Joao S. O. Bueno to remove mnemonics as used in languages
+	like Chinese. Fixes bug #157561.
+
+2004-11-13  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/ifscompose/README.ifscompose: updated link to the
+	tutorial (pointed out by Alan Horkan) and added another link.
+
+	* plug-ins/ifscompose/ifscompose.c: changed plug-in name from
+	"IfsCompose" to "IFS Fractal". Sorry for the late string changes
+	but the old name definitely was akward and probably hard to
+	translate anyway. Fixes bug #157135.
+
+	* plug-ins/ifscompose/ifscompose_storage.c: removed trailing
+	whitespace.
+
+2004-11-13  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/retinex.c (retinex_dialog): fixed table size.
+
+2004-11-13  Simon Budig  <simon@gimp.org>
+
+	* app/core/gimpimage-merge.c: Return the active layer instead of
+	the bottom layer when just merging down a floating selection.
+	Untabbified.
+
+	Fixes bug #158130.
+
+2004-11-12  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpconfig-dump.c: better fix for bug #157971.
+
+	* docs/gimprc.5.in: regenerated.
+
+2004-11-12  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/images/stock-show-all.png
+	* plug-ins/gfig/images/stock-select-object.png: new icons made by
+	Jimmac.
+
+2004-11-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage-undo-push.c: disallow non-attached items
+	to be pushed to the undo stack.
+
+2004-11-12  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/images/stock-show-all.png
+	* plug-ins/gfig/images/stock-select-object.png: added these two stock
+	icons. Jimmac, these two are screaming to be redone, please.
+
+	* plug-ins/gfig/images/Makefile.am: added these icons.
+
+	* plug-ins/gfig/gfig-bezier.c
+	* plug-ins/gfig/gfig-bezier.h
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-poly.c
+	* plug-ins/gfig/gfig-poly.h
+	* plug-ins/gfig/gfig-spiral.c
+	* plug-ins/gfig/gfig-spiral.h
+	* plug-ins/gfig/gfig-star.c
+	* plug-ins/gfig/gfig-star.h
+	* plug-ins/gfig/gfig-stock.c
+	* plug-ins/gfig/gfig-stock.h
+	* plug-ins/gfig/gfig.h: moved all the buttons to a GtkUIManager
+	toolbar, which makes the code simpler and easier to read.
+
+2004-11-12  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/tips-dialog.c: added icons to the Previous/Next
+	buttons (bug #158004).
+
+2004-11-11  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/splash.c: lowered labels a few pixels.
+
+2004-11-11  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: minor code cleanup.
+
+2004-11-11  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: use a GtkUIManager for the menu and
+	automagically have it translated!  The button bar will follow the same
+	path.  Remove the now useless "Paint" button.
+
+2004-11-11  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpconfig-dump.c: groff doesn't like lines to start
+	with a single quote, we better escape it. Fixes bug #157971.
+
+	* docs/gimprc.5.in: regenerated.
+
+2004-11-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp-edit.c
+	* app/core/gimpdrawable-blend.c
+	* app/core/gimpdrawable-bucket-fill.c
+	* app/core/gimpitem.c (gimp_item_stroke): added precondition
+	checks for gimp_item_is_attached() and removed checks for
+	gimp_item_get_image() to actually return an image (because it
+	always returns an image).
+
+	* tools/pdbgen/pdb/edit.pdb: let all wrappers fail if the drawable
+	is not attached.
+
+	* app/pdb/edit_cmds.c: regenerated.
+
+2004-11-11  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/scripts/add-bevel.scm
+	* plug-ins/script-fu/scripts/addborder.scm
+	* plug-ins/script-fu/scripts/carve-it.scm
+	* plug-ins/script-fu/scripts/carved-logo.scm
+	* plug-ins/script-fu/scripts/chip-away.scm
+	* plug-ins/script-fu/scripts/clothify.scm
+	* plug-ins/script-fu/scripts/font-map.scm
+	* plug-ins/script-fu/scripts/slide.scm
+	* plug-ins/script-fu/scripts/swirltile.scm: don't call gimp-edit-*
+	functions on drawables which are not added to an image because
+	this will be forbidden soon (because it can trash the image's undo
+	stack).
+	
+2004-11-11  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/scripts/lava.scm: replaced
+	undo-disable/enable by undo-group-start/end.
+
+2004-11-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_response):
+	call gimp_image_flush() after committing the image_map so the
+	menus are up-to-date. Fixes bug #157914.
+
+2004-11-11  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/display/gimpdisplayshell-preview.c: Use the transform
+	tool coordinates when creating subdivisions, not the
+	texture coordinates. Fixes breakage with layers that are not
+	the image size.
+
+2004-11-11  Jay Cox  <jaycox@gimp.org>
+
+	* app/base/brush-scale.c: Keep computed brush values from
+	overflowing with large reduction factors.  Fixes bug #76228.
+
+2004-11-11  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpintstore.c
+	* app/vectors/gimpvectors-import.c: please the overly pedantic
+	IRIX MIPSpro compiler and don't initialize structs with
+	non-constant values.
+
+2004-11-10  Sven Neumann  <sven@gimp.org>
+
+	* app/file/file-open.c (file_open_layer): add the image to the
+	list of recently used documents. Fixes bug #157879.
+
+2004-11-10  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: moved the tool options closer to the
+	tools and made the dialog a bit smaller.
+
+2004-11-10  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/mail.c: added a menu icon (compiled-in).
+
+2004-11-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-handlers.c
+	(gimp_display_shell_resolution_changed_handler): if dot_for_dot is
+	off, resolution change has the same effect as size change, so call
+	gimp_display_shell_size_changed_handler(). Fixes display garbage.
+
+2004-11-10  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/winicon/icodialog.[ch]
+	* plug-ins/winicon/icoload.[ch]
+	* plug-ins/winicon/icosave.[ch]
+	* plug-ins/winicon/main.[ch]: call progress functions
+	unconditionally; removed global "interactive" variable; use
+	standard strings for open/save progress messages; gui, indentation
+	& coding style cleanup; untabified.
+
+2004-11-10  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* plug-ins/winsnap/winsnap.c: applied a patch from Sven Neumann
+	with some minor modifications. Fixes bug #157612
+	Removed some unused variables.
+
+2004-11-10  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpbase/gimputils.c (gimp_escape_uline): "Since: GIMP 2.2".
+
+2004-11-10  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/preferences-dialog.c: set the padding-mode to custom
+	color if a custom color is choosen. Fixes bug #157844.
+
+2004-11-10  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/dbbrowser/plugin-browser.c (browser_dialog_new): fixed
+	capitalization of notebook tab label.
+
+2004-11-10  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpbase/gimputils.[ch]: renamed gimp_flags_get_value() to
+	gimp_flags_get_first_value(). Reordered functions so enum and
+	flags functions are grouped together. Added missing docs.
+
+	* libgimpbase/gimpbase.def: changed accordingly.
+
+2004-11-09  Jay Cox  <jaycox@gimp.org>
+
+	* plug-ins/common/psd.c: Skip resources with unknown signatures
+	instead of quiting.  Fixes bug #142468, and bug #152728
+
+	* app/core/gimpdrawable.c: in functions gimp_drawable_mask_bounds,
+	and gimp_drawable_mask_intersect: reinitialize the return values
+	after calling gimp_channel_bounds because gimp_channel_bounds
+	overwrites the values even when it returns false.  This fixes the
+	bug where the gimp crashes when running color tools on layers
+	smaller than the image, and processes only part of the image when
+	the layer is larger than the image size.
+
+2004-11-10  Sven Neumann  <sven@gimp.org>
+
+	* HACKING: some updates.
+
+2004-11-10  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/ifscompose/ifscompose.c: use a UI manager created
+	toolbar instead of two rows of buttons. Added a "dummy-menubar" so
+	the popup menu shows shortcuts again. Removed "Preview" and "Auto"
+	buttons since the preview doesn't block the GUI and can always be
+	updated.
+
+2004-11-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpstatusbar.[ch]: added new function
+	gimp_statusbar_push_length(), which works exactly like
+	push_coords() but takes only one value plus a GimpOrientationType
+	for specifying the value's axis.
+
+	* app/tools/gimptool.[ch]: added the corresponding
+	gimp_tool_push_status_length().
+
+	* app/tools/gimpmovetool.c: use gimp_tool_push_status_length()
+	so the guide position is shown in the selected display unit.
+	Cleaned up the status message code a bit.
+
+2004-11-10  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/helpbrowser/dialog.c: use an idle handler to jump to the
+	anchor.
+
+2004-11-09  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/bmpread.c: if the file has space in the colormap for
+	more than 256 entries, ignore them instead of failing. Fixes bug
+	#157775.
+
+2004-11-09  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/bmpread.c: Fix cut'n'paste err so grayscale images
+	load again. Fixes bug #157764.
+
+2004-11-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-callbacks.c
+	(gimp_display_shell_canvas_tool_events): pass (gint)-truncated
+	coordinates instead of RINT()-rounded ones to
+	gimp_display_shell_update_cursor(). Restores correct coordinates
+	display for zoomed-in display and fixes bug #153534.
+
+	* app/tools/gimpmovetool.c: added statusbar messages including the
+	(rounded) guide coordinate. Keeps bug #141719 closed.
+
+2004-11-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell.c (gimp_display_shell_new): don't
+	connect to "event" and don't connect any canvas event to
+	gimp_display_shell_events(). Connect all tool events separately
+	(doesn't include "configure-event" and thus fixes bug #141543).
+
+	* app/display/gimpdisplayshell-callbacks.c
+	(gimp_display_shell_canvas_tool_events): call
+	gimp_display_shell_events() manually before doing tool event
+	processing.
+
+	* app/display/gimpdisplayshell.c
+	* app/display/gimpdisplayshell-callbacks.[ch]: connect to
+	"size_allocate" of the canvas, not to "configure_event"
+	(suggested by Owen in bug #141543).
+
+	* app/display/gimpdisplayshell-callbacks.[ch]: removed
+	gimp_display_shell_popup_menu().
+
+	(gimp_display_shell_origin_button_press): emit "popup-menu" on the
+	shell manually instead of calling above function.
+
+	* app/display/gimpdisplayshell.c: added the whole menu popup code
+	here.
+
+2004-11-09  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpoffsetarea.c (gimp_offset_area_resize): queue
+	a resize. Fixes remaining issues with bug #157495.
+
+2004-11-09  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/url.c: removed debug output.
+
+2004-11-08  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/user-install-dialog.c (user_install_migrate_files):
+	don't copy menurc, the format changed anyway.
+	
+2004-11-08  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c (script_fu_ok):
+	actually retrieve the value from the GtkEntry for SF-VALUE.
+
+2004-11-08  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/layer.pdb: applied modified patch from Geert
+	Jordaens which adds the missing gimp_layer_from_mask() API.
+	Addresses bug #138662.
+
+	* app/pdb/internal_procs.c
+	* app/pdb/layer_cmds.c
+	* libgimp/gimplayer_pdb.[ch]. regenerated.
+
+	* libgimp/gimp.def: changed accordingly.
+
+2004-11-08  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/scripts/selection-round.scm: removed garbage
+	from beginning of file. Removed DOS line breaks.
+
+2004-11-08  Michael Natterer  <mitch@gimp.org>
+
+	* libgimp/gimppixelfetcher.c: added docs derived from a patch from
+	Cai Qian (bug #156271).
+
+2004-11-08  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/screenshot.c: changed label of default action
+	button to "Grab".
+
+2004-11-08  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/CEL.c
+	* plug-ins/common/CML_explorer.c
+	* plug-ins/common/channel_mixer.c
+	* plug-ins/common/gqbist.c
+	* plug-ins/common/spheredesigner.c
+	* plug-ins/flame/flame.c
+	* plug-ins/ifscompose/ifscompose.c: don't set help-ids on plug-in
+	file chooser dialogs. Set the default response for file dialogs.
+
+2004-11-08  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/resize-dialog.c (resize_dialog_response)
+	* app/dialogs/scale-dialog.c (scale_dialog_response): replaced
+	"case GTK_RESPONSE_CANCEL:" by "default:" so it also catches
+	hitting the escape key or clicking the WM close button.
+
+2004-11-08  Øyvind Kolås  <pippin@gimp.org>
+
+	* plug-ins/common/gqbist.c: fixed typo in construction of file
+	chooser, use gtk_dialog_run instead of separate callbacks for
+	the responses of the file chooser dialog.
+
+2004-11-08  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdrawable.c (gimp_drawable_mask_bounds)
+	(gimp_drawable_mask_intersect): initialize the return values before
+	checking if the drawable is attached. Keeps GIMP from going mad if
+	this assertion is ever triggered.
+
+2004-11-07  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/helpbrowser/dialog.c: don't connect the help browser to
+	the help system.
+
+2004-11-07  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/selection-round.scm: register the
+	compatibility procedure with the correct name.
+
+2004-11-07  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpcolorbutton.c: fixed unused code (tooltip was
+	taken from label field).
+
+2004-11-07  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/ifscompose/ifscompose.c: ported to GtkUIManager.
+
+2004-11-07  Sigurd Gartmann  <sigurd-translate@brogar.org>
+
+	* configure.in: Added support for the new locale nb to ALL_LINGUAS.
+
+2004-11-07  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/channel_mixer.c (query): the menu label should
+	have three dots (bug #157580).
+
+2004-11-07  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gflare/gflare.c: removed #undef GTK_DISABLE_DEPRECATED and
+	use a GtkListStore instead of the long-time deprecated GtkList. Done
+	some small cleanups, too.
+
+2004-11-06  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpbrushgenerated.c: changed minimum brush radius from
+	1.0 to 0.1.
+
+	* app/widgets/gimpbrusheditor.c: allow a smaller brush radius to
+	be set in the brush editor. Fixes bug #157508.
+
+2004-11-06  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/scale-dialog.c (scale_dialog_reset): same fix here.
+
+2004-11-06  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/preferences-dialog.c: fixed typo (bug #157513).
+
+2004-11-06  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/convert-dialog.c (convert_dialog_new): removed
+	trailing period from check button label. Fixes bug #157511.
+
+2004-11-06  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/resize-dialog.c (resize_dialog_reset): fixed most of
+	the Reset functionality (bug #157495). The offset box is still not
+	working correctly.
+
+	* app/widgets/gimpsizebox.c (gimp_size_box_update_resolution):
+	check for availability of the size entry before accessing it.
+
+2004-11-06  Sven Neumann  <sven@gimp.org>
+
+	New Win32 icons contributed by Jernej Simoncic:
+	
+	* app/Makefile.am
+	* app/makefile.msc
+	* app/gimp.rc
+	* app/fileicon.ico: added new file icon for the Win32 build.
+
+	* app/wilber.ico: nicer application icon for the Win32 build.
+
+2004-11-05  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/maze/maze.c
+	* plug-ins/maze/maze_face.c: some irrelevant cleanups while doing
+	code review.
+
+2004-11-05  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/flame/flame.c: removed #undef GTK_DISABLE_DEPRECATED
+	because it's no longer needed. Cleaned up #defines and
+	declarations. Removed tabs and trailing whitespace.
+
+2004-11-04  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpsessioninfo.c: be more tolerant and silently
+	skip entries that the dialog factory doesn't recognize.
+
+	* app/widgets/gimpdialogfactory.c: minor cleanup.
+
+2004-11-04  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/user-install-dialog.c (user_install_response): don't
+	save the (empty) gimprc after migrating the user settings.
+
+2004-11-04  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/uniteditor.c: undeprecated by using a
+	GtkUIManager for creating the toolbar. Some cleanup and code
+	reordering.
+
+2004-11-04  Michael Natterer  <mitch@gimp.org>
+
+	* configure.in: disable the whole bunch of FOO_DISABLE_DEPRECATED
+	only for future versions of GLib, GTK+ and Pango because the
+	upcoming new stable versions add no new deprecations that are
+	relevant for the GIMP source.
+
+2004-11-04  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/ifscompose/ifscompose.c: some undeprecation and
+	cleanup. Still uses GtkItemFactory.
+
+2004-11-04  Michael Natterer  <mitch@gimp.org>
+
+	Don't use deprecated GtkToolbar API in GimpTextEditor:
+
+	* app/actions/Makefile.am
+	* app/actions/actions.c
+	* app/actions/text-editor-actions.[ch]
+	* app/actions/text-editor-commands.[ch]: added acions and
+	callbacks for the new "text-editor" action group.
+
+	* app/menus/menus.c: register a "<TextEditor>" UI manager.
+
+	* menus/Makefile.am
+	* menus/text-editor-toolbar.xml: new file for the toolbar.
+
+	* app/widgets/gimptexteditor.[ch]: use the toolbar created by the
+	UI manager instead of constructing it using deprecated API.
+
+	* app/tools/gimptextoptions.c: changed accordingly.
+
+	* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load()
+	(used by text-editor-commands.c).
+
+2004-11-04  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/ifscompose/ifscompose.c: #undef GTK_DISABLE_DEPRECATED.
+
+2004-11-04  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead
+	of a GtkItemFactory. Added virtual function ::get_action_type()
+	and create the manager's actions manually using that action type
+	instead of using gtk_action_group_add_actions().
+
+	* app/widgets/gimpcolorpanel.c: override ::get_action_type() so it
+	creates GimpActions (which can have a color attached) instead of
+	GtkActions. Changed the menu item visibility and color preview
+	code accordingly.
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpitemfactory.[ch]: finally removed.
+
+	* configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again.
+
+2004-11-04  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpoldwidgets.c: #undef GTK_DISABLE_DEPRECATED
+
+	* libgimpwidgets/gimpunitmenu.h: #include <gtk/gtkoptionmenu.h>
+	explicitely and #undef GTK_DISABLE_DEPRECATED only around the
+	inclusion if it was defined before.
+
+2004-11-04  Michael Natterer  <mitch@gimp.org>
+
+	* libgimp/gimpunitcache.h
+	* libgimpbase/gimpchecks.h
+	* libgimpbase/gimpdatafiles.h
+	* libgimpbase/gimplimits.h
+	* libgimpbase/gimpmemsize.h
+	* libgimpbase/gimputils.h
+	* libgimpbase/gimpwin32-io.h
+	* libgimpthumb/gimpthumb-enums.h
+	* libgimpthumb/gimpthumb-error.h
+	* libgimpwidgets/gimppreviewarea.h: added G_BEGIN_DECLS / G_END_DECLS.
+
+2004-11-04  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/ccanalyze.c
+	* plug-ins/common/uniteditor.c
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-preview.c
+	* plug-ins/ifscompose/ifscompose.c
+	* plug-ins/imagemap/imap_misc.c
+	* plug-ins/imagemap/imap_selection.c
+	* plug-ins/imagemap/imap_toolbar.c
+	* plug-ins/imagemap/imap_tools.c
+	* plug-ins/print/gimp_color_window.c: stop using deprecated
+	functions, added some #undef GTK_DISABLE_DEPRECATED where needed.
+
+2004-11-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/module-dialog.c
+	* plug-ins/dbbrowser/gimpprocbrowser.c
+	* plug-ins/dbbrowser/plugin-browser.c: use
+	gtk_tree_model_get_iter_first() instead of the deprecated
+	_get_iter_root().
+
+	* app/display/gimpdisplayshell-callbacks.c: don't include
+	"widgets/gimpitemfactory.h".
+
+2004-11-03  Øyvind Kolås  <pippin@gimp.org>
+
+	* app/base/gimphistogram.h: %s/historgam/histogram/
+	
+2004-11-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdasheditor.c (gimp_dash_editor_finalize): don't
+	forget to g_free(editor->segments).
+
+2004-11-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpscalecombobox.c
+	(gimp_scale_combo_box_mru_remove_last)
+	* app/widgets/gimpeditor.c (gimp_editor_add_action_button)
+	* app/xcf/xcf-load.c (xcf_load_old_path): plugged some small leaks.
+
+2004-11-03  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
+	plugged a mem-leak.
+
+	* app/widgets/gimpviewrendererimagefile.c
+	(gimp_view_renderer_imagefile_render): don't leak the pixbuf here.
+
+	* app/widgets/gimpviewrenderer-frame.c: added a comment.
+
+2004-11-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint-funcs/paint-funcs.c (combine_sub_region): applied
+	patch from Joao S. O. Bueno which moves assignments into an "else"
+	branch and thus optimizes the (common) "if" branch. Did some
+	cosmetic cleanups.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
+	don't silently return when there is already a script running but
+	show a message instead. Unfortunately introduces two new strings,
+	but bugs are bugs. Fixes bug #123882.
+
+2004-11-02  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimagefile.c (gimp_imagefile_save_thumb): minor
+	cleanup.
+
+	* libgimpthumb/gimpthumb-utils.c (_gimp_thumbs_delete_others): do
+	the right thing. Used to do the wrong thing when called with a
+	thumbnail size which is not from the GimpThumbSize enum.
+
+2004-11-02  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/image-commands.c (image_new_from_image_cmd_callback):
+	call image_new_dialog_set() unconditionally. Fixes bug #157096.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/drawable_transform.pdb: factored out the
+	"invoke" bodies to two utility functions, getting rid of *tons* of
+	duplicated code.
+
+	* app/pdb/drawable_transform_cmds.c: regenerated (only whitespace
+	and comments changed).
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/drawable_transform.pdb (drawable_*_defaults):
+	renamed parameter "interpolation" to "interpolate" as suggested by
+	pippin.
+
+	* app/pdb/drawable_transform_cmds.c
+	* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/user-install-dialog.c (user_install_migrate_files):
+	don't copy pluginrc* and themerc*.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* libgimp/gimpimage.h: one more s/cmap/colormap/.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/transform_tools.pdb: deprecated all functions.
+
+	* app/pdb/transform_tools_cmds.c
+	* libgimp/gimptransformtools_pdb.[ch]: regenerated.
+
+	* plug-ins/common/tiff.c
+	* plug-ins/script-fu/scripts/3dTruchet.scm
+	* plug-ins/script-fu/scripts/coolmetal-logo.scm
+	* plug-ins/script-fu/scripts/image-structure.scm
+	* plug-ins/script-fu/scripts/perspective-shadow.scm
+	* plug-ins/script-fu/scripts/text-circle.scm
+	* plug-ins/script-fu/scripts/truchet.scm: use the new transform API.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/drawable_transform.pdb: added _defaults()
+	variants (flip_defaults, rotate_defaults, ...) for all transform
+	functions which finally call gimp_drawable_transform_affine().
+	The _defaults() functions don't take the whole interpolation_type,
+	supersample etc. parameter overkill, but only a "interpolation"
+	boolean like the old PDB wrappers.
+
+	* libgimp/gimp.def: changed accordingly.
+
+	* app/pdb/drawable_transform_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/drawable_transform.pdb: renamed flip() and
+	rotate() to flip_simple() and rotate_simple(). Renamed flip_free()
+	and rotate_free() to flip() and rotate() (the special cases should
+	have a special suffix, not the general ones).
+
+	* libgimp/gimp.def: changed accordingly.
+
+	* app/pdb/drawable_transform_cmds.c
+	* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/compressor.c (compressors): added missing bzip2
+	command lines for Win32.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/bmp/bmpread.c
+	* plug-ins/bmp/bmpwrite.c
+	* plug-ins/common/CEL.c
+	* plug-ins/common/animationplay.c
+	* plug-ins/common/animoptimize.c
+	* plug-ins/common/autostretch_hsv.c
+	* plug-ins/common/c_astretch.c
+	* plug-ins/common/ccanalyze.c
+	* plug-ins/common/color_enhance.c
+	* plug-ins/common/film.c
+	* plug-ins/common/gee.c
+	* plug-ins/common/gee_zoom.c
+	* plug-ins/common/gif.c
+	* plug-ins/common/gifload.c
+	* plug-ins/common/grid.c
+	* plug-ins/common/header.c
+	* plug-ins/common/mng.c
+	* plug-ins/common/normalize.c
+	* plug-ins/common/pcx.c
+	* plug-ins/common/png.c
+	* plug-ins/common/pnm.c
+	* plug-ins/common/postscript.c
+	* plug-ins/common/psd.c
+	* plug-ins/common/psd_save.c
+	* plug-ins/common/raw.c
+	* plug-ins/common/sunras.c
+	* plug-ins/common/tga.c
+	* plug-ins/common/tiff.c
+	* plug-ins/common/tile.c
+	* plug-ins/common/vinvert.c
+	* plug-ins/common/winclipboard.c
+	* plug-ins/common/winprint.c
+	* plug-ins/common/xbm.c
+	* plug-ins/common/xpm.c
+	* plug-ins/common/xwd.c
+	* plug-ins/fits/fits.c
+	* plug-ins/gfli/gfli.c
+	* plug-ins/imagemap/imap_preview.c
+	* plug-ins/print/print.c
+	* plug-ins/pygimp/pygimp-image.c
+	* plug-ins/winicon/main.c: use the new "colormap" functions
+	instead of the deprecated "cmap" ones.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	More final API cleanup:
+
+	* tools/pdbgen/pdb/image.pdb: added gimp_image_set,get_colormap()
+	and deprecated set,get_cmap().
+
+	* libgimpwidgets/gimppreviewarea.[ch]: renamed
+	gimp_preview_area_set_cmap() to set_colormap().
+
+	* libgimp/gimp.def
+	* libgimp/gimpdrawablepreview.c
+	* libgimp/gimpexport.c
+	* libgimp/gimpimage.[ch]
+	* libgimpwidgets/gimpwidgets.def: changed accordingly.
+
+	* app/pdb/image_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpimage_pdb.[ch]: regenerated.
+
+	(undeprecation of plug-ins will follow...)
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpcroptool.c (crop_recalc): added "gboolean
+	recalc_highlight" and call gimp_display_shell_set_highlight() only
+	when it's TRUE. Pass TRUE from all places where the crop outline
+	actually changed.
+
+	(gimp_crop_tool_control): added back the call to crop_recalc() for
+	the RESUME case so the outline gets updated on zoom/scroll, but pass
+	recalc_highlight = FALSE because it has not changed.
+	Fixes bug #157001.
+
+2004-11-02  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/drawable_transform.pdb (flip): renamed
+	parameter "center" to "auto_center" and removed
+	"transform_direction". Renamed rotate() to rotate_free() and
+	added a "gboolean auto_center" parameter. Added new function
+	rotate() which takes enum GimpRotationType instead of an
+	arbiatrary angle so the flip and rotate APIs are symmetric.
+
+	* libgimp/gimp.def: added the gimp_drawable_transform_* stuff.
+
+	* app/pdb/drawable_transform_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
+
+2004-11-02  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/image-scale-dialog.c (image_scale_callback): actually
+	use the choosen interpolation type. Fixes bug #157102.
+
+2004-11-02  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-dobject.h
+	* plug-ins/gfig/gfig-preview.c
+	* plug-ins/gfig/gfig-style.h
+	* plug-ins/gfig/gfig-types.h
+	* plug-ins/gfig/gfig.h: some more cleanups. The current_style bug is
+	still there :(
+
+2004-11-01  Øyvind Kolås  <pippin@gimp.org>
+
+	* app/xcf/xcf-load.c: applied patch from David Gowers, extra sanity
+	checking for the xcf loader, colormaps read from non indexed images
+	are discarded. Does not fix bug #134097, but prevents gimp from
+	reloading an impossible state.
+
+2004-11-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable-transform.[ch]
+	(gimp_drawable_transform_flip): renamed "center" to "auto_center".
+
+	(gimp_drawable_transform_rotate): added missing parameters so it
+	can be used for a to-be-added PDB wrapper offering a
+	GimpRotationType based rotate API.
+
+	Both functions: always clip when transforming a whole channel,
+	since they must keep their size.
+
+	(gimp_drawable_transform_affine): actually forward the passed
+	"clip_result" to transform_tiles_affine() instead of always FALSE.
+
+2004-11-01  Øyvind Kolås  <pippin@gimp.org>
+
+	* app/pdb/color_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpcolor_pdb.c
+	* libgimp/gimpcolor_pdb.h: regenerated
+	* tools/pdbgen/pdb/color.pdb: added levels-stretch to @procs, removed
+	metainformation from deprecated levels-auto.
+
+2004-11-01  Øyvind Kolås  <pippin@gimp.org>
+
+	* app/actions/drawable-actions.c
+	* app/actions/drawable-commands.c
+	* app/actions/drawable-commands.h
+	* app/base/levels.c
+	* app/base/levels.h
+	* app/core/gimpdrawable-levels.c
+	* app/core/gimpdrawable-levels.h
+	* app/pdb/color_cmds.c
+	* app/tools/gimplevelstool.c
+	* libgimp/gimpcolor_pdb.c
+	* menus/image-menu.xml
+	* menus/image-menu.xml.in
+	* tools/pdbgen/pdb/color.pdb: renamed [drawable-]levels-auto
+	to [drawable-]levels-stretch, anticipating other ways to automatically
+	determine levels settings, old PDB command maintained, but marked
+	as deprecated.
+
+2004-11-01  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
+	don't check for file_proc->menu_paths. Our load and save procedure
+	don't necessarily register a menu path any longer.
+
+	* app/plug-in/plug-ins.c: minor cleanup.
+
+	* app/xcf/xcf.c (xcf_init): no need for adding menu paths for the
+	XCF load and save procedures.
+
+	* tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation.
+
+	* app/pdb/fileops_cmds.c
+	* libgimp/gimpfileops_pdb.c: regenerated.
+
+2004-11-01  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/drawable_transform.pdb: added "clip_result" to
+	the transform_options_args() utility function and changed all
+	wrappers accordingly. Removed "interpolation", "supersample" and
+	"recursion_level" args from drawable_transform_flip().
+
+	* app/pdb/drawable_transform_cmds.c
+	* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
+
+2004-11-01  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/tiff.c (query): fixed typo.
+
+2004-11-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/drawable-actions.c: trailing whitespace.
+
+	* app/actions/drawable-commands.[ch]: partly revert alphabetical
+	ordering. Instead, group them as in drawable-actions.c and order
+	by alphabet inside the groups (different ordering in *-actions.c
+	and *-commands.c is inconvenient for the usual workflow of editing
+	both files at the same time).
+
+	* app/core/gimpdrawable-levels.h: indentation.
+
+2004-11-01  Michael Natterer  <mitch@gimp.org>
+
+	* themes/Small/gtkrc: don't change GtkDialog::button_spacing and
+	::action_area_border because it breaks alignment with all other
+	dialog spacings or borders (which are hardcoded).
+
+2004-11-01  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-types.h: new file to hold the types gfig uses.
+	This makes the sources easier to read.
+
+	* plug-ins/gfig/Makefile.am: added gfig-types.h
+
+	* plug-ins/gfig/gfig.h: removed some types definitions and put them
+	in gfig-types.h and ...
+
+	* plug-ins/gfig/gfig-dobject.h
+	* plug-ins/gfig/gfig-style.h: ...into these files.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.2-pre1 release.
+
+2004-10-31  Simon Budig  <simon@gimp.org>
+
+	* data/images/gimp-splash.png: new splash based on a great photo
+	(and pumpkin) by Seth Burgess <sjburges@gimp.org>.
+
+2004-10-31  Simon Budig  <simon@gimp.org>
+
+	* plug-ins/common/plasma.c: Fixed handling of 1x1 selection and
+	selection out of drawable.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/Makefile.am (EXTRA_DIST): removed pix-data.h.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: changed gimp_version to 2.2-pre1, to match the
+	naming scheme of the 2.0 pre-releases.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/newsprint.c: removed an unused variable.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/user-install-dialog.c: when migrating the user
+	settings, tolerate errors and create the tmp directory that was
+	explicitely not copied.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpconfig-utils.c (gimp_config_file_copy): copy the
+	file permissions also.
+
+	* app/dialogs/user-install-dialog.c: added code to migrate user
+	settings from ~/.gimp-2.0. It copies all files (except GIMP swap
+	files) and all subdirectories (except tmp) with all files. It
+	doesn't recurse into subdirectories.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpguiconfig.c: disabled the image area by default
+	to reduce some clutter.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/user-install-dialog.c: fixed page logic for migration
+	of user settings. Still missing code to actually copy the files.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpmemsizeentry.c: don't use camel case in memory
+	size identifiers.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpimageeditor.c (gimp_image_editor_set_context):
+	set the active image. Fixes bug #156942.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/user-install-dialog.c: started to work on migration of
+	user settings (bug #156636). Not at all functional yet.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.c: allow for mnemonics in radio
+	groups created with gimp_radio_group_new().
+
+2004-10-31  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dobject.c: some more UI improvements.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpsizebox.c: added a size entry to edit the
+	resolution. This should close bug #151022.
+
+2004-10-31  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/resize-dialog.c: connect the offset controls.
+
+2004-10-30  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-style.c: fixed some annoying popup messages at
+	the price of a smallish mem-leak that I will fix later.
+
+2004-10-30  Sven Neumann  <sven@gimp.org>
+
+	* app/composite/gimp-composite-generic.c
+	(gimp_composite_hue_any_any_any_generic): do nothing if the color
+	has no saturation. Patch by Joao S. Bueno. Fixes bug #123296.
+
+2004-10-30  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/image-commands.c (image_scale_cmd_callback): destroy
+	the scale dialog when the display is disconnected.
+
+	* app/dialogs/resize-dialog.c: fixed a couple of bugs related to
+	the offset area. Still work in progress.
+
+2004-10-30  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/newsprint.c: Moved the preview to the left, as
+	suggested by Joao S. O. Bueno.
+
+2004-10-30  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-line.c
+	* plug-ins/gfig/gfig-line.h
+	* plug-ins/gfig/gfig-poly.c
+	* plug-ins/gfig/gfig-preview.c
+	* plug-ins/gfig/gfig-star.c
+	* plug-ins/gfig/gfig-style.c
+	* plug-ins/gfig/gfig-style.h: some more cleanups and UI tweaks. Still
+	work in progress.
+
+	* plug-ins/gfig/pix-data.h: removed this empty, unused file.
+
+2004-10-30  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpguiconfig.[ch]
+	* app/config/gimprc-blurbs.h
+	* app/dialogs/preferences-dialog.c
+	* app/tools/gimpmoveoptions.[ch]
+	* app/tools/gimpmovetool.[ch]: reverted changes for bug #156801.
+	Instead added a gimprc option that allows to get the old behaviour
+	back.
+
+2004-10-30  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpmoveoptions.[ch]
+	* app/tools/gimpmovetool.[ch]: applied (cleaned up version of) a
+	patch from Joao S. O. Bueno that adds a tool-option to restore the
+	old Move tool behaviour. Fixes bug #156801.
+
+2004-10-30  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/despeckle.c: applied a patch from Geert Jordaens
+	that improves the Despeckle algorithm. See bug #72862.
+
+2004-10-29  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/siod-wrapper.c (init_constants): Updated to
+	use convert_string() to change name of constant to Scheme format.
+
+2004-10-30  Sven Neumann  <sven@gimp.org>
+
+	* INSTALL
+	* NEWS
+	* README: updated for 2.2 pre-releases.
+
+2004-10-30  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/grid.c (run): applied patch by Joao S. O. Bueno
+	that implements the opacity parameters the way it is documented.
+	Fixes bug #156750.
+
+2004-10-30  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/glasstile.c: applied patch from Yeti, updated by
+	Kevin Cozens and modified by me. Fixes bug #85261.
+
+2004-10-29  Øyvind Kolås  <pippin@gimp.org>
+
+	* tools/pdbgen/pdb/color.pdb: moved body of code from here.
+
+	* app/core/gimpdrawable-levels.[ch]: to here.
+	* app/core/Makefile.am: added gimpdrawable-levels.[ch].
+	* app/pdb/color_cmds.c: regenerated.
+
+	* app/actions/drawable-actions.c
+	* app/actions/drawable-commands.[ch]: added drawable-layers-auto
+	action.
+
+	* app/widgets/gimphelp-ids.h: added GIMP_HELP_LAYER_WHITE_BALANCE.
+	* app/menus/image-menu.xml.in: added new auto/White Balance action.
+	* app/menus/image-menu.xml: regenerated.
+
+2004-10-29  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load)
+	* app/widgets/gimpclipboard.c (gimp_clipboard_init): only be
+	verbose on request.
+
+	* app/plug-in/plug-in.c (plug_in_close): turned warnings into
+	messages and respect gimp->be_verbose.
+
+2004-10-29  Øyvind Kolås  <pippin@gimp.org>
+
+	* app/actions/drawable-commands.[ch]
+	* app/actions/drawable-actions.[ch]: alphabetized file pending
+	addition.
+
+2004-10-29  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/test-sphere.scm: Added notes about
+	use of SF-PALETTE.
+
+2004-10-29  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/jpeg.c: pass the name in filesystem encoding to
+	gimp_image_set_filename(). Fixes bug #153751 for the JPEG plug-in.
+
+2004-10-29  Sven Neumann  <sven@gimp.org>
+
+	* app/file/file-utils.c (file_utils_uri_to_utf8_filename): when
+	the filename cannot be converted to UTF-8, warn and return the URI
+	instead. This is a workaround for the crash described in bug #153751.
+
+2004-10-29  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/dialogs.c (toplevel_entries): added foreign entries
+	for the keyboard shortcut and the controller action dialogs.
+
+	* app/dialogs/preferences-dialog.c
+	* app/widgets/gimpcontrollereditor.c: register the dialogs with
+	the "toplevel" dialog factory so they remember their size and
+	position.
+
+2004-10-29  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/dbbrowser/gimpprocbrowser.c
+	* plug-ins/dbbrowser/plugin-browser.c: don't say "1 Procedures" or
+	"1 Plug-In Interfaces" but use the singular form instead.
+
+2004-10-29  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/flarefx.c
+	* plug-ins/common/nova.c: changed preview cursors to GDK_CROSSHAIR.
+
+	* plug-ins/common/iwarp.c
+	* plug-ins/gflare/gflare.c
+	* plug-ins/ifscompose/ifscompose.c: added GDK_CROSSHAIR preview
+	cursors. Not quite perfect for IfsCompose (actually needs tool-
+	and constext-sensitive cursors) but definitely better than
+	before. Fixes bug #90519.
+
+2004-10-29  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/edit.pdb: mention gimp_drawable_fill() in the
+	docs for gimp_edit_fill().
+
+	* app/pdb/edit_cmds.c
+	* libgimp/gimpedit_pdb.c: regenerated.
+
+2004-10-28  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-arc.c
+	* plug-ins/gfig/gfig-bezier.c
+	* plug-ins/gfig/gfig-bezier.h
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dialog.h
+	* plug-ins/gfig/gfig-dobject.c
+	* plug-ins/gfig/gfig-dobject.h
+	* plug-ins/gfig/gfig-ellipse.c
+	* plug-ins/gfig/gfig-grid.c
+	* plug-ins/gfig/gfig-grid.h
+	* plug-ins/gfig/gfig.c: small cleanups
+
+2004-10-28  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablecombobox.c
+	* libgimp/gimpimagecombobox.c: changed the API docs to suggest to
+	use gimp_int_combo_box_connect() with these widgets. We don't want
+	more people to be caught by bug #156659.
+
+2004-10-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/grid.c: fixed a long-standing cut'n'paste bug
+	which caused the intersection color to be drawn with the wrong
+	shade of gray when drawing on a grayscale drawable.
+
+2004-10-28  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/resize-dialog.c: added the offset area back. Still
+	work in progress.
+
+2004-10-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/helpbrowser/dialog.c: only create a "Document not
+	found" error page if the requested URL was a page to load, not a
+	supplementary URL like an image. Fixes bug #138275.
+
+2004-10-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/bmp/bmp.c
+	* plug-ins/common/CEL.c
+	* plug-ins/common/aa.c
+	* plug-ins/common/compressor.c
+	* plug-ins/common/csource.c
+	* plug-ins/common/dicom.c
+	* plug-ins/common/gbr.c
+	* plug-ins/common/gif.c
+	* plug-ins/common/gifload.c
+	* plug-ins/common/gih.c
+	* plug-ins/common/gtm.c
+	* plug-ins/common/header.c
+	* plug-ins/common/jpeg.c
+	* plug-ins/common/mng.c
+	* plug-ins/common/pat.c
+	* plug-ins/common/pcx.c
+	* plug-ins/common/pix.c
+	* plug-ins/common/png.c
+	* plug-ins/common/pnm.c
+	* plug-ins/common/postscript.c
+	* plug-ins/common/psd.c
+	* plug-ins/common/psd_save.c
+	* plug-ins/common/psp.c
+	* plug-ins/common/sunras.c
+	* plug-ins/common/svg.c
+	* plug-ins/common/tga.c
+	* plug-ins/common/tiff.c
+	* plug-ins/common/url.c
+	* plug-ins/common/wmf.c
+	* plug-ins/common/xbm.c
+	* plug-ins/common/xpm.c
+	* plug-ins/common/xwd.c
+	* plug-ins/faxg3/faxg3.c
+	* plug-ins/fits/fits.c
+	* plug-ins/gfli/gfli.c
+	* plug-ins/sgi/sgi.c
+	* plug-ins/winicon/main.c
+	* plug-ins/xjt/xjt.c: removed the calls to gimp_plugin_menu_register()
+	from all plug-ins. File plug-ins don't register into a menu any longer.
+
+2004-10-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/raw.c (query): do not install an extension for
+	the raw plug-in to avoid confusion with the dcraw format.
+
+2004-10-28  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/layers-actions.c (layers_actions_update): do not set
+	the "layers-mask-add" action insensitive if there's no alpha channel.
+
+	* app/actions/layers-commands.c (layers_add_mask_response): add an
+	alpha channel if there isn't one already. Fixes bug #156676.
+
+2004-10-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
+	use gimp_int_combo_box_connect() so that the initial selection
+	causes the "changed" callback to be run. Should fix bug #156659.
+
+2004-10-28  Øyvind Kolås  <pippin@gimp.org>
+
+	* app/display/gimpdisplayshell-preview.c: Improve preview accuracy of
+	perspective transform, by subdiving into a 5x5 grid.
+
+	Fixes bug #152222.
+
+2004-10-27  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/display/gimpdisplayshell-preview.c: Really fixed all cases
+	of the perspective tool preview breaking with certain orientations by
+	using triangles instead of quads.
+
+2004-10-27  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/display/gimpdisplayshell-preview.c: Hopefully fixed all cases
+	of the perspective tool preview breaking with certain orientations.
+
+2004-10-27  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/enumcode.pl: Don't declare $first twice.
+
+	* libgimp/Makefile.am: Be sure to distribute gimpenums.c.tail.
+
+	* libgimp/gimpenums.c.tail: Added into CVS.
+
+2004-10-27  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-bezier.[ch]: added a notebook page for the
+	bezier tool options instead of yet another popup window.
+
+	* plug-ins/gfig/gfig-dialog.c: modified accordingly and HIGed a bit.
+
+2004-10-27  Øyvind Kolås  <pippin@gimp.org>
+
+	* app/core/gimpdrawable-transform.c: made the fixed point used in
+	supersampling configurable (in source) and changed from 15.16 to
+	21.10 fixed point.
+	
+	Fixes bug #128594 for drawables less than 2G wide.
+
+2004-10-27  Michael Schumacher <schumaml@gmx.de>
+
+	* app/widgets/gimpwidgets-utils.c: fixed a typo in
+	#include "libgimpbase/gimpwin32-io.h"
+
+2004-10-27  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.[ch]
+	* plug-ins/gfig/gfig-poly.[ch]
+	* plug-ins/gfig/gfig-spiral.[ch]
+	* plug-ins/gfig/gfig-star.[ch]
+	* plug-ins/gfig/gfig.h: first step of moving all the hidden popup
+	dialogs for the tool options in a GtkNotebook showing the options
+	within one page for each tool.
+
+2004-10-27  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/enumcode.pl: removed trailing commmas from output.
+
+2004-10-27  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/enumcode.pl: fixed loop control in
+	_gimp_enums_init(). This caused all plug-ins to crash immidiately.
+	You will need to make sure that libgimp/gimpenums.c.tail is
+	recreated and appended to libgimp/gimpenums.c
+
+2004-10-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2
+	bounding boxes to x,y,width,height ones. Added
+	gimp_transform_matrix_flip_free(). Renamed some parameters to be
+	consistent with others. Some internal cleanup.
+
+	* app/tools/gimpperspectivetool.c
+	* app/tools/gimpscaletool.c
+	* app/tools/gimpsheartool.c
+	* tools/pdbgen/pdb/drawable_transform.pdb
+	* tools/pdbgen/pdb/transform_tools.pdb: changed accordingly.
+
+	* tools/pdbgen/pdb/drawable_transform.pdb
+	* tools/pdbgen/pdb/transform_tools.pdb: guard all transform
+	wrappers with if(gimp_drawable_mask_intersect(...)), also the
+	ones which don't need the returned bounding box.
+
+	* tools/pdbgen/pdb/drawable_transform.pdb: renamed some parameters
+	and added gimp_drawable_transform_matrix() which takes the 9
+	coefficients of a 3x3 matrix for ultimate flexibility ;)
+
+	* app/pdb/drawable_transform_cmds.c
+	* app/pdb/internal_procs.c
+	* app/pdb/transform_tools_cmds.c
+	* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
+
+2004-10-27  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/dockable-actions.c (dockable_toggle_actions): changed
+	menu label from "Show Image Menu" to "Show Image Selection".
+
+	* app/widgets/gimpsizebox.c: unmarked a string for translation.
+
+	* app/dialogs/scale-dialog.c: added back the message when scaling
+	an indexed image.
+
+2004-10-27  DindinX  <dindinx@gimp.org>
+
+	* libgimp/gimpaspectpreview.c: really use the second parameter of
+	gimp_aspect_preview_new (), so plug-ins can now really remember the
+	state of the preview between invocations.
+
+	* libgimpwidgets/gimpscrolledpreview.c: fix a little typo
+
+	* plug-ins/common/channel_mixer.c: fix a warning by using TRUE for a
+	boolean value (initial state of the preview) instead of a weird NULL.
+
+2004-10-27  Michael Natterer  <mitch@gimp.org>
+
+	* modules/controller_linux_input.c
+	* modules/controller_midi.c: don't g_free(error) but
+	g_clear_error(&error) the GError.
+
+2004-10-27  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/resize-dialog.[ch]: started to redo the Resize
+	dialog in the style of the new Scale dialog. Only halfway done but
+	at least the new API is there.
+
+	* app/actions/image-commands.c
+	* app/actions/layers-commands.c: changed accordingly.
+
+	* app/dialogs/image-scale-dialog.c: cosmetics.
+
+2004-10-27  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/gfig/*[ch]: preliminary cleanups: removed all trailing
+	spaces.
+
+2004-10-26  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/pdb/drawable_transform.pdb: removed abuse of init,
+	called pdb_misc in all procedures.
+
+	* app/pdb/drawable_transform_cmds.c
+	* libgimp/gimpdrawabletransform_pdb.c: regenerated.
+
+2004-10-27  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/Makefile.am (PDB_WRAPPERS_H, PDB_WRAPPERS_C): added new
+	files gimpdrawabletranform_pdb.[ch].
+
+2004-10-27  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/image-scale-dialog.[ch]: a wrapper around the scale
+	dialog that takes care of verifying the user input and optionally
+	asking for confirmation. Most of this moved out of image-commands.c.
+
+	* app/actions/image-commands.c: use the new image scale dialog
+	even though it doesn't allow to edit the resolution yet. That's a
+	temporary regression that will get fixed soon.
+
+	* app/actions/layers-commands.c: cosmetics.
+
+	* app/dialogs/scale-dialog.c (scale_dialog_reset): also reset the
+	resolution.
+
+	* app/widgets/gimpsizebox.c: fixed cut'n'paste error.
+
+2004-10-27  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpsizebox.[ch]: added a resolution label similar
+	to one in the template editor. Prepared for editable resolution,
+	work in progress...
+
+	* app/dialogs/scale-dialog.[ch]: added resolution and resolution
+	unit parameters to ScaleDialogCallback.
+
+	* app/actions/layers-commands.c: changed accordingly.
+
+2004-10-26  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimptemplateeditor.c: commented out the memory size
+	label. The visual clutter of it's bold appearance was IMO not
+	appropriate. I think the dialog is better without it.
+
+	* app/widgets/gimpsizebox.c: added a pixel size label as in the
+	Image New dialog.
+
+2004-10-26  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/enumcode.pl: added gtk-doc comment for
+	gimp_enums_get_type_names().
+
+2004-10-26  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/retinex.c: applied patch by Geert Jordaens that
+	lets Retinex deal with RGBA drawables. Closes bug #135594 again.
+
+2004-10-26  Sven Neumann  <sven@gimp.org>
+
+	Added new drawable transform API to the PDB. Largely based on
+	patches from Joao S. O. Bueno. Fixes bug #137053.
+
+	* app/core/gimpdrawable-transform.[ch]: added missing parameters
+	to gimp_drawable_transform_flip().
+
+	* tools/pdbgen/pdb/transform_tools.pdb: changed accordinly.
+
+	* app/base/base-enums.h
+	* app/core/core-enums.h: removed pdp-skip for GimpInterpolationType
+	and GimpTransformDirection enums.
+
+	* libgimp/gimpenums.h
+	* plug-ins/pygimp/gimpenums.py
+	* tools/pdbgen/enums.pl
+	* tools/pdbgen/groups.pl: regenerated.
+
+	* tools/pdbgen/Makefile.am
+	* tools/pdbgen/pdb/drawable_transform.pdb: added new file defining
+	the new PDB calls.
+
+	* app/pdb/Makefile.am
+	* app/pdb/drawable_transform_cmds.c
+	* app/pdb/internal_procs.c
+	* app/pdb/transform_tools_cmds.c
+	* libgimp/gimp_pdb.h
+	* libgimp/gimpdrawabletransform_pdb.[ch]: regenerated.
+
+2004-10-26  Michael Natterer  <mitch@gimp.org>
+
+	* modules/controller_linux_input.c
+	* modules/controller_midi.c: don't enter an infinite blocking loop
+	when the user selects an input file that can be opened, but not
+	read (like a directory).
+
+2004-10-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpactionview.[ch] (gimp_action_view_new): added
+	parameter "const gchar *select_action" and preselect the passed
+	action if non-NULL. Made the column enum public to users of this
+	widget can get data from its tree store.
+
+	* app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog):
+	pass NULL because we don't want a preselected action here.
+
+	* app/widgets/gimpcontrollereditor.[ch]: added "Edit" and "Delete"
+	buttons to change the event -> action mapping. Implement a action
+	chooser dialog using GimpActionView. Fixes bug #106920.
+
+2004-10-26  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/channels-commands.c
+	* app/core/gimpchannel-select.c
+	* app/core/gimpimagefile.c
+	* app/core/gimpundo.c
+	* app/widgets/gimpcomponenteditor.c: use the new enum utility
+	functions from libgimpbase instead of accessing enum_value->value_name.
+
+2004-10-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/quit-dialog.c (quit_dialog_container_changed): when
+	changing the button's label to "Quit", also make it the default
+	action.
+
+2004-10-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcontrollereditor.[ch]: new widget built from
+	preliminary code from the prefs dialog. Prerequisite for finally
+	fixing bug #106920.
+
+	* app/dialogs/preferences-dialog.c: use the new widget.
+
+2004-10-26  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/retinex.c: cleaned up the GUI and GIMP-specific
+	code a bit. Use gimp_drawable_mask_intersect().
+
+2004-10-25  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/enumcode.pl: Use $1 instead of deprecated \1 for
+	regexp group.
+
+2004-10-26  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
+	my last change removed the sanity check for array_length >= 0.
+	Put it back.
+
+2004-10-26  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpbase/gimpbase.def: updated.
+
+2004-10-25  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/retinex.c: added this new plug-in.
+	Addresses bug #135594
+
+	* plug-ins/common/plugin-defs.pl: modified accordingly.
+
+	* plug-ins/common/.cvsignore
+	* plug-ins/common/Makefile.am: regenerated.
+
+	* plug-ins/gfig/gfig-arc.c
+	* plug-ins/gfig/gfig-arc.h
+	* plug-ins/gfig/gfig-circle.c
+	* plug-ins/gfig/gfig-circle.h
+	* plug-ins/gfig/gfig-dialog.c: smallish style cleanups
+
+2004-10-25  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
+	silently accept arrays which are longer than specified. Nothing
+	bad can happen and it's common practice to resize arrays in fixed
+	size chunks so avoid frequent resizing. Fixes bug #155359.
+
+2004-10-25  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/siod-wrapper.c (init_constants): removed
+	debugging output i forgot.
+
+2004-10-25  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/quit-dialog.c: change the action button's label to
+	"Quit" if there are no images with unsaved changes.
+
+2004-10-25  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpbase/gimpbaseenums.[ch]: register some missing enums.
+
+	* tools/pdbgen/enumcode.pl: removed code to generate 
+	plug-ins/script-fu/script-fu-constants.c, generate code to
+	explicitely initialize and query all of libgimp*'s enums
+	and write it to libgimp/gimpenums.c.tail
+
+	* libgimp/gimpenums.h: regenerated.
+
+	* libgimp/Makefile.am: append gimpenums.c.tail to gimpenums.c
+
+	* libgimp/gimp.c (gimp_main): call g_type_init() and
+	_gimp_enums_init().
+
+	* libgimp/gimp.def: added gimp_enums_get_type_names().
+
+	* plug-ins/script-fu/Makefile.am
+	* plug-ins/script-fu/script-fu-constants.[ch]: removed these files.
+
+	* plug-ins/script-fu/siod-wrapper.c: dynamically register all
+	constants using gimp_enums_get_type_names() and introspection.
+	Also register the built-in unit types.
+
+	* plug-ins/script-fu/script-fu.c: changed accordingly.
+
+2004-10-25  Michael Natterer  <mitch@gimp.org>
+
+	Don't store human readable and translatable enum/flag strings in
+	GEnumValue's and GTypeValue's fields but attach them to their
+	GType using separate structs and utility functions:
+
+	* tools/gimp-mkenums: added params and perl voodoo to support
+	generating a second array of values, which is used by the
+	Makefiles below to create and register arrays of value
+	descriptions.
+
+	* libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive
+	arrays of translatable strings to/from enum and flags types. Added
+	structs GimpEnumDesc and GimpFlagsDesc for that purpose.
+
+	* libgimpbase/gimputils.[ch]: changed existing enum utility
+	functions, added new ones and added a symmetric API for flags.
+
+	* app/base/Makefile.am
+	* app/core/Makefile.am
+	* app/display/Makefile.am
+	* app/paint/Makefile.am
+	* app/text/Makefile.am
+	* app/tools/Makefile.am
+	* app/widgets/Makefile.am
+	* libgimp/Makefile.am
+	* libgimpbase/Makefile.am: changed *-enums.c generation rules
+	accordingly.
+
+	* app/base/base-enums.c
+	* app/core/core-enums.c
+	* app/display/display-enums.c
+	* app/paint/paint-enums.c
+	* app/text/text-enums.c
+	* app/tools/tools-enums.c
+	* app/widgets/widgets-enums.c
+	* libgimpbase/gimpbaseenums.c: regenerated.
+
+	* app/widgets/gimpenumstore.c
+	* app/widgets/gimpenumwidgets.c
+	* app/widgets/gimptemplateeditor.c
+	* libgimpwidgets/gimppreviewarea.c: follow the enum utility
+	function API changes.
+
+2004-10-25  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_cmd_gimp_guides.c
+	* plug-ins/imagemap/imap_edit_area_info.c
+	* plug-ins/imagemap/imap_main.c
+	* plug-ins/imagemap/imap_menu.[ch]
+	* plug-ins/imagemap/imap_menu_funcs.[ch]
+	* plug-ins/imagemap/imap_misc.c
+	* plug-ins/imagemap/imap_settings.c
+	* plug-ins/imagemap/imap_source.c: added a menu entry for Help.
+	Did more minor layout adjustments for HIG compliance.
+
+2004-10-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpobject.c: #include "libgimpbase/gimpbase.h", not
+	just gimputils.h
+
+2004-10-25  Michael Natterer  <mitch@gimp.org>
+
+	* menus/toolbox-menu.xml.in: commented out the "Debug" submenu.
+	Should do this via an xsltproc --param actually...
+
+2004-10-25  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/newsprint.c: removed debugging g_print and
+	remove my memory fix, since it was buggy and shouldn't be done.
+	My fix just broke this plug-in (reported by Joao S. O. Bueno
+	Calligaris)
+
+2004-10-25  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimpvectortool.c: Switch to design mode when
+	Escape gets pressed. Untabbified.
+
+2004-10-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/gradient-editor-commands.c
+	* app/display/gimpdisplayshell-preview.c: irrelevant coding style
+	and spacing cleanups.
+
+	* app/widgets/gimpimageeditor.c: removed utility function
+	gimp_image_editor_context_changed() and connect
+	gimp_image_editor_set_image() directly using
+	g_signal_connect_swapped().
+
+2004-10-25  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_circle.c
+	* plug-ins/imagemap/imap_cmd_gimp_guides.c
+	* plug-ins/imagemap/imap_cmd_guides.c
+	* plug-ins/imagemap/imap_default_dialog.[ch]
+	* plug-ins/imagemap/imap_edit_area_info.c
+	* plug-ins/imagemap/imap_grid.c
+	* plug-ins/imagemap/imap_main.c
+	* plug-ins/imagemap/imap_misc.c
+	* plug-ins/imagemap/imap_polygon.c
+	* plug-ins/imagemap/imap_preferences.c
+	* plug-ins/imagemap/imap_rectangle.c
+	* plug-ins/imagemap/imap_selection.c
+	* plug-ins/imagemap/imap_source.c
+	* plug-ins/imagemap/imap_toolbar.c
+	* plug-ins/imagemap/imap_tools.c: reviewed for HIG
+	compliance. Various other minor fixes. Closes bug #150004.
+
+2004-10-25 Kevin Cozens <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/test-sphere.scm: Added parameter
+	missing from argument list.
+
+2004-10-25  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/enumcode.pl
+	* libgimp/Makefile.am: register all enums in libgimp/gimpenums.h
+	with the type system.
+
+	* libgimp/gimpenums.h: regenerated.
+
+	* libgimp/gimp.def: updated.
+
+2004-10-25  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: gimp_user_version should be 2.2.
+
+	* libgimpmodule/Makefile.am (AM_CPPFLAGS): cleanup.
+
+2004-10-25  Sven Neumann  <sven@gimp.org>
+
+	* configure.in:
+	* app/Makefile.am
+	* tools/Makefile.am: bumped version to 2.2.0-pre1, set app version
+	to 2.2, reset other versions to 2.0. Changed library versioning so
+	we install with the same soname as gimp-2.0 again.
+
+2004-10-25  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimagefile.c (gimp_imagefile_get_desc_string): say
+	"Click to create preview" if no preview is available.
+
+2004-10-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_save()
+	which saves a GtkTextBuffer's contents to a file.
+
+	* app/widgets/gimperrorconsole.c: use
+	gimp_editor_add_action_button() and removed all "clicked"
+	callbacks, including all file saving code.
+
+	* app/actions/error-console-actions.c
+	* app/actions/error-console-commands.[ch]: added the code removed
+	above to the action callbacks. Use gimp_text_buffer_save().
+
+2004-10-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpgradienteditor.[ch]
+	* app/widgets/gimppaletteeditor.[ch]: added public APIs for
+	zooming the editors. Use gimp_editor_add_action_button() to create
+	all buttons. Removed all button callbacks and all duplicated
+	button sensitivity logic.
+
+	* app/widgets/gimpdataeditor.c (gimp_data_editor_set_data): update
+	the editor's UI manager if it exists.
+
+	* app/actions/gradient-editor-actions.c
+	* app/actions/gradient-editor-commands.[ch]: added zoom actions
+	and callback and call gimp_gradient_editor_zoom(). Fixed
+	gradient_editor_actions_update() to actually set all items'
+	sensitivity (it was possible to modify read-only gradients and
+	even to crash GIMP).
+
+	* app/actions/palette-editor-actions.c
+	* app/actions/palette-editor-commands.[ch]: changed "new" and
+	"zoom" actions to actually do their job instead of calling
+	gtk_button_clicked(editor->foo_button).
+
+2004-10-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcolormapeditor.c: removed the "Edit Color"
+	dialog callbacks and use gimp_editor_add_action_button() for
+	the edit button. Removed button sensitivity logic. Hide the
+	color dialog when the image's mode changes.
+
+	* app/actions/colormap-editor-actions.c: added missing tooltip
+	for the edit action.
+
+	* app/actions/colormap-editor-commands.c: implement the dialog
+	here.
+
+2004-10-24  DindinX  <dindinx@gimp.org>
+
+	* app/core/gimpdrawable-desaturate.c: only return early if there's
+	nothing to desaturate.
+
+2004-10-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/vectors-commands.c: don't leak the filenames of the
+	import and export dialogs.
+
+2004-10-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/vectors-export-dialog.[ch]
+	* app/dialogs/vectors-import-dialog.[ch]: new files.
+
+	* app/actions/vectors-commands.c: use the new dialogs and remember
+	their last values.
+
+2004-10-23  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/vectors-commands.c: added missing controls to the
+	path import and export dialogs.
+
+2004-10-23  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/newsprint.c: cleaned it up, fixed a (documented)
+	memory leak and the weird behaviour of the resolution scales.
+
+2004-10-23  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/newsprint.c: added a preview.
+
+2004-10-23  Michael Natterer  <mitch@gimp.org>
+
+	* libgimp/gimpaspectpreview.h
+	* libgimp/gimpdrawablepreview.h
+	* libgimp/gimpprogressbar.h
+	* libgimpwidgets/gimpcellrenderercolor.h
+	* libgimpwidgets/gimpcellrenderertoggle.h
+	* libgimpwidgets/gimpframe.h
+	* libgimpwidgets/gimpintcombobox.h
+	* libgimpwidgets/gimpintstore.h
+	* libgimpwidgets/gimppreview.h
+	* libgimpwidgets/gimppreviewarea.h
+	* libgimpwidgets/gimpscrolledpreview.h: added padding to all class
+	structs which have been added since 2.0.
+
+2004-10-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/file-commands.c (file_save_cmd_callback): don't
+	g_return_if_fail() if there is no active drawable, just silently
+	return.
+
+	* app/actions/image-commands.c: remember the last merge_type of
+	the "Merge Visible Layers" dialog.
+
+	* app/actions/layers-commands.c: remeber the last values of the
+	"Add Layer Mask" dialog.
+
+	* app/actions/select-commands.c: renamed a bunch of static
+	variables to be consistent with other variables used to remember
+	dialog values.
+
+	* app/actions/view-commands.c (view_fullscreen_cmd_callback): it's
+	useless to update the "view-fullscreen" actions here because the
+	"fullscreen" state of the shell changes asynchronously
+
+2004-10-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/image-merge-layers-dialog.c
+	* app/dialogs/layer-add-mask-dialog.c: made them not resizable.
+
+	* app/dialogs/convert-dialog.c
+	* app/dialogs/offset-dialog.c: renamed ugly variables.
+
+	* app/dialogs/image-new-dialog.c
+	* app/dialogs/stroke-dialog.c: irrelevant pedantic code reordering.
+
+2004-10-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/image-merge-layers-dialog.[ch]: one more dialog split
+	out of actions/.
+
+	* app/actions/image-commands.c: removed it here. Some cleanup.
+
+2004-10-23  Sven Neumann  <sven@gimp.org>
+
+	* libgimpthumb/gimpthumb-utils.[ch]
+	* libgimpthumb/gimpthumbnail.[ch]
+	* libgimpthumb/gimpthumb.def: added missing API, mainly for deleting
+	thumbnails.
+
+	* app/core/gimpimagefile.[ch]: when saving a thumbnail, delete a
+	failure thumbnail if one exists. Unless the thumbnail was created
+	explicitely, remove all other thumbnails for this image.
+
+	* app/actions/documents-commands.c: changed accordingly.
+
+	* app/file/file-open.c: only save a thumbnail if there isn't a
+	valid thumbnail already.
+
+	* app/widgets/gimpthumbbox.c: before attempting to create a new
+	thumbnail, check if there's an uptodate failure thumbnail.
+
+2004-10-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/layer-add-mask-dialog.[ch]: one more dialog split
+	out of actions/.
+
+	* app/actions/layers-commands.c: removed it here. Some cleanup.
+
+2004-10-23  Michael Natterer  <mitch@gimp.org>
+
+	* autogen.sh: don't tell nonsense by printing "I am going to run
+	./configure with no arguments", because we always pass at least
+	--enable-maintainer-mode. Instead, simply always print all
+	arguments. Also removed --copy from the calls to glib-gettextize
+	and intltoolize.
+
+2004-10-23  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the
+	SLEECTION_STROKE and PATH_STROKE stock items so they can be used
+	in action areas.
+
+	* app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash
+	with "_Stroke" and reordered some code.
+
+	* app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead
+	of GTK_STOCK_OK. Added parameters to specify the dialog's title
+	so it doesn't say "Stroke Options".
+
+	* app/actions/select-commands.c
+	* app/actions/vectors-commands.c
+	* app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke
+	Path" as dialog titles.
+
+2004-10-23  Michael Natterer  <mitch@gimp.org>
+
+	When there are variants of actions with and without dialog, let
+	the dialog-less actions try to use the values from the last dialog
+	invocation:
+
+	* app/actions/channels-actions.c
+	* app/actions/channels-commands.[ch]
+	* app/actions/layers-actions.c
+	* app/actions/layers-commands.[ch]
+	* app/actions/vectors-actions.c
+	* app/actions/vectors-commands.[ch]: renamed the foo-new-defaults
+	actions to foo-new-last-values and use the last values entered in
+	the dialogs.
+
+	* app/widgets/gimpchanneltreeview.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpvectorstreeview.c: changed accordingly. Show
+	the dialog on clicking "New" and call the last-values action on
+	<shift>+click.
+
+	* app/actions/select-actions.c
+	* app/actions/vectors-commands.c: renamed the foo-stroke-last-vals
+	to -last-values.
+
+	* app/widgets/gimpselectioneditor.c
+	* app/widgets/gimpvectorstreeview.c: stroke with last values on
+	<shift> clicking the stroke buttons.
+
+2004-10-23  Sven Neumann  <sven@gimp.org>
+
+	* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save): save to a
+	temporary file to avoid problems with concurrent thumbnail
+	creation.
+
+2004-10-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/layer-options-dialog.[ch]: the new/edit layer dialog.
+
+	* app/actions/layers-commands.c: use it here.
+
+2004-10-22  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpimagemaptool.[ch]
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimplevelstool.c: allow to Shift-click the Load and
+	Save buttons to skip the file chooser dialog and reuse the last
+	used filename. Fixes bug #75558.
+
+2004-10-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/template-options-dialog.[ch]: the new/edit template
+	dialog.
+
+	* app/actions/templates-commands.c: removed the code here and use
+	template_options_dialog_new(). Removed utility functions. Some
+	cleanup.
+
+2004-10-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpeditor.c (gimp_editor_ensure_button_box): make
+	sure the button_box is always interted at the very bottom of the
+	editor.
+
+	* app/widgets/gimpviewabledialog.c: changed the "description"
+	property from CONSTRUCT_ONLY to CONSTRUCT.
+
+	* app/widgets/gimpcolormapeditor.c: show the index of the edited
+	color in the color dialog and use the correct icon. Replaced label
+	"Hex triplet" by "HTML notation" to be consistent with the color
+	dialog. Removed wrong 2 pixel border around the table below the
+	preview.
+
+2004-10-22  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/wmf.c: fixed non-interactive call with default
+	values.
+
+2004-10-22  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/colormap-editor-actions.c
+	* app/actions/dialogs-actions.c
+	* app/core/gimpimage-colormap.c
+	* app/dialogs/convert-dialog.c
+	* app/dialogs/dialogs.c
+	* app/widgets/gimpcolormapeditor.c: use the term "Colormap"
+	instead of "Indexed Palette". Fixes bug #155829.
+
+2004-10-22  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/wmf.c: applied a patch by Karine Proot that adds
+	a preview to the load dialog and a similar UI as the SVG loader.
+	Fixes bug #133519 and bug #133521.
+
+2004-10-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-enums.[ch]: added new enum GimpStrokeMethod which
+	can be one of { LIBART, PAINT_CORE }.
+
+	* app/core/Makefile.am
+	* app/core/core-types.h
+	* app/core/gimpstrokedesc.[ch]: new object which encapsulates
+	the params and setup logic for the different stroke methods.
+
+	* app/core/gimpitem.[ch]: use it in GimpItem::stroke() and
+	in the gimp_item_stroke() wrapper.
+
+	* app/core/gimpchannel.c (gimp_channel_stroke)
+	* app/core/gimpselection.c (gimp_selection_stroke)
+	* app/vectors/gimpvectors.c (gimp_vectors_stroke): changed accprdingly.
+
+	* app/actions/select-commands.c
+	* app/actions/vectors-commands.c
+	* app/dialogs/stroke-dialog.c
+	* tools/pdbgen/pdb/edit.pdb
+	* tools/pdbgen/pdb/paths.pdb: use GimpStrokeDesc. Simplifies the
+	code quite a bit.
+
+	* app/pdb/edit_cmds.c
+	* app/pdb/paths_cmds.c: regenerated.
+
+2004-10-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimppropwidgets.c: remember the param_spec with each
+	radio button instead of with the box/frame around them.
+
+2004-10-21 Kevin Cozens <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/script-fu.c: Removed _() tag from two strings
+	that should not have been marked for translation.
+
+2004-10-21  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts-fu.c: Fixed spelling error.
+
+2004-10-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/select-actions.c
+	* app/actions/select-commands.[ch]
+	* app/actions/vectors-actions.c
+	* app/actions/vectors-commands.[ch]: added actions and callbacks
+	to stroke with the last values used without showing the stroke
+	dialog. The actions have no menu entries but can be called via
+	shortcuts. Fixes bug #135746.
+
+	(Disclaimer: the uglyness of the callbacks shows the need for a
+	stroke API overhaul).
+
+2004-10-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable-stroke.c
+	(gimp_drawable_stroke_scan_convert): Replacing the call to
+	gimp_channel_is_empty() by a simple gimp_drawable_mask_intersect()
+	was wrong because gimp_channel_is_empty() makes sure that the
+	selection doesn't mask itself while being stroked.
+
+2004-10-20  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/raw.c: ported to GimpPreviewArea.
+
+2004-10-20  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/raw.c: new plug-in from Tim Copperfield, made
+	work with the GIMP 2.1 API by Philipp Gühring, then heavily
+	cleaned up and undeprecated by myself. Fixes bug #144943.
+	
+	(still uses GtkPreview, but i wanted a sane state in cvs to diff
+	 against before replacing it)
+
+	* plug-ins/common/plugin-defs.pl: changed accordingly.
+
+	* plug-ins/common/Makefile.am: regenerated.
+
+2004-10-20  Michael Natterer  <mitch@gimp.org>
+
+	Fixed bug #155733 for libgimp:
+
+	* tools/pdbgen/pdb/drawable.pdb: export drawable_mask_intersect()
+	to the PDB and improved documentation for drawable_mask_bounds().
+
+	* app/pdb/drawable_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpdrawable_pdb.[ch]: regenerated.
+
+	* libgimp/gimp.def: changed accordingly.
+
+2004-10-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable.[ch]: added gimp_drawable_mask_intersect()
+	which returns the same bounding box as gimp_drawable_mask_bounds(),
+	but returns TRUE only if there is a non-empty intersection between
+	the drawable and the selection, or no selection at all. It also
+	returns the intersection as x,y,width,height instead of the
+	eeky x1,y1,x2,y2.
+
+	* app/core/gimp-edit.c
+	* app/core/gimpdrawable-blend.c
+	* app/core/gimpdrawable-bucket-fill.c
+	* app/core/gimpdrawable-desaturate.c
+	* app/core/gimpdrawable-equalize.c
+	* app/core/gimpdrawable-histogram.c
+	* app/core/gimpdrawable-invert.c
+	* app/core/gimpdrawable-stroke.c
+	* app/core/gimpimagemap.c
+	* app/core/gimpselection.c
+	* tools/pdbgen/pdb/color.pdb
+	* tools/pdbgen/pdb/transform_tools.pdb: either switch from
+	gimp_drawable_mask_bounds() to _intersect() or check the return
+	values of _mask_bounds() manually to avoid operations on empty
+	areas. Return successfully because it's a nop, not a failure.
+	Fixes bug #155733 for the core.
+
+	* app/pdb/color_cmds.c
+	* app/pdb/transform_tools_cmds.c: regenerated.
+
+2004-10-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimptextoptions.c (gimp_text_options_gui): removed
+	3 mnemonics. No other tool options label has a mnemonic.
+	Addresses bug #155861.
+
+2004-10-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/vectors-options-dialog.[ch]: one more dialog split
+	out of actions/.
+
+	* app/actions/vectors-commands.c: removed it here. Merged more
+	utility functions into their only callers.
+
+	* app/actions/dockable-commands.c
+	* app/actions/edit-commands.c
+	* app/actions/file-commands.c
+	* app/actions/palettes-commands.c
+	* app/actions/tool-options-commands.c
+	* app/actions/view-commands.c: renamed "qbox" and "query_box"
+	variables to "dialog".
+
+2004-10-19  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/screenshot.c (shoot_dialog): don't forget to set
+	the mnemonic widgets for the labels. Fixes bug #155811.
+
+2004-10-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/channel-options-dialog.[ch]: new files implementing
+	the channel options dialog with a horrid number of 13 construction
+	parameters. Still better than having the same code twice, only
+	differing in strings used...
+
+	* app/actions/channels-commands.c
+	* app/actions/qmask-commands.c: removed the dialog code here and
+	use channel_options_dialog_new().
+
+2004-10-19  Jay Cox  <jaycox@gimp.org>
+
+	* plug-ins/common/psd_save.c: don't try to save psd files that are
+	larger than 30000 pixels in either direction.  Fixed the rle code
+	to compress more compactly.  Fixed a memmory leak in
+	save_channel_data.
+
+2004-10-18  Michael Natterer  <mitch@gimp.org>
+
+	Action code review and pre-release consistency cleanup:
+
+	* app/actions/*-actions.c: added some missing and resolved
+	conflicting mnemonics, added missing help IDs. Cleaned up the
+	*_actions_update() functions.
+
+	* app/actions/channels-actions.c
+	* app/actions/layers-actions.c
+	* app/actions/vectors-actions.c (*_actions_update): simplified
+	the code that figures the prev and next channel,layer,vectors.
+
+	* app/actions/qmask-actions.c: use the same accelerator for
+	"qmask-active" and "qmask-toggle". Fixed action sensitivity.
+
+	* app/actions/channels-commands.c
+	* app/actions/dockable-commands.c
+	* app/actions/documents-commands.c
+	* app/actions/gradients-commands.c
+	* app/actions/layers-commands.c
+	* app/actions/palettes-commands.c
+	* app/actions/image-commands.c
+	* app/actions/select-commands.c
+	* app/actions/vectors-commands.c: folded tons of private utility
+	functions into their only callers (they used to be public and
+	called from outside before the switch to action based menus).
+	Renamed functions and variables saying "query" or "qbox" to
+	"dialog". Moved static functions to the end of the files. Misc
+	minor cleanups.
+
+	* app/actions/drawable-actions.c
+	* app/actions/drawable-commands.c: made the "drawable-visible" and
+	"drawable-linked" actions affect the layer if the active drawable
+	is a layer mask.
+
+	* app/actions/select-commands.c: added action to stroke with the
+	last values used in an attempt to address bug #135746 but #if 0'ed
+	it because the approach is too ugly.
+
+	* app/tools/gimpiscissorstool.c: changed mnemonic from I to S.
+
+	* menus/image-menu-xml.in: added more stuff to the (commented out)
+	"context" menu.
+
+2004-10-17  DindinX  <dindinx@gimp.org>
+
+	* libgimp/gimppixelrgn.c: some more clues in the documentation
+	(suggested by nomis)
+
+2004-10-17  DindinX  <dindinx@gimp.org>
+
+	* libgimp/gimppixelrgn.c: clarify some usecases for
+	gimp_pixel_rgn_init().
+
+2004-10-17  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/colortoalpha.c: Added a preview.
+
+2004-10-17  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/glasstile.c: use a GimpDrawablePreview.
+
+2004-10-17  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/borderaverage.c: smallish cleanups.
+
+2004-10-17  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/displace.c: Added a preview and minor cleanups.
+	Can someone provide useful testcases for this plug-in?
+
+2004-10-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpitemtreeview.[ch]: moved "item_type" and
+	"signal_name" from GimpItemTreeView to GimpItemTreeViewClass.
+	Removed them from gimp_item_tree_view_new(). Require the view_type
+	instead of item_type in gimp_item_tree_view_new().
+
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimpdrawabletreeview.c (get_type): made them
+	abstract base classes.
+
+	* app/widgets/gimpchanneltreeview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpvectorstreeview.c (class_init): set the
+	item_type and signal_name members if GimpItemTreeViewClass.
+
+	* app/dialogs/dialogs-constructors.c: changed accordingly.
+
+2004-10-16  Manish Singh  <yosh@gimp.org>
+
+	* autogen.sh: Add support for automake 1.9. Also rm autom4te.cache,
+	since it might interfere with differing autoconf versions.
+
+2004-10-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpuimanager.[ch]: added utility function
+	gimp_ui_manager_get_action() which takes "group_name" and
+	"action_name".
+
+	* app/display/gimpdisplayshell-close.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimptoolbox.c
+	* app/widgets/gimptooloptionseditor.c: use it.
+
+2004-10-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/channels-actions.c
+	* app/actions/colormap-editor-actions.c
+	* app/actions/documents-actions.c
+	* app/actions/tool-options-actions.c
+	* app/actions/vectors-actions.c: added more tooltips for actions
+	which are used as extended dialog button callbacks.
+
+	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep
+	the list of extended actions in reverse order.
+
+	* app/widgets/gimpchanneltreeview.c
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimpdocumentview.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpselectioneditor.c
+	* app/widgets/gimptooloptionseditor.c
+	* app/widgets/gimpvectorstreeview.c: don't set the tooltips
+	manually. Removes another bunch of insane translatable multiline
+	format strings. Pass the extended actions in the right order
+	to gimp_editor_add_action_button().
+
+2004-10-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/vectors-commands.c (vectors_linked_cmd_callback):
+	call gimp_item_set_linked(), not gimp_item_set_visible().
+	Fixes bug #155578
+
+2004-10-16  Michael Natterer  <mitch@gimp.org>
+
+	Ported the layers, channels and paths dialogs from
+	gimp_editor_add_button() to gimp_editor_add_action_button(),
+	removing a massive amount of duplicated code, sensitivity logic
+	and confusing utility functions.
+
+	* app/actions/channels-actions.c
+	* app/actions/channels-commands.[ch]
+	* app/actions/layers-actions.c
+	* app/actions/layers-commands.[ch]
+	* app/actions/vectors-actions.c
+	* app/actions/vectors-commands.[ch]: added "foo-new-default"
+	actions and callbacks which create items without a dialog,
+	optionally using default values from a passed template. Removed
+	all public utility function that were passed as function pointers
+	to widget construtors. Added tooltips to all actions which are now
+	used for dialog buttons.
+
+	* app/widgets/gimpeditor.c (gimp_editor_add_action_button):
+	automatically create multi-line tooltips showing the modifiers for
+	extended action buttons. Removes the need for lots of insane
+	format strings that need to be translated correctly.
+
+	* app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass):
+	replaced tooltip and help_id strings by action names.
+
+	(struct GimpItemTreeView)
+	(gimp_item_tree_view_new): removed "edit", "new" and "activate"
+	function pointers.
+
+	(gimp_item_tree_view_constructor): create all buttons
+	with gimp_editor_add_action_button(), using the action names
+	from GimpItemTreeViewClass.
+
+	Removed tons of "clicked" callbacks and all code which sets the
+	buttons' sensitivity. They are not needed any longer.
+
+	Require all subclasses to implement GimpItemTreeView::new_item(),
+	a new virtual function which creates a plain new item without
+	showing a dialog.
+
+	* app/widgets/gimpdrawabletreeview.c
+	* app/widgets/gimpchanneltreeview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpvectorstreeview.c: fill in the action names and
+	implement GimpItemTreeView::new_item(). Removed all button
+	sensitivity logic.
+
+	* app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't
+	include anything from actions/ any more.
+
+2004-10-15  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/layer.pdb: fixed parameter descriptions for
+	layer_add_mask() and layer_remove_mask().
+
+	* app/pdb/layer_cmds.c
+	* libgimp/gimplayer_pdb.c: regenerated.
+
+2004-10-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/images-commands.[ch]
+	* app/actions/templates-commands.[ch]: made some public functions
+	private or removed them entirely by folding their code into their
+	callers. They used to be passed as function pointers to widgets in
+	the pre action-based dialog buttons era.
+
+2004-10-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/quit-dialog.c: raise the image's displays on
+	double-click in the dirty image list.
+
+2004-10-15  Michael Natterer  <mitch@gimp.org>
+
+	Fixed bug #155328:
+
+	* app/actions/vectors-actions.c (vectors_actions_update): don't
+	set the "selection to path" actions sensitive if there is no
+	image.
+
+	* app/widgets/gimpitemtreeview.c: update the UI manager after
+	setting the view's image. Connect to GimpImage::flush() and
+	update the UI manager in the callback, too.
+
+2004-10-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/view-actions.c (view_zoom_actions): removed
+	duplicate "view-zoom-in" action (cut'n'paste error) and fixed the
+	swapped "zoom in/out a lot" actions. Fixes bug #155446.
+
+2004-10-15  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.1.7 release.
+
+2004-10-15  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimptransformoptions.c: removed the "Density" label.
+	It wasn't helpful and caused the transform options to be wider than
+	necessary.
+
+	* app/tools/gimpblendoptions.c
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimptransformoptions.c: let combo boxes expand
+	horizontally like we do in other (all?) dialogs.
+
+	* app/widgets/gimptemplateeditor.c
+	(gimp_template_editor_aspect_callback): update the pixel size label.
+
+2004-10-15  Sven Neumann  <sven@gimp.org>
+
+	* data/images/gimp-splash.png: new splash by Jimmac.
+
+2004-10-15  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/scatter_hsv.c: ported to GimpDrawablePreview, and
+	removed many lines of codes.
+
+2004-10-14  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/neon.scm: Fixed minor error in script.
+	(Related to bug #153900 and compatability with Tiny-Fu)
+
+2004-10-14  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/neon.c: fixed the handling of drawable with alpha.
+
+2004-10-14  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/nlfilt.c: Ported to GimpDrawablePreview, the
+	previous preview was absolutely useless. Done some cleanups, too.
+
+	* plug-ins/common/spread.c: remember the preview state between
+	invocations.
+
+2004-10-14  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/emboss.c: use a GimpDrawablePreview instead of a
+	GimpAspectPreview, since this plug-in is somewhat edge-oriented and
+	this makes the code simpler ;)
+
+2004-10-14  Michael Natterer  <mitch@gimp.org>
+
+	* themes/Default/images/stock-gradient-bilinear-16.png
+	* themes/Default/images/stock-gradient-linear-16.png: rotate them
+	by 90 degrees. All our gradient previews and icons go left->right,
+	not top->bottom.
+
+2004-10-14  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/bmpread.c: Make sure we have a bpp value we can
+	handle, and fail gracefully if not. Fixes bug #155401.
+
+2004-10-14  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.c
+	* app/widgets/gimpenumwidgets.[ch]
+	* app/widgets/gimppropwidgets.c
+	* app/actions/layers-commands.c
+	* app/dialogs/convert-dialog.c
+	* app/tools/gimpblendoptions.c
+	* app/tools/gimpbucketfilloptions.c
+	* app/tools/gimpcolorbalancetool.c
+	* app/tools/gimpcolorizetool.c
+	* app/tools/gimpcoloroptions.c
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimphuesaturationtool.c
+	* app/tools/gimpinkoptions-gui.c
+	* app/tools/gimplevelstool.c
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimpselectionoptions.c
+	* app/tools/gimptransformoptions.c: the child of a GimpFrame must
+	not have any border width. Fixes many subtle misalignments.
+
+2004-10-14  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpprogress.[ch]: added "message" function to the
+	GimpProgress interface. Call gimp_message() if it is unimplemented.
+
+	* app/plug-in/plug-in-progress.[ch]: added new function
+	plug_in_progress_message() that passes the message to the current
+	proc_frame's progress.
+
+	* app/widgets/gimpthumbbox.c: implement GimpProgress::message.
+	Just do nothing in the implementation. We don't want to see
+	messages from file plug-ins that we use to create the thumbnails.
+
+	* tools/pdbgen/pdb/message.pdb
+	* app/pdb/message_cmds.c: if there's a current plug-in, dispatch
+	the message by calling plug_in_progress_message().
+
+	* app/display/gimpdisplayshell-close.c: fixed wrong types in
+	function calls.
+
+2004-10-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcolordialog.c (gimp_color_dialog_new): use
+	GIMP_HELP_COLOR_DIALOG as help_id.
+
+2004-10-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/dialogs-commands.c: purely cosmetic.
+
+2004-10-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-enums.[ch]: register GimpConvertPaletteType with
+	the type system.
+
+	* tools/pdbgen/enums.pl: regenerated.
+
+	* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
+	fixed to insert the widget at the right place in the radio box.
+
+	* app/dialogs/convert-dialog.c: use enum widgets and
+	gimp_enum_radio_frame_add(), resulting in a much better looking
+	dialog with much less lines of code.
+
+2004-10-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/helpbrowser/dialog.c: changed "Home" button to "Index".
+	"Home" is misleading and leads to problems in some locales (see
+	bug #148120).
+
+2004-10-14  Michael Natterer  <mitch@gimp.org>
+
+	* tools/authorsgen/contributors: correct UTF-8 spelling of
+	João S. O. Bueno Calligaris.
+
+	* AUTHORS
+	* app/dialogs/authors.h: regenerated.
+
+2004-10-14  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/circuit.scm: Fixed to allow use of
+	script on original layer.  (bug #155358)  Fixed spelling error.
+
+2004-10-13  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/Makefile.am: Remove stamp files during
+	maintainer-clean. Addresses bug #155357. Also flesh out the
+	dependencies some so rebuilds get triggered when all their
+	dependent files change.
+
+2004-10-14  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/file-commands.c (file_revert_cmd_callback): creata
+	an UTF-8 filename from the image URI and display that instead of
+	the URI.
+
+	* app/dialogs/convert-dialog.c (convert_dialog_new): removed the
+	palette size warning for transparent images. The number of colors
+	is already adjusted to 255. This text was IMO more frightening
+	than helpful.
+
+2004-10-13  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/add-bevel.scm: two variables were
+	not defined before first use (bug #153900).
+
+2004-10-13  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* app/widgets/gimpactionview.c: Fixed a spelling error.
+
+2004-10-13  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/colorify.c: Added a preview.
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.c: removed trailing whitespace.
+
+	* libgimpwidgets/gimpwidgets.def: added
+	gimp_preview_set_default_cursor.
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpmessagedialog.c: improved handling of parent
+	widget; probably just being paranoid here.
+
+	* app/actions/image-commands.c
+	* app/dialogs/image-new-dialog.c: ported memory size confirmation
+	dialogs to GimpMessageDialog.
+
+2004-10-13  DindinX  <dindinx@gimp.org>
+
+	* libgimpwidgets/gimppreview.[ch]: added a new function to set the
+	default cursor on preview: gimp_preview_set_default_cursor().
+
+	* libgimpwidgets/gimpscrolledpreview.c: changed accordlingly.
+
+	* plug-ins/common/flarefx.c:
+	* plug-ins/common/nova.c: use this function.
+
+	This addresses bug #90519.
+
+2004-10-13  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/cubism.c: Added a preview and done some cleanups.
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/plug-in-commands.c
+	* app/actions/templates-commands.c
+	* app/actions/tool-options-commands.c: ported more boolean queries
+	to GimpMessageDialog.
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpmessagedialog.c: handle parent widget not being
+	a GtkWindow by calling gtk_widget_get_toplevel().
+
+	* app/actions/data-commands.c
+	* app/actions/edit-commands.c
+	* app/actions/file-commands.c: ported more boolean queries to
+	GimpMessageDialog.
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpmessagedialog.[ch]: added a simple message
+	dialog to avoid code duplication.
+
+	* app/widgets/gimpmessagebox.c: set the border width to 12 pixels.
+
+	* app/dialogs/file-save-dialog.c
+	* app/dialogs/quit-dialog.c
+	* app/display/gimpdisplayshell-close.c
+	* app/widgets/gimperrordialog.c
+	* app/widgets/gimphelp.c
+	* app/widgets/gimpactionview.c: use the new GimpMessageDialog.
+
+2004-10-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/image-actions.c
+	* menus/image-menu.xml.in: added menu branch "<Image>/Image/Guides".
+
+	* plug-ins/script-fu/scripts/Makefile.am
+	* plug-ins/script-fu/scripts/guides-from-selection.scm
+	* plug-ins/script-fu/scripts/guides-new-percent.scm
+	* plug-ins/script-fu/scripts/guides-new.scm
+	* plug-ins/script-fu/scripts/guides-remove-all.scm: added new
+	scripts from Alan Horkan. Fixes bug #119667.
+
+2004-10-13  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/flarefx.c: cleaned up and simplified the
+	FlareCenter code even more.
+
+	* plug-ins/common/nova.c: did the same changes for the NovaCenter
+	stuff.
+
+	Also added code which sets an appropriate cursor on "realize" to
+	fix bug #90519, but GimpPreview currently prevents this from
+	working correctly...
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/widgets-enums.[ch]: changed the description for
+	GIMP_HELP_BROWSER_GIMP.
+
+	* app/dialogs/file-save-dialog.c:
+	* app/widgets/gimphelp.c: use a GimpDialog embedding a
+	GimpMessageBox instead of gimp_query_boolean_box which looks
+	somewhat old fashioned.
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphelp.c: improved error messages on missing help
+	browser plug-in.
+
+	* libgimpthumb/gimpthumb-utils.c
+	* libgimpthumb/gimpthumbnail.c: improved documentation.
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-close.c
+	(gimp_display_shell_close_dialog): changed button label.
+
+2004-10-12  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/asc2img.scm: Fixed error in name of
+	script used in second register line.
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-close.c: changed rounding.
+
+2004-10-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/image-new-dialog.c (image_new_response): don't
+	forget to reset the template combo on RESPONSE_RESET.
+
+2004-10-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplay-foreach.c: keep the container of dirty
+	images up to date.
+
+	* app/dialogs/quit-dialog.c: fixed model/view behavior here, too.
+
+	(both are still far from perfect)
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-close.c
+	(gimp_display_shell_close_dialog): keep the time uptodate.
+
+2004-10-13  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimagefile.c (gimp_imagefile_create_thumbnail): ref
+	the imagefile while creating the thumbnail.
+
+	* app/core/gimpimagefile.[ch]
+	* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): moved
+	the tricky part about thumbnail creation into the new function
+	gimp_imagefile_create_thumbnail_weak().
+
+2004-10-13  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/pagecurl/pagecurl.c: forgot to remove N_() from
+	gimp_plugin_menu_register().
+
+2004-10-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/preferences-dialog.c (prefs_dialog_new): added
+	missing and resolved conflicting mnemonics.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/selection-round.scm: moved out of the
+	"Modify" placeholder. Using placeholders from Script-Fu breaks
+	i18n.  We will need to change menu registration for scripts but
+	this will have to wait..
+
+2004-10-12  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/*/*.c: all plug-ins except script-fu: removed the
+	translation marks from the menu paths passed to
+	gimp_plugin_menu_register(). All default menu branches used by
+	included plug-ins are created and translated by the core now.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimage.[ch]: renamed struct member "unit" to
+	"resolution_unit".
+
+	* app/actions/image-commands.c
+	* app/core/gimp-edit.c
+	* app/core/gimpimage-duplicate.c
+	* app/core/gimpimage-undo-push.c
+	* app/dialogs/info-window.c
+	* app/vectors/gimpvectors-export.c
+	* app/widgets/gimptoolbox-dnd.c:
+	* app/xcf/xcf-load.c
+	* app/xcf/xcf-save.c: changed accordingly. Use gimp_image_get_unit()
+	where appropriate.
+
+	* app/core/gimptemplate.c (gimp_template_set_from_image): fixed
+	unit handling. Don't touch the template unit, it is used as the
+	initial display unit. This will need further changes...
+
+2004-10-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add):
+	need to pack the widget expanding. Fixes pattern container
+	entries.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/info-window.[ch]: fixed unit handling. Right-align
+	the labels displaying the cursor position. Renamed the "Extended"
+	tab to "Cursor". Renamed the API accordingly.
+
+	* app/display/gimpdisplayshell-cursor.c: changed accordingly.
+
+2004-10-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/drawable-commands.c (drawable_rotate_cmd_callback):
+	if the drawable is a channel, pass clip_result as FALSE. Need to
+	do this here for rotating only because it can't be decided
+	generically in GimpChannel. Fixes crash when rotating channels
+	or layer masks.
+
+	Use the undo_desc from GimpItemClass instead of passing "Flip
+	Layer" and "Rotate Layer".
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* app/file/file-open.c: minor cleanup.
+
+	* app/file/file-save.c (file_save_as): no need to fiddle with the
+	image name, the URI is taken from the imagefile anyway.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/layers-actions.c (layers_actions_update): set
+	"layers-crop" insensitive if the selection is empty.
+
+	* plug-ins/script-fu/scripts/alien-glow-button.scm
+	* plug-ins/script-fu/scripts/alien-glow-logo.scm
+	* plug-ins/script-fu/scripts/basic2-logo.scm
+	* plug-ins/script-fu/scripts/gradient-bevel-logo.scm: use "Sans
+	Bold" instead of "Futura_Poster". The underscore in the font name
+	used to confuse intltool (bug #137029) and the freefont package
+	isn't that widely used any longer anyway.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox.
+
+	* app/widgets/gimppropwidgets.c: the order of setting the X and Y
+	properties does matter.
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/scale-dialog.[ch]: added first version of a new
+	Scale dialog in an attempt to address bug #151022.
+
+	* app/actions/layers-commands.c: use the new scale dialog.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimptemplateeditor.c: added mnemonics for the size
+	entries.
+
+2004-10-12  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned):
+	instead of simply using the passed widget as mnemonic_widget for
+	the GtkLabel, call the new utility function find_mnemonic_widget()
+	which recursively searches the passed widget until it finds one
+	that actually can be mnemonic-activated. Fixes lots of mnemonics
+	where the attached widget is e.g. a GtkEventBox or GtkComboBox.
+
+2004-10-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimptooloptions-gui.[ch]: removed the recently added
+	utility functions again.
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpviewablebox.[ch]
+	* app/widgets/gimpwidgets-utils.[ch]: and added cleaned up
+	versions here.
+
+	* app/tools/gimpbucketfilloptions.c
+	* app/tools/gimpclonetool.c
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimptextoptions.c: changed accordingly.
+
+	* app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead
+	of reinventing the wheel.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpaction.c (gimp_action_set_proxy): use a larger
+	icon size for GimpImagefile views.
+
+	* themes/Default/images/stock-frame-64.png: removed the 1 pixel
+	wide empty border around the frame.
+
+	* app/widgets/gimpviewrenderer-frame.c: adjusted the hardcoded values.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* Makefile.am: defined DISTCHECK_CONFIGURE_FLAGS with the
+	configure options that are needed to run 'make dist'.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimptemplateeditor.c: tweaked table spacings to get
+	the Height label aligned with the entry again.
+
+2004-10-12  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpprogressdialog.c (gimp_progress_dialog_new): set
+	the "skip_taskbar_hint" and "skip_pager_hint" properties on the
+	progress window.
+
+2004-10-11  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/fp/fp.c: Moved from here...
+
+	* plug-ins/common/fp.c: ... to here.
+
+	* plug-ins/common/plugin-defs.pl: changed accordingly.
+
+	* plug-ins/common/.cvsignore
+	* plug-ins/common/Makefile.am: regenerated.
+
+	* configure.in
+	* plug-ins/Makefile.am
+	* plug-ins/fp: Removed directory.
+
+2004-10-11  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/jigsaw.c: ported to GimpAspectPreview.
+
+2004-10-11  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/flarefx.c: use a GimpSizeEntry for specifying
+	the flare center. Fixed flare center dragging. Lots of cleanup.
+
+2004-10-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/dialogs-types.h: removed ColorDialog typedef.
+
+2004-10-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimptooloptions-gui.[ch]: added utility functions
+	which create a GimpViewableButton+GimpContainerEntry combo for
+	brushes, patterns, gradients and fonts and a very ugly utility
+	function which packs one of these combos into a GtkFrame returned
+	by gimp_prop_enum_radio_frame_new(). This stuff does not really
+	belong here but is too ugly to be moved to a more general place.
+
+	* app/tools/gimpbucketfilloptions.c
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimptextoptions.c: use the new utility functions. Moved
+	the pattern previews into the radio frame where using the pattern
+	is selected. Make them insensitive if using the pattern is not
+	selected.
+
+2004-10-11  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimprc-blurbs.h: tweaked the thumbnail related blurbs.
+
+	* app/dialogs/preferences-dialog.c: group the thumbnail related
+	controls together. Could probably still be improved...
+
+2004-10-11  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/documents-commands.c
+	(documents_recreate_preview_cmd_callback): when recreating the
+	thumbnail, delete old thumbnails and create it in the configured
+	thumbnail size instead of the container view preview size.
+
+	* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_update_thumb):
+	reset the image info when the thumbnail state changes.
+
+2004-10-11  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c: construct a case-insensitive glob
+	pattern to use when filtering for file extensions.
+
+2004-10-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
+	user-visible counting starts at 1, not 0.
+
+2004-10-11  Michael Natterer  <mitch@gimp.org>
+
+	* tools/authorsgen/contributors: added missing contributors.
+	Thanks to Kevin Cozens for going through ChangeLog and making a list.
+
+	* AUTHORS
+	* app/dialogs/authors.h: regenerated.
+
+2004-10-11  Sven Neumann  <sven@gimp.org>
+
+	* libgimpthumb/gimpthumbnail.c: ooops, forgot to disable the debug
+	output again.
+
+2004-10-11  Sven Neumann  <sven@gimp.org>
+
+	* app/batch.c: clarified.
+
+2004-10-08  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* configure.in: removed duplicate GETTEXT_PACKAGE line.
+
+2004-10-11  Sven Neumann  <sven@gimp.org>
+
+	* libgimpthumb/gimpthumb-utils.[ch]
+	* libgimpthumb/gimpthumb.def: added an API to delete thumbnails.
+
+	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnail):
+	when recreating a thumbnail on user request, delete all existing
+	thumbnails for it.
+
+	* plug-ins/common/AlienMap2.c: removed unused variable.
+
+2004-10-10  Sven Neumann  <sven@gimp.org>
+
+	* libgimpthumb/gimpthumb-utils.[ch]
+	* libgimpthumb/gimpthumb.def
+	* libgimpthumb/gimpthumbnail.c: added support for local thumbnails
+	as introduced by version 0.7 of the thumbnail spec. Untested, but
+	at least the API is there.
+
+2004-10-10  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/AlienMap2.c: ported to GimpAspectPreview, and some
+	minor cleanups.
+
+2004-10-10  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/vpropagate.c: added a preview.
+
+2004-10-10  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/flarefx.c
+	* plug-ins/common/waves.c: cleanups and ported to GimpAspectPreview.
+
+2004-10-10  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcontainerview.c (gimp_container_view_lookup):
+	handle NULL as viewable parameter as a workaround for bug #149906.
+
+	* app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): made
+	the code more robust.
+
+	* app/xcf/xcf-private.h
+	* app/xcf/xcf.c: added a const qualifier.
+
+2004-10-09  DindinX  <dindinx@gimp.org>
+
+	* app/dialogs/dialogs.h: fixed a typo in the double-inclusion guard.
+
+2004-10-09  Sven Neumann  <sven@gimp.org>
+
+	* AUTHORS
+	* app/dialogs/authors.h: regenerated. Someone should look into
+	updating the list of contributors for the 2.2 release ...
+
+2004-10-08  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* tools/authorsgen/contributors: Added my name to the
+	list of contributors.
+
+2004-10-08  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpthumbbox.c: tweaked the text shown while
+	updating the preview so that the dialog doesn't need to resize.
+
+2004-10-08  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpcoreconfig.[ch]
+	* app/config/gimprc-blurbs.h: added new gimprc option
+	"thumbnail-filesize-limit" that allows to control the maximum
+	filesize for automatic thumbnail creation.
+
+	* app/dialogs/preferences-dialog.c: added a GUI for it, needs
+	review.
+
+	* app/core/gimpimagefile.[ch]: minor cleanups. Moved call to
+	gimp_thumbnail_peek_image() from gimp_imagefile_save_thumb() to
+	 gimp_imagefile_save_thumbnail() to avoid it being called twice.
+
+	* app/file/file-utils.[ch]: export utility function
+	file_utils_find_proc_by_extension() that allows to check for a
+	file plug-in by looking at the filename extension only.
+
+	* app/widgets/gimpthumbbox.[ch]: automatically create or update
+	thumbnails for image files with a known extension that are smaller
+	than "thumbnail-filesize-limit".  Fixes bug #137176.
+
+2004-10-08  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/ripple.c: handle the tile parameter identically
+	for preview and final result. Set Edges options insensitive when
+	"Retain tileability" is checked. Reported by Olivier.
+
+2004-10-08  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/apply_lens.c (lens_dialog): invalidate the
+	preview when the toggle buttons are used. Reported by Olivier.
+
+	* app/widgets/gimpview.c: minor cleanup.
+
+2004-10-08  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpmeasuretool.c: implement GimpTool::key_press() and
+	cancel the tool on GDK_Escape. Come cleanup.
+
+2004-10-08  Michael Natterer  <mitch@gimp.org>
+
+	Made the text options about two toolbox grid columns smaller.
+	Addresses bug #122862.
+
+	* app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use
+	the number of digits of the property's max_val plus two as number
+	of chars for the sizeentry'y spinbutton (instead of always 10 as
+	before).
+
+	* app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry
+	has a minimal width of 150 pixels (eek). Set a silly small minimal
+	width instead (the entry expands to the available width anyway).
+
+2004-10-08  Sven Neumann  <sven@gimp.org>
+
+	* app/file/file-utils.c: added lots of const qualifiers.
+
+2004-10-08  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimppaintoptions-gui.c: the gradient button in blend
+	options got lost, added it back. Also moved creation of the brush,
+	pattern and gradient buttons to utility functions and cleaned up
+	the whole file a bit.
+
+2004-10-08  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell.c (gimp_display_shell_real_scaled)
+	(gimp_display_shell_flush)
+	* app/gui/gui-vtable.c (gui_display_create): always pass a
+	GimpDisplay, not a GimpDisplayShell as "data" to
+	gimp_ui_manager_update().
+
+	* app/actions/actions.c (action_data_get_*): removed checks if the
+	passed data is a GimpDisplayShell and temporarily added g_assert()
+	to be sure. The assertions will be removed before 2.2.
+
+2004-10-07  Sven Neumann  <sven@gimp.org>
+
+	* libgimpthumb/gimpthumbnail.c: added some (disabled) debug output.
+
+	* app/widgets/gimpviewrenderer-frame.[ch]: added a way to retrieve
+	the size of the frame borders.
+
+	* app/widgets/gimpthumbbox.c: don't set an arbitrary padding but
+	exactly the size of the frame borders. Otherwise we get large
+	thumbnails (scaled down) if we request normal sized ones.
+
+2004-10-07  Kevin Cozens  <kcozens@cvs.gimp.org>
+
+	* plug-ins/script-fu/scripts/selection-round.scm: Changed deprecated
+	constant ADD to CHANNEL-OP-ADD.
+
+2004-10-07  Michael Natterer  <mitch@gimp.org>
+
+	Merged the gz and bz2 plug-ins into one generic compression
+	handler that can be extended by adding entries to a table of
+	compressor definitions:
+
+	* configure.in: removed bz2 special casing for win32.
+
+	* plug-ins/common/bz2.c
+	* plug-ins/common/gz.c: removed.
+
+	* plug-ins/common/compressor.c: new plug-in.
+
+	* plug-ins/common/plugin-defs.pl: changed accordingly.
+
+	* plug-ins/common/.cvsignore
+	* plug-ins/common/Makefile.am: regenerated.
+
+2004-10-07  Simon Budig  <simon@gimp.org>
+
+	* app/actions/view-commands.c: fill in the formula...  :-)
+	untabbified.
+
+	* app/display/gimpdisplayshell-scale.c: Micro-Cleanup, untabbified.
+
+2004-10-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/view-actions.c: changed zoom actions to be
+	GimpEnumActions using the GimpActionSelectType enum. Enables
+	keyboard shortcuts for useless stuff like "zoom out a lot", and
+	makes them better accessible for external controllers.
+
+	* app/actions/view-commands.[ch]: renamed view_zoom_cmd_callback()
+	to view_zoom_explicit_cmd_callback(), removed the zoom_in and
+	zoom_out callbacks and added a new view_zoom_cmd_callback() for
+	the new GimpActionSelectType-based actions. The implementation of
+	the new zoom types is questionable but now there is a place where
+	nomis can fill in nice formulas...
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpeditselectiontool.[ch]: added new parameter
+	"gboolean propagate_release" to gimp_edit_slection_tool_start()
+	and remember it in the GimpEditSelectionTool struct. If requested,
+	propagate GimpTool::button_release() to the tool below in the tool
+	stack.
+
+	* app/tools/gimpselectiontool.c (gimp_selection_tool_start_edit):
+	pass FALSE so we don't get the button_release().
+
+	* app/tools/gimpmovetool.[ch]: pass TRUE so we get
+	button_release(). If moving a layer or path in "pick active" mode,
+	remember the old active layer/path and switch back to it in
+	button_release(). Fixes bug #97734.
+
+	Unrelated:
+
+	* app/tools/gimpeditselectiontool.c
+	(gimp_edit_selection_tool_motion): set "first_move" to FALSE only
+	if a move actually happened. Fixes un-undoable moves at high zoom
+	factors.
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdnd.c (gimp_dnd_data_drag_begin): remember for
+	which GdkDragContext the icon_widget was made.
+
+	(gimp_dnd_data_drag_end): destroy the icon_widget only if it was
+	created for this GdkDragContext. Fixes broken DND icon_widgets
+	when dragging the same source again while the old icon_widget is
+	still floating back from an unsuccessful drop. Fixes bug #139337.
+
+2004-10-05  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/lib.pl: Slight cleanup of doc generating code.
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/lib.pl: for deprecated procedures, create a gtk-doc
+	comment that contains a link to the replacement procedure and
+	doesn't contain redundant information.
+
+	* tools/pdbgen/pdb/text_tool.pdb: fixed names of replacement
+	procedures.
+
+	* libgimp/gimpbrushes.c
+	* libgimp/gimpgradients.c
+	* libgimp/gimppalettes.c
+	* libgimp/gimppatterns.c: made the handwritten gtk-doc comments of
+	deprecated procedures look like the generated ones.
+
+	* app/pdb/text_tool_cmds.c
+	* libgimp/gimpbrushes_pdb.c
+	* libgimp/gimpgradients_pdb.c
+	* libgimp/gimppalettes_pdb.c
+	* libgimp/gimppatterns_pdb.c
+	* libgimp/gimptexttool_pdb.c: regenerated.
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimp-tools.c (gimp_tools_restore): reset the tool
+	options before deserializing so they have the correct default
+	values. Fixes bug #120832.
+
+	* app/tools/gimpbucketfilloptions.c
+	* app/tools/gimpmagnifyoptions.c
+	* app/tools/gimpselectionoptions.c
+	* app/tools/gimptransformoptions.c: removed all set_defaults()
+	utility functions and moved their code to reset(). The change
+	above calls them automatically so there is no need to call them
+	from the GUI constructors any more.
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/scripts/selection-round.scm: use a
+	scale_entry instead of a spinbutton, changed mnemonic from "R" to
+	"E", indentation.
+
+	* plug-ins/script-fu/scripts/test-sphere.scm: s/SF_BRUSH/SF-BRUSH/
+	in a comment.
+
+2004-10-06  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/selection-round.scm: applied patch by
+	Alan Horkan that improves usability and usefulness of this script.
+	Did some code cleanup and added the old procedure for backward
+	compatibility. Fixes bug #145147.
+
+	* menus/image-menu.xml.in: renamed placeholder in Image->Select
+	from "Outline" to "Modify".
+
+2004-10-06  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/postscript.c (ps_open): tweaked error message.
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/pdb/procedural_db.h (struct ProcRecord): changed new member
+	"deprecated" from "gboolean" to a "gchar*" which holds the name of
+	the replacement procedure.
+
+	* tools/pdbgen/app.pl: changed accordingly.
+
+	* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): show
+	the name of the replacement procedure in the warning message.
+
+	* tools/pdbgen/stddefs.pdb: added utility function
+	std_pdb_deprecated() which takes the name of the replacement
+	procedure and fills the blurb, help, author, copyright, date and
+	deprecated fields of the procedure definition.
+
+	* tools/pdbgen/pdb/brushes.pdb
+	* tools/pdbgen/pdb/gradients.pdb
+	* tools/pdbgen/pdb/image.pdb
+	* tools/pdbgen/pdb/palettes.pdb
+	* tools/pdbgen/pdb/patterns.pdb
+	* tools/pdbgen/pdb/text_tool.pdb: use it instead of duplicating
+	the same code and strings for all deprecated procedures.
+
+	* app/pdb/*_cmds.c
+	* libgimp/gimppatterns_pdb.c
+	* libgimp/gimptexttool_pdb.c: regenerated.
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	Fixed the scale constraints radio buttons:
+
+	* app/tools/gimptransformoptions.c (gimp_transform_options_gui):
+	initialize the radio group with the correct value instead of
+	resetting the model before creating the group.
+
+	(gimp_scale_options_constrain_callback): change the model
+	only if the radio button became active.
+
+	(gimp_scale_options_constrain_notify): new callback which makes
+	the radio buttons a real view on the model again (fixes GUI
+	updates on modifier press/release).
+
+2004-10-06  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/plug-in-actions.c (plug_in_actions_update): an image
+	doesn't necessarily have a drawable. Handle the case when it doesn't.
+
+2004-10-06  Sven Neumann  <sven@gimp.org>
+
+	* app/app_procs.[ch]
+	* app/batch.[ch]
+	* app/main.c: added new command-line option "--batch-interpreter"
+	that allows to specify the procedure to use to process batch
+	commands. Removed the perl-server hack but kept Script-Fu as the
+	default for backward compatibility.
+
+	* docs/gimp.1.in: documented the new option.
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/file-commands.c (file_revert_confirm_callback):
+	removed the code which sets the new image on all contexts where
+	the old image was set...
+
+	* app/display/gimpdisplay-foreach.c (gimp_displays_reconnect):
+	...and added it here so it happens for all calls of this function,
+	also from the PDB. Fixes bug #154638.
+
+2004-10-06  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimp.def: updated.
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/brush.pdb: return the mask's bpp and the
+	brush's pixmap data if it has one.
+
+	* tools/pdbgen/pdb/pattern.pdb: cleaned up.
+
+	* tools/pdbgen/pdb/image.pdb: added $deprecated = 1 to deprecated
+	functions even if they are not exported to libgimp any more.
+
+	* app/pdb/procedural_db.h (struct ProcRecord): added member
+	"gboolean deprecated".
+
+	* tools/pdbgen/app.pl
+	* app/xcf/xcf.c: fill it accordingly.
+
+	* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): warn
+	not only for deprecated procedured which are in the compat hach
+	table, but also for procedures with deprecated flag set to TRUE.
+
+	* app/pdb/*_cmds.c
+	* libgimp/gimpbrush_pdb.[ch]
+	* libgimp/gimppattern_pdb.[ch]: regenerated.
+
+	* libgimp/gimpbrushmenu.c
+	* plug-ins/gfig/gfig-style.c: changed accordingly.
+
+2004-10-05  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/lib.pl: Fix array return value generation when there
+	are more args after it.
+
+2004-10-06  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: bumped version number to 2.1.7.
+
+2004-10-06  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/lib.pl: put subsequent deprecated prototypes into
+	a single #ifndef ... #endif pair.
+
+	* libgimp/gimpbrushes_pdb.h
+	* libgimp/gimpgradients_pdb.h
+	* libgimp/gimppalettes_pdb.h
+	* libgimp/gimppatterns_pdb.h
+	* libgimp/gimptexttool_pdb.h: regenerated.
+
+2004-10-06  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimage.[ch]: store the time when the image is first
+	dirtied.
+
+	* app/display/gimpdisplayshell-close.c: tell the user what time
+	period of changes will be lost when the image is not saved.
+
+2004-10-06  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/brushes.pdb (brushes_get_brush_data)
+	* tools/pdbgen/pdb/gradients.pdb (gradients_sample_uniform)
+	(gradients_sample_custom) (gradients_get_gradient_data)
+	* tools/pdbgen/pdb/patterns.pdb (patterns_get_pattern_data):
+	deprecated.
+
+	* tools/pdbgen/pdb/brush.pdb
+	* tools/pdbgen/pdb/gradient.pdb
+	* tools/pdbgen/pdb/palette.pdb
+	* tools/pdbgen/pdb/pattern.pdb: added replacements for the
+	deprecated functions. Removed the silly feature that passing NULL
+	as name operates on the current brush, pattern etc.
+
+	* app/pdb/brush_cmds.c
+	* app/pdb/brushes_cmds.c
+	* app/pdb/gradient_cmds.c
+	* app/pdb/gradients_cmds.c
+	* app/pdb/internal_procs.c
+	* app/pdb/palette_cmds.c
+	* app/pdb/pattern_cmds.c
+	* app/pdb/patterns_cmds.c
+	* libgimp/gimpbrush_pdb.[ch]
+	* libgimp/gimpbrushes_pdb.[ch]
+	* libgimp/gimpgradient_pdb.[ch]
+	* libgimp/gimpgradients_pdb.[ch]
+	* libgimp/gimppalette_pdb.c
+	* libgimp/gimppattern_pdb.[ch]
+	* libgimp/gimppatterns_pdb.[ch]: regenerated.
+
+	* libgimp/gimpbrushmenu.c
+	* libgimp/gimpgradientmenu.c
+	* libgimp/gimppatternmenu.c
+	* plug-ins/FractalExplorer/Dialogs.c
+	* plug-ins/common/gradmap.c
+	* plug-ins/common/sample_colorize.c
+	* plug-ins/flame/flame.c
+	* plug-ins/gfig/gfig-style.c
+	* plug-ins/gflare/gflare.c
+	* plug-ins/pagecurl/pagecurl.c
+	* plug-ins/script-fu/scripts/spyrogimp.scm: changed accordingly.
+
+2004-10-06  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/spheredesigner.c: improved the dialog a bit,
+	needs more work.
+
+2004-10-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/addborder.scm: simple change to make
+	the script work on all image types, not only RGB.
+
+2004-10-05  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.1.6 release.
+
+2004-10-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/helpbrowser/dialog.c: added a close button. Launch the
+	browser with the HTML focused.
+
+2004-10-05  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned):
+	left-justify the label.
+
+	* libgimpwidgets/gimpdialog.c: if a button with GTK_RESPONSE_HELP
+	is being added, hide the automatically added help button.
+
+	* plug-ins/script-fu/script-fu-interface.c: five buttons are too
+	much for the action area. Renamed the About button to Help and
+	resurrected the help button in the about dialog as a way to get to
+	the actual help pages (pressing F1 will get you there as well).
+
+2004-10-05  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c: added a help button.
+
+2004-10-05  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call):
+	- check the number of elements of array parameters against
+	  the actually passed array and spit a proper error message
+	  instead of trashing the wire. Fixes bug #154266.
+	- g_strdup()/g_free() the proc_name so it doesn't get mungled
+	  by convert_string().
+	- added missing implementation of INT16ARRAY return values.
+	- cleaned up STRINGARRAY value implementations to work like
+	  all other array values.
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c (script_fu_reset):
+	fixed reset for SF_TEXT values.
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
+	oops, didn't meant to remove that line.
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/Makefile.am (imagemap_SOURCES): removed pix-data.h.
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_area):
+	take drawable offsets into account when masking the preview with
+	the selection mask.
+
+2004-10-04  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/gimprc.pdb (gimprc_query, gimprc_set): disallow
+	the empty string as token. Spotted by Kevin Cozens.
+
+	* app/pdb/gimprc_cmds.c: regenerated.
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpaspectpreview.c (gimp_aspect_preview_draw_buffer):
+	no need to set bpp before calling gimp_drawable_get_thumbnail_data().
+
+2004-10-04  DindinX  <dindinx@gimp.org>
+
+	* libgimp/gimpaspectpreview.c: (gimp_aspect_preview_draw_buffer):
+	only apply the effect inside the current selection. This, together
+	with my previous commit fixes bug #132194.
+
+2004-10-04  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/channel_mixer.c: Ported to GimpAspectPreview. This
+	addresses but not totally fixes bug #132194.
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpguiconfig.[ch]
+	* app/config/gimprc-blurbs.h: added gimprc option "show-help-button".
+
+	* app/dialogs/preferences-dialog.c: added a GUI for it.
+
+	* app/dialogs/file-save-dialog.c
+	* app/dialogs/image-new-dialog.c
+	* app/dialogs/quit-dialog.c
+	* app/display/gimpdisplayshell-close.c
+	* app/widgets/gimphelp-ids.h: don't set help-ids on confirmation
+	dialogs.
+
+	* libgimpbase/gimpprotocol.[ch]
+	* libgimp/gimp.[ch]: added boolean "show_help_button" to the
+	config message.
+
+	* app/plug-in/plug-in-run.c: pass the new preference to the plug-in.
+
+	* libgimpwidgets/gimpdialog.[ch]: added new function that allows to
+	set whether new dialogs should get a help button added.
+
+	* app/gui/gui.c
+	* libgimp/gimpui.c: call gimp_dialogs_show_help_button() according
+	to the gimprc settings.
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c (script_fu_about): set 
+	the help_func again (but not the help_id).
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c (script_fu_about):
+	enabled line wrapping on labels.
+	(script_fu_interface): substitute underscores by hyphens to
+	generate the help-id from the procedure name.
+
+2004-10-04  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpbase/gimpwire.c: added assertions to make sure "count" is
+	always >= 0. Turns the crash described in bug #154266 into a
+	warning plus corrupted wire state :) Real fix (in script-fu) will
+	follow. Untabified.
+
+2004-10-04  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimphelpui.c: untabified.
+
+	(gimp_help_callback): use GIMP_HELP_ID instead of "gimp-help-id".
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c (script_fu_interface):
+	set a minimum width for the color button again.
+	(script_fu_about): don't set help_func and help_id on the about
+	dialog.
+
+2004-10-04  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/brush.pdb
+	* tools/pdbgen/pdb/gradient.pdb
+	* tools/pdbgen/pdb/palette.pdb: disallow the empty string for
+	new brushes, gradients and palettes and check the return value
+	of gimp_data_factory_data_new(). Cleanup.
+
+	* app/core/gimpbrushgenerated.c (gimp_brush_generated_new)
+	* app/core/gimpgradient.c (gimp_gradient_new)
+	* app/core/gimpdatafactory.c (gimp_data_factory_data_new): same
+	here. Fixes bug #154264.
+
+	* app/core/gimpdata.[ch] (gimp_data_set_filename): added boolean
+	"deletable" parameter because it's not derivable from "writable".
+
+	* app/core/gimpdatafactory.c (gimp_data_factory_load_data): need
+	to figure "deletable" separately from "writable" to be able to
+	delete unsavable stuff in the user-writable data directories.
+	Fixes bug #154410.
+
+	(gimp_data_factory_data_save_single): cleaned up.
+
+	* app/pdb/brush_cmds.c
+	* app/pdb/gradient_cmds.c
+	* app/pdb/palette_cmds.c
+	* libgimp/gimpbrush_pdb.c
+	* libgimp/gimpgradient_pdb.c
+	* libgimp/gimppalette_pdb.c: regenerated.
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/asc2img.scm: a cleaned up version of
+	the script contributed by Kevin Cozens (see bug #153900).
+	
+	* plug-ins/script-fu/scripts/predator.scm: applied patch by Kevin
+	Cozens that fixes use of the script on original layer (bug #152678).
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/3d-outline.scm
+	* plug-ins/script-fu/scripts/blended-logo.scm
+	* plug-ins/script-fu/scripts/camo.scm
+	* plug-ins/script-fu/scripts/clothify.scm
+	* plug-ins/script-fu/scripts/flatland.scm
+	* plug-ins/script-fu/scripts/glossy.scm
+	* plug-ins/script-fu/scripts/land.scm
+	* plug-ins/script-fu/scripts/predator.scm
+	* plug-ins/script-fu/scripts/rendermap.scm
+	* plug-ins/script-fu/scripts/ripply-anim.scm
+	* plug-ins/script-fu/scripts/speed-text.scm
+	* plug-ins/script-fu/scripts/spinning-globe.scm: applied patches
+	from Kevin Cozens that define variables before first use (bug
+	#153900).
+
+2004-10-04  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpgradientmenu.c: handle allocation > requisition for
+	the gradient preview.
+
+	* plug-ins/script-fu/script-fu-interface.c: added a horizontal
+	size group for the left-aligned controls.
+
+2004-10-03  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/destripe.c: ported to GimpDrawablePreview.
+
+2004-10-03  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/nova.c: ported to GimpAspectPreview.
+
+2004-10-03  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/max_rgb.c: ported to GimpAspectPreview.
+
+2004-10-03  Michael Schumacher <schumaml@gmx.de>
+
+	* plug-ins/dbbrowser/Makefile.am
+	* plug-ins/script-fu/Makefile.am: moved the libgimpprocbrowser to
+	the beginning of LDADD
+	
+2004-10-03  DindinX  <dindinx@gimp.org>
+
+	* libgimp/gimpaspectpreview.c: limit the size of the preview to 512
+	pixels.  This prevents plug-ins using gimp_drawable_get_thumbnail_data
+	to crash.
+
+2004-10-03  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/emboss.c: ported to GimpAspectPreview and made some
+	cleanups so this plug-in now use the same naming scheme as other
+	plug-ins do.
+
+2004-10-03  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/whirlpinch.c: ported to GimpAspectPreview.
+
+2004-10-03  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/color.pdb: export the Colorize tool to the PDB.
+	Fixes bug #154368.
+
+	* app/pdb/color_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpcolor_pdb.[ch]: regenerated.
+
+2004-10-03  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/blinds.c: use a GimpAspectPreview to make the
+	preview resizable.
+
+2004-10-03  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/ripple.c: Added a preview.
+
+2004-10-02  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/polar.c: use a GimpAspectPreview.
+
+2004-10-02  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/mapcolor.c: use a GimpAspectPreview and made the
+	code much simpler.
+
+2004-10-02  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/illusion.c: use a GimpAspectPreview so the preview
+	is now resizable.
+
+2004-10-02  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/apply_lens.c: added a preview.  This plug-in still
+	need some work.
+
+2004-10-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-callbacks.c
+	(gimp_display_shell_tool_events): dispatch GDK_Escape to
+	GimpTool::key_press().
+
+	* app/tools/gimpcroptool.c (gimp_crop_tool_key_press)
+	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press):
+	* app/tools/gimptransformtool.c (gimp_transform_tool_key_press):
+	cancel the tool on <Escape>.
+
+2004-10-01  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/dbbrowser/plugin-browser.c: it's Plug-In, not Plugin.
+
+2004-10-01  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpcroptool.c (crop_response): destroy the info
+	dialog instead of hiding it. Fixes session management.
+
+2004-10-01  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpcroptool.c: unset the highlight from
+	crop_response() so it gets called when cropping is cancelled.
+
+	* app/dialogs/info-dialog.c (info_dialog_show): do what the
+	function name says, show the window, but don't present it.
+	Fixes bugs #128833 and #138816.
+
+2004-10-01  Sven Neumann  <sven@gimp.org>
+
+	* themes/Default/images/stock-frame-64.png: replaced the obtrusive
+	drop-shadow by a thin white frame with a subtle shadow. Taken from
+	a mockup done by Jimmac.
+
+	* app/widgets/gimpviewrenderer-frame.c: changed the hardcoded
+	offsets for the new frame image :(
+
+2004-10-01  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-callbacks.c: no need to include
+	gimpdisplayshell-render.h here.
+
+	* app/display/gimpdisplayshell-draw.c
+	* app/display/gimpdisplayshell-render.[ch]
+
+	* app/display/gimpdisplayshell.[ch]: added an API to highlight a
+	rectangle (specified in image coordinates). Actually it doesn't
+	highlight but dims the area outside the rectangle.
+
+	* app/tools/gimpcroptool.c: use the new functionality to show the
+	area to be cropped. Fixes bug #93360.
+
+2004-09-30  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/script-fu-types.h (struct SFScript): renamed
+	member "decription" to "menu_path".
+
+	* plug-ins/script-fu/script-fu-interface.c: changed accordingly.
+
+	* plug-ins/script-fu/script-fu-scripts.c: ditto. Don't pass the
+	menu_path as "blurb" to gimp_install_temp_proc(). Instead,
+	pass "help" as "blurb" and nothing as "help".
+
+	* plug-ins/script-fu/scripts/test-sphere.scm: shortened overly
+	long and useless help text.
+
+2004-09-30  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/dbbrowser/gimpprocbox.c: don't include
+	"libgimp/stdplugins-intl.h".
+
+	* plug-ins/dbbrowser/gimpprocbrowser.c
+	* plug-ins/dbbrowser/plugin-browser.c: use gimp_destroy_paramdefs()
+	so we don't leak all param names and descriptions.
+
+	* plug-ins/dbbrowser/gimpprocview.c: don't show empty rows or
+	redundant information (help == blurb for deprecated procedures).
+
+2004-09-30  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/dbbrowser/Makefile.am
+	* plug-ins/dbbrowser/gimpprocbox.c: new files holding more common
+	code from the two browsers.
+
+	* plug-ins/dbbrowser/gimpprocbrowser.c: use it.
+
+	* plug-ins/dbbrowser/plugin-browser.c: ditto. Re-enabled sorting
+	by all columns in both views. More cleanup.
+
+2004-09-30  Sven Neumann  <sven@gimp.org>
+
+	* README: added missing linebreak.
+
+	* plug-ins/imagemap/imap_about.c (do_about_dialog): should not
+	mark email address for translation.
+
+2004-09-30  Daniel Egger  <degger@fhm.edu>
+
+	* README: Applied proofreading patch from Jonathan Levi
+	<drjlevi@netonecom.net>.
+
+2004-09-30  Michael Natterer  <mitch@gimp.org>
+
+	Cleaned up the DB Browser and Plugin Details code and GUI.  It's
+	not perfect yet but at least they don't look like crap any more.
+	Fixes bug #131490.
+
+	* plug-ins/common/plugin-defs.pl
+	* plug-ins/common/plugindetails.c: removed this plugin.
+
+	* plug-ins/common/.cvsignore
+	* plug-ins/common/Makefile.am: regenerated.
+
+	* plug-ins/dbbrowser/Makefile.am
+	* plug-ins/dbbrowser/dbbrowser.c
+	* plug-ins/dbbrowser/dbbrowser_utils.[ch]: removed these files.
+
+	* plug-ins/dbbrowser/gimpprocbrowser.[ch]
+	* plug-ins/dbbrowser/gimpprocview.[ch]: new cleaned up files.
+
+	* plug-ins/dbbrowser/plugin-browser.c: the former plugindetails.
+	* plug-ins/dbbrowser/procedure-browser.c: the former dbbrowser.
+
+	* plug-ins/script-fu/Makefile.am: link against the new library
+	libgimpprocbrowser.a
+
+	* plug-ins/script-fu/script-fu-console.c: changed #includes
+	accordingly. Minor cleanup.
+
+	* tools/pdbgen/pdb/plug_in.pdb (plugins_query): fixed menu_path
+	return value. Was broken since the plug-in menu registering
+	changes.
+
+	* app/pdb/plug_in_cmds.c: regenerated.
+
+2004-09-30  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphelp.c (gimp_help_get_locales): fixed brokeness
+	I introduced with my last cleanup.
+
+2004-09-29  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/plug-ins/gimpfu.py: applied slightly tweaked patch
+	from Joao S. O. Bueno, which adds a mutliline text field (PF_TEXT) and
+	untabbifies things. Closes bug #153921.
+
+	* plug-ins/pygimp/plug-ins/gimpplugin.py
+	* plug-ins/pygimp/plug-ins/gimpshelf.py
+	* plug-ins/pygimp/plug-ins/gimpui.py: Untabbify.
+
+2004-09-29  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/plug-ins/gtkcons.py: minor tweak to history
+	behavior.
+
+	* plug-ins/pygimp/plug-ins/clothify.py
+	* plug-ins/pygimp/plug-ins/foggify.py
+	* plug-ins/pygimp/plug-ins/gimpcons.py
+	* plug-ins/pygimp/plug-ins/gtkcons.py
+	* plug-ins/pygimp/plug-ins/pdbbrowse.py
+	* plug-ins/pygimp/plug-ins/shadow_bevel.py
+	* plug-ins/pygimp/plug-ins/sphere.py
+	* plug-ins/pygimp/plug-ins/whirlpinch.py: Untabbify.
+
+2004-09-29  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpcropoptions.c (gimp_crop_options_gui): plugged a
+	tiny memleak spotted by Olivier.
+
+2004-09-29  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.[ch]
+	* libgimpwidgets/gimpwidgets.def: added gimp_preview_draw_buffer().
+
+	* libgimp/gimpaspectpreview.[ch]
+	* libgimp/gimpdrawablepreview.[ch]
+	* libgimp/gimpui.def: removed the public draw_buffer API.
+	Implement the virtual GimpPreview::draw_buffer method instead.
+
+	* plug-ins/common/cartoon.c
+	* plug-ins/common/deinterlace.c
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/dog.c
+	* plug-ins/common/edge.c
+	* plug-ins/common/engrave.c
+	* plug-ins/common/exchange.c
+	* plug-ins/common/gauss.c
+	* plug-ins/common/grid.c
+	* plug-ins/common/neon.c
+	* plug-ins/common/noisify.c
+	* plug-ins/common/oilify.c
+	* plug-ins/common/photocopy.c
+	* plug-ins/common/plasma.c
+	* plug-ins/common/sel_gauss.c
+	* plug-ins/common/sharpen.c
+	* plug-ins/common/shift.c
+	* plug-ins/common/snoise.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/struc.c: changed accordingly. Don't pass the
+	preview around as GimpDrawablePreview or GimpAspectPreview. It
+	should whenever possible be accessed as GimpPreview.
+
+2004-09-29  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.[ch]
+	* libgimpwidgets/gimpscrolledpreview.[ch]
+	* libgimpwidgets/gimpwidgets.def: moved the offsets and the
+	draw_thumb method back to the GimpPreview class.
+
+	* libgimp/gimpdrawablepreview.c: changed accordingly.
+
+	* plug-ins/common/bumpmap.c
+	* plug-ins/common/cartoon.c
+	* plug-ins/common/deinterlace.c
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/dog.c
+	* plug-ins/common/edge.c
+	* plug-ins/common/engrave.c
+	* plug-ins/common/exchange.c
+	* plug-ins/common/gauss.c
+	* plug-ins/common/grid.c
+	* plug-ins/common/mblur.c
+	* plug-ins/common/neon.c
+	* plug-ins/common/noisify.c
+	* plug-ins/common/oilify.c
+	* plug-ins/common/photocopy.c
+	* plug-ins/common/sel_gauss.c
+	* plug-ins/common/sharpen.c
+	* plug-ins/common/shift.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/softglow.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/struc.c
+	* plug-ins/common/unsharp.c
+	* plug-ins/common/wind.c: back to using gimp_preview_get_position().
+
+	* libgimp/gimpregioniterator.c (gimp_rgn_iterator_new): corrected
+	gtk-doc comment.
+
+2004-09-29  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/snoise.c: Use a GimpAspectPreview here, so the
+	preview is resizable.
+
+2004-09-29  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpui.def
+	* libgimpwidgets/gimpwidgets.def: updated.
+
+2004-09-29  DindinX  <dindinx@gimp.org>
+
+	* libgimpwidgets/gimppreview.c
+	* libgimpwidgets/gimppreview.h: split this widget into itself (more
+	abstract now) and ...
+
+	* libgimpwidgets/gimpscrolledpreview.c
+	* libgimpwidgets/gimpscrolledpreview.h: this widget which also have
+	some scrollbars and a nagivation preview.
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgetstypes.h: changed accordingly.
+
+	* libgimp/gimpaspectpreview.c
+	* libgimp/gimpaspectpreview.h: Added this widget, derived from
+	GimpPreview, which has always the same ratio has the given drawable.
+	This widget has almost the same api as GimpDrawablePreview, and is
+	useful for plug-ins that show the whole (scaled) drawable in their
+	preview.
+
+	* libgimp/gimpdrawablepreview.c
+	* libgimp/gimpdrawablepreview.h: GimpDrawablePreview is now derived
+	from GimpScrolledPreview.
+
+	* libgimp/Makefile.am
+	* libgimp/gimpui.h
+	* libgimp/gimpuitypes.h: changed accordingly.
+
+	* plug-ins/common/plasma.c: use a GimpAspectPreview.
+
+	* plug-ins/common/bumpmap.c
+	* plug-ins/common/cartoon.c
+	* plug-ins/common/deinterlace.c
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/dog.c
+	* plug-ins/common/edge.c
+	* plug-ins/common/engrave.c
+	* plug-ins/common/exchange.c
+	* plug-ins/common/gauss.c
+	* plug-ins/common/grid.c
+	* plug-ins/common/mblur.c
+	* plug-ins/common/neon.c
+	* plug-ins/common/noisify.c
+	* plug-ins/common/oilify.c
+	* plug-ins/common/photocopy.c
+	* plug-ins/common/sel_gauss.c
+	* plug-ins/common/sharpen.c
+	* plug-ins/common/shift.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/softglow.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/struc.c
+	* plug-ins/common/unsharp.c
+	* plug-ins/common/wind.c: use gimp_scrolled_preview_get_position
+	instead of gimp_preview_get_position.
+
+2004-09-29  Michael Natterer  <mitch@gimp.org>
+
+	* libgimp/gimpregioniterator.[ch]: renamed the "run_mode"
+	parameters to "unused" and remode the rum_mode member from the
+	private GimpRgbIterator struct.
+
+	* plug-ins/common/AlienMap2.c
+	* plug-ins/common/autostretch_hsv.c
+	* plug-ins/common/c_astretch.c
+	* plug-ins/common/color_enhance.c
+	* plug-ins/common/colorify.c
+	* plug-ins/common/colortoalpha.c
+	* plug-ins/common/gradmap.c
+	* plug-ins/common/mapcolor.c
+	* plug-ins/common/max_rgb.c
+	* plug-ins/common/noisify.c
+	* plug-ins/common/normalize.c
+	* plug-ins/common/sample_colorize.c
+	* plug-ins/common/scatter_hsv.c
+	* plug-ins/common/semiflatten.c
+	* plug-ins/common/threshold_alpha.c
+	* plug-ins/common/vinvert.c
+	* plug-ins/fp/fp.c: made "run_mode" a private variable of run()
+	and pass 0 to gimp_rgn_iterate*(). Minor cleanups.
+
+2004-09-29  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimp.def
+	* libgimp/gimpui.def
+	* libgimpwidgets/gimpwidgets.def: updated.
+
+2004-09-29  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/Makefile.am
+	* tools/pdbgen/groups.pl: renamed group "gradient_edit" to
+	"gradient" and added "brush", "palette" and "pattern" groups.
+
+	* tools/pdbgen/pdb/gradient_edit.pdb: removed.
+
+	* tools/pdbgen/pdb/brush.pdb
+	* tools/pdbgen/pdb/gradient.pdb
+	* tools/pdbgen/pdb/palette.pdb
+	* tools/pdbgen/pdb/pattern.pdb: new files containing functions
+	which create, duplicate, rename, delete, query and manipulate
+	a single brush, pattern etc.
+
+	* tools/pdbgen/pdb/brushes.pdb
+	* tools/pdbgen/pdb/gradients.pdb
+	* tools/pdbgen/pdb/palettes.pdb
+	* tools/pdbgen/pdb/patterns.pdb: deprecated stuff that is obsolete
+	now and simply removed the procedures that were added after 2.0.
+
+	* app/pdb/gradient_edit_cmds.c
+	* libgimp/gimpgradientedit_pdb.[ch]: removed.
+
+	* app/pdb/brush_cmds.c
+	* app/pdb/gradient_cmds.c
+	* app/pdb/palette_cmds.c
+	* app/pdb/pattern_cmds.c
+	* libgimp/gimpbrush_pdb.[ch]
+	* libgimp/gimpgradient_pdb.[ch]
+	* libgimp/gimppalette_pdb.[ch]
+	* libgimp/gimppattern_pdb.[ch]: new files.
+
+	* app/pdb/brushes_cmds.c
+	* app/pdb/gradients_cmds.c
+	* app/pdb/internal_procs.c
+	* app/pdb/palettes_cmds.c
+	* app/pdb/patterns_cmds.c
+	* libgimp/gimp_pdb.h
+	* libgimp/gimpbrushes_pdb.[ch]
+	* libgimp/gimpgradients_pdb.[ch]
+	* libgimp/gimppalettes_pdb.[ch]
+	* libgimp/gimppatterns_pdb.[ch]: regenerated.
+
+	* app/pdb/Makefile.am
+	* libgimp/Makefile.am
+	* plug-ins/gfig/gfig-style.c: changed accordingly.
+
+2004-09-28  Sven Neumann  <sven@gimp.org>
+
+	* app/file/gimprecentlist.c (gimp_recent_list_write): don't write
+	empty groups.
+
+	* app/file/gimprecentlist.c: disabled the code for the win32
+	platform. It doesn't make much sense there anyway. If someone
+	wants to contribute a win32 specific implementation, we'd welcome
+	that. A Mac OS X implementation would be nice to have as well.
+
+2004-09-28  Sven Neumann  <sven@gimp.org>
+
+	* etc/ps-menurc: updated for GIMP 2.1 by Eric Pierce.
+
+2004-09-28  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/imagemap/imap_circle.c: 
+	* plug-ins/imagemap/imap_cmd_gimp_guides.c
+	* plug-ins/imagemap/imap_edit_area_info.c
+	* plug-ins/imagemap/imap_grid.c
+	* plug-ins/imagemap/imap_polygon.c 
+	* plug-ins/imagemap/imap_rectangle.c
+	* plug-ins/imagemap/imap_settings.c: first set of changes to make
+	imagemap fully HIG compliant. More to come.
+
+2004-09-28  Sven Neumann  <sven@gimp.org>
+
+	* app/file/gimprecentlist.c: seek to the start of the file before
+	calling lockf().
+
+2004-09-28  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/common/borderaverage.c: added size entry. Fixes #143156
+	(Use size entry widget in Borderaverage plug-in)
+
+2004-09-28  Sven Neumann  <sven@gimp.org>
+
+	* docs/gimp.1.in: updated name of the splash image.
+
+2004-09-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimppalette.c: code review / cleanup.
+
+	(gimp_palette_delete_entry): don't add "Black" when the last color
+	gets removed, a palette can easily live with zero colors.
+
+	* app/widgets/gimppaletteeditor.c
+	(palette_editor_invalidate_preview): also update the entry which
+	shows the palette_entry's name.
+
+2004-09-28  Sven Neumann  <sven@gimp.org>
+
+	* app/file/gimprecentlist.c (gimp_recent_list_write_raw): handle
+	EINTR while writing.
+
+2004-09-28  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpxmlparser.[ch]: added new convenience function
+	gimp_xml_parser_parse_fd().
+
+	* app/file/Makefile.am
+	* app/file/gimprecentitem.[ch]
+	* app/file/gimprecentlist.[ch]: added an implementation of the
+	recent-files spec as found on freedesktop.org. This code is taken
+	from libegg and has been edited to fit the GIMP needs.
+
+	* app/file/file-open.c
+	* app/file/file-save.c: update the ~/.recently-used file. Fixes
+	bug #131206.
+
+2004-09-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainerbox.c (gimp_container_box_get_preview):
+	removed hack which strcmp()s the property name to figure the
+	preview's border_width and use the container view's
+	preview_border_width instead.
+
+2004-09-28  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
+	simplified code and removed a compiler warning.
+
+2004-09-28  Carol Spears  <carol@gimp.org>
+
+	* data/images/gimp-splash.png there was a white spot that was making
+	me crazy.  It is gone now.
+
+2004-09-28  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpaction.c (gimp_action_set_proxy): added a hack
+	to get rid of the border drawn around thumbnails in the "Open Recent"
+	menu.
+
+2004-09-28  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog):
+	add a shortcut to the filechooser that points to the user's folder.
+
+	* app/actions/vectors-commands.c: added a file filter to the SVG
+	import dialog.
+
+2004-09-27  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): added some
+	padding for the shadow frame to avoid scaling the thumbnail.
+
+2004-09-27  Sven Neumann  <sven@gimp.org>
+
+	* themes/Default/images/Makefile.am
+	* themes/Default/images/stock-frame-64.png: added a stock icon
+	that shows a simple drop shadow but could be exchanged for other
+	image decorations.
+
+	* libgimpwidgets/gimpstock.[ch]: register the new icon.
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some
+	ugly code to draw a frame around a preview pixbuf.
+
+	* app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached
+	to the GimpViewRenderer class so it can be shared by all renderers.
+
+	* app/widgets/gimpviewrendererimagefile.c: use the new functionality
+	to draw a nice frame around imagefile previews.
+
+	* app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border.
+
+2004-09-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/data-commands.c: cleanup.
+
+	* app/actions/vectors-commands.c
+	* app/display/gimpdisplayshell.c
+	* tools/pdbgen/pdb/paint_tools.pdb: removed unused #includes.
+
+	* app/text/gimptext-bitmap.c
+	* app/text/gimptext-parasite.c
+	* app/text/gimptext-vectors.c
+	* app/text/gimptext-xlfd.c
+	* app/text/gimptext.c
+	* app/text/gimptextlayer-xcf.c: include "text-types.h" instead
+	of "text/text-types.h".
+
+	* app/widgets/gimppatternselect.c: create a GimpPatternFactoryView
+	instead of GimpDataFactoryView.
+
+	* app/pdb/paint_tools_cmds.c: regenerated.
+
+2004-09-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/brushes-actions.c
+	* app/actions/gradients-actions.c
+	* app/actions/palettes-actions.c
+	* app/actions/patterns-actions.c: made the "foo-edit" actions
+	GimpStringActions and pass the identifier of the editor dialog
+	to the callback.
+
+	* app/actions/data-commands.[ch] (data_edit_data_cmd_callback):
+	show the editor dialog here instead of calling view->edit_func().
+
+	* app/dialogs/dialogs-constructors.[ch]: removed the brush,
+	gradient and palette edit_funcs.
+
+	* app/widgets/widgets-types.h: removed typedef GimpDataEditFunc.
+
+	* app/widgets/gimpdatafactoryview.[ch]: removed the edit_func
+	member and parameters and create the edit button unconditionally.
+
+	* app/widgets/gimpbrushfactoryview.[ch]
+	* app/widgets/gimppatternfactoryview.[ch]: changed accordingly.
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpdataselect.[ch]: removed this class, it's not
+	needed any longer.
+
+	* app/widgets/gimpbrushselect.[ch]
+	* app/widgets/gimpgradientselect.[ch]
+	* app/widgets/gimppaletteselect.[ch]
+	* app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog
+	and follow the edit_func removal.
+
+	* app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func
+	stuff.
+
+	* app/widgets/gimpcontainereditor.c: minor unrelated cleanup.
+
+2004-09-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/dialogs-constrcutors.[ch]: renamed some constructors
+	for consistency and added a (useless) template grid.
+
+	* app/dialogs/dialogs.c: make the arrays of GimpDialogFactoryEntries
+	more readable by using macros to define them.
+
+2004-09-27  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimagefile.c: removed conversion to TempBuf.
+	Instead implement GimpViewable::get_new_pixbuf by compositing the
+	thumbnail on a checkerboard.
+
+	* app/widgets/gimpviewrenderer.[ch]: renamed the no_view_pixbuf
+	struct member to pixbuf.
+	(gimp_view_renderer_real_render): try gimp_viewable_get_pixbuf()
+	and render the pixbuf before falling back to the TempBuf preview.
+	(gimp_view_renderer_render_pixbuf): new function that sets a
+	pixbuf for the renderer and flushes the render_buffer.
+
+	* app/widgets/gimpviewrendererimagefile.c
+	(gimp_view_renderer_imagefile_render): render the pixbuf.
+
+	* app/dialogs/dialogs-constructors.c: create the document history
+	dockable with a zero borderwidth.
+
+2004-09-27  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail_invoker): use
+	the GIMP_CHECK_SIZE_SM define, not the enum value
+	GIMP_CHECK_SIZE_SMALL_CHECKS which is 0 (eeek!).
+
+	* app/pdb/fileops_cmds.c: regenerated.
+
+	* app/widgets/gimphelp.c (gimp_help_get_locales): minor cleanup.
+
+2004-09-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdataeditor.[ch]: added "data" property.
+
+	* app/widgets/gimpbrusheditor.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimppaletteeditor.c: pass the current data to
+	g_object_new() so we never end up with initially empty editors.
+
+2004-09-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdataeditor.[ch]: added CONSTRUCT_ONLY
+	"data-factory" property. Removed gimp_data_editor_construct().
+
+	* app/widgets/gimpbrusheditor.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimppaletteeditor.c: pass the construct parameters
+	to g_object_new().
+
+2004-09-26  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcolorframe.c: changed label alignment to be more
+	HIG conformant and consistent with the rest of the user interface.
+
+2004-09-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdialogfactory.[ch]: added "name", "blurb",
+	"stock_id" and "help_id" to struct GimpDialogFactoryEntry and to
+	gimp_dialog_factory_dialog_register(). Added typedef
+	GimpDialogConstructor which takes a GimpDialogFactoryEntry in
+	addition to the parameters GimpDialogNewFunc takes. Added a
+	constructor function pointer to GimpDialogFactory which defaults
+	to a function that just returns entry->new_func(). Use that
+	constructor instead of entry->new_func() for creating
+	dialogs. Added public API gimp_dialog_factory_set_constructor().
+
+	* app/dialogs/dialogs.c: register name, blurb, stock_id and
+	help_id for all dockables so all the dialog info lives in one huge
+	ugly table now. For the global_toolbox_factory and the
+	global_dock_factory, set a constructor which creates a dockable
+	around the widget returned by entry->new_func().
+
+	* app/dialogs/dialogs-constructors.[ch]: don't create the dockable
+	in each dialog constructor. Removes tons of code and reduces most
+	constructors to a "return gimp_foo_new(...)" one-liner. Got rid of
+	all static variables, they were from a time when GimpDialogFactory
+	was unable to manage singletons.
+
+	* app/widgets/gimpbrusheditor.[ch]
+	* app/widgets/gimpgradienteditor.[ch]
+	* app/widgets/gimppaletteeditor.[ch]: return GtkWidget, not
+	GimpDataEditor from gimp_foo_editor_new().
+
+	* app/widgets/gimpdataeditor.c: minor cleanups.
+
+2004-09-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcolordialog.c: moved stuff from new() to init().
+
+2004-09-26  Michael Natterer  <mitch@gimp.org>
+
+	Ported GimpNavigationView to use actions for its buttons:
+
+	* app/menus/menus.c (menus_init): register a <GimpNavigationEditor>
+	UI manager containing the "view" action group.
+
+	* app/actions/actions.c (action_data_get_foo): handle "data" being
+	a GimpNavigationEditor.
+
+	* app/actions/view-actions.c (view_actions): added tooltips for
+	the actions used in the editor.
+
+	(view_actions_update): use action_data_get_display() instead of
+	checking the type of "data" manually.
+
+	* app/widgets/gimpeditor.c (gimp_editor_add_action_button): use
+	a GtkToggleButton instead of GimpButton for GtkToggleActions.
+
+	* app/display/gimpnavigationeditor.[ch]: added a GimpMenuFactory
+	parameter to the public constructor and removed all other
+	parameters. Simplified gimp_navigation_editor_new_private() and
+	use gimp_editor_add_action_button() instead of just add_button()
+	for creating the buttons. Made gimp_navigation_view_set_shell()
+	private. Update the UI manager when the shell zooms or scrolls.
+
+	* app/dialogs/dialogs-constructors.c (dialogs_navigation_view_new):
+	pass the menu_factory to gimp_navigation_editor_new().
+
+	Removed #includes which are not needed any more.
+
+2004-09-26  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/exchange.c: use the same preview as in all other
+	plug-ins.
+
+2004-09-25  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_stock.c: removed C++ style comment.
+
+2004-09-25  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/imagemap/imap_stock.[ch]
+	* plug-ins/imagemap/Makefile.am
+	* plug-ins/imagemap/*.xpm: get rid of all .xpm images
+
+	* configure.in 
+	* plug-ins/imagemap/images/*: and add them as .png here
+
+	* plug-ins/imagemap/imap_browse.c: remove unused include.
+	
+2004-09-25  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpviewrenderer.h: removed trailing whitespace.
+
+2004-09-25  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-close.c: changed mnemonic so that
+	you can close an image w/o saving it by using Ctrl-W Alt-W.
+
+2004-09-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage-qmask.h: added comment about not changing the
+	silly "Qmask" string because it is used to identify the Quick Mask
+	in the XCF.
+
+	* app/core/gimpchannel.c: implement GimpViewable::get_description()
+	and return "Quick Mask" if it's the Quick Mask.
+
+	* app/actions/qmask-actions.c
+	* app/actions/qmask-commands.c
+	* app/core/core-enums.[ch]
+	* app/core/gimpimage-qmask.c
+	* app/display/gimpdisplayshell.c: s/QuickMask/Quick Mask/.
+
+2004-09-25  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/engrave.c: Added a preview and #if'ed out some
+	unreachable code.
+
+2004-09-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimppickable.[ch]: added new vitrual function
+	GimpPickableInterface::get_image()
+
+	* app/core/gimpdrawable.c
+	* app/core/gimpimagemap.c
+	* app/core/gimpprojection.[ch]: implement it.
+
+2004-09-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcolormapeditor.[ch]
+	* app/widgets/gimphistogrameditor.[ch]
+	* app/widgets/gimpselectioneditor.[ch]: removed redundant "gimage"
+	parameters from public constructors. They are all GimpImageEditor
+	widgets which get their image via gimp_docked_set_context() and
+	gimp_image_editor_set_image() later anyway. Fixes uglyness as well
+	as problems where the editors had an image but no context, causing
+	strange behavior in their foo_actions_update() functions.
+
+	* app/dialogs/dialogs-constructors.c: changed accordingly. Removed
+	redundant calls to gimp_dockable_set_context() on newly created
+	dockables because they will get a context when added to their
+	containers.
+
+2004-09-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcolormapeditor.c: moved stuff from
+	gimp_colormap_editor_new() to
+	gimp_colormap_editor_init(). Untabified.
+
+2004-09-25  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/dog.c: made the preview behave like in all other
+	plug-ins by using a GimpDrawablePreview.  This allowed to remove a
+	bunch of complicated code.
+
+2004-09-25  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimptemplateeditor.[ch]: added resolution and image
+	type information which is usually hidden in the Advanced Options.
+
+2004-09-25  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/oilify.c: Added a preview and made some small
+	cleanups.
+
+2004-09-24  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimprc-blurbs.h (LAYER_PREVIEW_SIZE_BLURB): try to
+	improve the tooltip for the layer-preview-size gimprc setting.
+	Addresses bug #153603.
+
+2004-09-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage-undo-push.c (undo_pop_fs_to_layer): factored
+	common code out of the UNDO amd REDO cases. Use gimp_drawable_update()
+	instead of gimp_viewable_invalidate_preview() so the projection
+	gets updated correctly. Fixes bug #149558.
+
+	* app/core/gimplayer-floating-sel.c (floating_sel_to_layer):
+	removed unused variables and their assignments.
+
+2004-09-24  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimptemplateeditor.[ch]: added a label that shows
+	the pixel size (as in the initial mockup done by Jimmac).
+
+2004-09-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpimagemaptool.c
+	(gimp_image_map_tool_settings_dialog): set the folder using
+	gtk_file_chooser_set_current_folder(), not set_filename().
+
+2004-09-24  Sven Neumann  <sven@gimp.org>
+
+	* app/base/curves.[ch]
+	* app/tools/gimpcurvestool.c: defined CURVES_NUM_POINTS and use it.
+
+	* tools/pdbgen/pdb/color.pdb (curves_spline_invoker): unset the
+	last control point which got initialized to (255,255) by
+	curves_init(). Fixes bug #153635.
+
+	* app/pdb/color_cmds.c: regenerated.
+
+2004-09-24  Sven Neumann  <sven@gimp.org>
+
+	* app/plug-in/plug-in-message.c: removed a linebreak from a
+	warning message.
+
+2004-09-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimpairbrushoptions.c
+	* app/paint/gimpcloneoptions.c
+	* app/paint/gimpconvolveoptions.c
+	* app/paint/gimpdodgeburnoptions.c
+	* app/paint/gimperaseroptions.c
+	* app/paint/gimpinkoptions.c
+	* app/paint/gimppaintoptions.c
+	* app/paint/gimppenciloptions.c
+	* app/paint/gimpsmudgeoptions.c
+	* app/tools/gimpblendoptions.c
+	* app/tools/gimpbucketfilloptions.c
+	* app/tools/gimpcoloroptions.c
+	* app/tools/gimpcolorpickeroptions.c
+	* app/tools/gimpcropoptions.c
+	* app/tools/gimpflipoptions.c
+	* app/tools/gimphistogramoptions.c
+	* app/tools/gimpimagemapoptions.c
+	* app/tools/gimpmagnifyoptions.c
+	* app/tools/gimpmeasureoptions.c
+	* app/tools/gimpmoveoptions.c
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimpselectionoptions.c
+	* app/tools/gimptextoptions.c
+	* app/tools/gimptransformoptions.c
+	* app/tools/gimpvectoroptions.c: code cleanup: untabified and
+	trailing whitespace removal, removed empty instance_init()
+	funcions, cleaned up variable declarations/initializations.
+
+2004-09-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register)
+	* app/tools/gimppenciltool.c (gimp_pencil_tool_register):
+	add GIMP_CONTEXT_GRADIENT_MASK to the tools' context_props because
+	these tools use the current gradient. Fixes bug #153584.
+
+2004-09-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/color-dialog.[ch]: removed...
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcolordialog.[ch]: ...and added as widget.
+
+	* app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM.
+
+	* app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState.
+
+	* app/widgets/gimpcolormapeditor.[ch]
+	* app/widgets/gimpcolorpanel.[ch]
+	* app/widgets/gimpgradienteditor.[ch]
+	* app/widgets/gimppaletteeditor.[ch]
+	* app/widgets/gimptoolbox-color-area.c
+	* app/actions/gradient-editor-commands.c
+	* app/actions/view-commands.c: ported to GimpColorDialog. Removes
+	a whole bunch of ugly widgets/ -> dialogs/ dependencies.
+
+2004-09-23  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c: put the text view into
+	a scrolled window. Removed "changed" callbacks for GtkEntry and
+	GtkTextView. Instead retrieve the final string when the dialog is
+	confirmed.
+
+	* plug-ins/script-fu/scripts/carved-logo.scm
+	* plug-ins/script-fu/scripts/chrome-it.scm
+	* plug-ins/script-fu/scripts/crystal-logo.scm
+	* plug-ins/script-fu/scripts/sota-chrome-logo.scm: use
+	gimp-data-directory instead of the deprecated constant
+	gimp-data-dir.
+
+	* plug-ins/script-fu/scripts/mkbrush.scm: unmarked strings for
+	translation that I marked yesterday. Won't work unfortunately.
+
+2004-09-23  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/blended-logo.scm: fixed context
+	push/pop.
+
+2004-09-23  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-enums.h
+	* plug-ins/script-fu/script-fu-interface.c
+	* plug-ins/script-fu/script-fu-scripts.c
+	* plug-ins/script-fu/siod-wrapper.c: applied a patch by Kevin
+	Cozens, based on a patch by Dov Grobgeld. Implements multi-line
+	text input in Script-Fu (bug #124394).
+
+	* plug-ins/script-fu/scripts/test-sphere.scm: test the new SF-TEXT
+	parameter.
+
+2004-09-23  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimppixbuf.c (gimp_drawable_get_thumbnail,
+	gimp_image_get_thumbnail): use the exported symbols from
+	libgimp, not the private _gimp_drawable_thumbnail()
+	and _gimp_image_thumbnail() functions.
+
+	* libgimp/gimp.def: added new symbols, removed
+	_gimp_image_thumbnail and _gimp_drawable_thumbnail.
+
+2004-09-23  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/brushes.pdb
+	* tools/pdbgen/pdb/gradients.pdb
+	* tools/pdbgen/pdb/palettes.pdb
+	* tools/pdbgen/pdb/patterns.pdb: removed the foos_set_foo()
+	procedures and marked the foos_get_foo() ones as deprecated. For
+	brushes, patterns and palettes, added foos_get_foo_info()
+	procedures which work like foos_get_foo_data() but return just the
+	properties, not the actual data. Allow NULL or "" to be passed
+	as name to all functions (use the current brush, pattern etc.
+	in this case).
+
+	* tools/pdbgen/pdb/fonts.pdb: cleanup.
+
+	* app/pdb/procedural_db.c: added the removed ones to the compat
+	hash table.
+
+	* libgimp/Makefile.am
+	* libgimp/gimpbrushes.[ch]
+	* libgimp/gimpgradients.[ch]
+	* libgimp/gimppalettes.[ch]
+	* libgimp/gimppatterns.[ch]: new files with compat functions
+	wich call the resp. gimp_context_*() functions.
+
+	* libgimp/gimp.h: changed accordingly.
+
+	* app/pdb/brushes_cmds.c
+	* app/pdb/gradients_cmds.c
+	* app/pdb/internal_procs.c
+	* app/pdb/palettes_cmds.c
+	* app/pdb/patterns_cmds.c
+	* libgimp/gimpbrushes_pdb.[ch]
+	* libgimp/gimpgradients_pdb.[ch]
+	* libgimp/gimppalettes_pdb.[ch]
+	* libgimp/gimppatterns_pdb.[ch]: regenerated.
+
+	* plug-ins/FractalExplorer/Dialogs.c
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-style.[ch]
+	* plug-ins/gflare/gflare.c: changed accordingly.
+
+2004-09-23  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/bumpmap.c (bumpmap_dialog): added a GtkPaned for
+	packing preview and controls so the controls are resizable again.
+
+2004-09-23  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/scripts/3d-outline.scm
+	* plug-ins/script-fu/scripts/beveled-pattern-arrow.scm
+	* plug-ins/script-fu/scripts/beveled-pattern-bullet.scm
+	* plug-ins/script-fu/scripts/beveled-pattern-button.scm
+	* plug-ins/script-fu/scripts/beveled-pattern-heading.scm
+	* plug-ins/script-fu/scripts/beveled-pattern-hrule.scm
+	* plug-ins/script-fu/scripts/blended-logo.scm
+	* plug-ins/script-fu/scripts/carve-it.scm
+	* plug-ins/script-fu/scripts/carved-logo.scm
+	* plug-ins/script-fu/scripts/chip-away.scm
+	* plug-ins/script-fu/scripts/chrome-it.scm
+	* plug-ins/script-fu/scripts/coffee.scm
+	* plug-ins/script-fu/scripts/comic-logo.scm
+	* plug-ins/script-fu/scripts/coolmetal-logo.scm
+	* plug-ins/script-fu/scripts/crystal-logo.scm
+	* plug-ins/script-fu/scripts/frosty-logo.scm
+	* plug-ins/script-fu/scripts/glossy.scm
+	* plug-ins/script-fu/scripts/hsv-graph.scm
+	* plug-ins/script-fu/scripts/land.scm
+	* plug-ins/script-fu/scripts/lava.scm
+	* plug-ins/script-fu/scripts/mkbrush.scm
+	* plug-ins/script-fu/scripts/rendermap.scm
+	* plug-ins/script-fu/scripts/select-to-brush.scm
+	* plug-ins/script-fu/scripts/select-to-pattern.scm
+	* plug-ins/script-fu/scripts/sota-chrome-logo.scm
+	* plug-ins/script-fu/scripts/spyrogimp.scm
+	* plug-ins/script-fu/scripts/starburst-logo.scm
+	* plug-ins/script-fu/scripts/starscape-logo.scm
+	* plug-ins/script-fu/scripts/t-o-p-logo.scm
+	* plug-ins/script-fu/scripts/test-sphere.scm
+	* plug-ins/script-fu/scripts/textured-logo.scm: use the new
+	opacity, paint_mode, brush, pattern, gradient, palette and font
+	accessors.
+
+2004-09-23  Sven Neumann  <sven@gimp.org>
+
+	Converted the last bunch of scripts to the new context API:
+
+	* plug-ins/script-fu/scripts/[s-z]*.scm
+
+2004-09-23  Sven Neumann  <sven@gimp.org>
+
+	Converted more scripts to the new context API:
+
+	* plug-ins/script-fu/scripts/glossy.scm
+	* plug-ins/script-fu/scripts/hsv-graph.scm
+	* plug-ins/script-fu/scripts/image-structure.scm
+	* plug-ins/script-fu/scripts/perspective-shadow.scm
+	* plug-ins/script-fu/scripts/pupi-button.scm
+	* plug-ins/script-fu/scripts/rendermap.scm
+	* plug-ins/script-fu/scripts/ripply-anim.scm
+
+2004-09-23  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/hsv-graph.scm: 
+
+	* tools/pdbgen/pdb/context.pdb: oops, should probably pop, not
+	push a context in gimp_context_pop().
+
+	* app/pdb/context_cmds.c: regenerated.
+
+	* plug-ins/script-fu/scripts/mkbrush.scm: don't fiddle with the
+	brush description, simply use the name choosen by the user.
+
+2004-09-23  Sven Neumann  <sven@gimp.org>
+
+	Converted the next bunch of scripts to the new context API:
+
+	* plug-ins/script-fu/scripts/[d-n]*.scm: push and pop a context.
+	Removed code that used to restore the context values changed by
+	the scripts.
+
+2004-09-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-message.c (plug_in_handle_proc_return_priv):
+	removed warning about entering a dead code path. That path is not
+	dead at all :)
+
+2004-09-23  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/context.pdb: added accessors for the context's
+	brush, pattern, gradient, palette and brush. Deprecation of old
+	functions will follow. Fixes gimp-context-set-background wrapper.
+	Cleanup.
+
+	* tools/pdbgen/pdb/patterns.pdb
+	* libgimp/gimpbrushes.h: minor fixes.
+
+	* app/pdb/context_cmds.c
+	* app/pdb/internal_procs.c
+	* app/pdb/patterns_cmds.c
+	* libgimp/gimpcontext_pdb.[ch]: regenerated.
+
+2004-09-23  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/bumpmap.c (bumpmap_dialog): cosmetics.
+
+2004-09-22  Kevin Turner  <acapnotic@twistedmatrix.com>
+
+	* plug-ins/pygimp/gimpfu.py (register): clean up errors in
+	parameter checking.
+
+2004-09-22  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/brushes.pdb: removed the opacity and paint_mode
+	functions...
+
+	* tools/pdbgen/pdb/context.pdb: ...and added them here.
+
+	* app/pdb/procedural_db.c: added them to the pdb_compat hash table.
+
+	* libgimp/Makefile.am
+	* libgimp/gimpbrushes.[ch]: new files with compat functions
+	which call the gimp_context_*() functions.
+
+	* libgimp/gimp.h: changed accordingly.
+
+	* app/pdb/brushes_cmds.c
+	* app/pdb/context_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpbrushes_pdb.[ch]
+	* libgimp/gimpcontext_pdb.[ch]: regenerated.
+
+2004-09-22  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/Makefile.am
+	* tools/pdbgen/groups.pl
+	* tools/pdbgen/pdb/palette.pdb: removed the "Palette" pdb group...
+
+	* tools/pdbgen/pdb/context.pdb: and added its functions to the
+	"Context" namespace instead.
+
+	* app/pdb/Makefile.am
+	* app/pdb/palette_cmds.c: removed.
+
+	* app/pdb/procedural_db.c: added them to the pdb_compat hash table.
+
+	* libgimp/Makefile.am
+	* libgimp/gimppalette_pdb.[ch]: removed.
+
+	* libgimp/gimppalette.[ch]: new files holding compat functions
+	which call gimp_context_*() functions.
+
+	* libgimp/gimp.h
+	* libgimp/gimpui.c: changed accordingly.
+
+	* app/pdb/context_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimp_pdb.h
+	* libgimp/gimpcontext_pdb.[ch]: regenerated.
+
+	* plug-ins/MapObject/mapobject_image.c
+	* plug-ins/MapObject/mapobject_preview.c
+	* plug-ins/common/apply_lens.c
+	* plug-ins/common/blinds.c
+	* plug-ins/common/borderaverage.c
+	* plug-ins/common/checkerboard.c
+	* plug-ins/common/colortoalpha.c
+	* plug-ins/common/cubism.c
+	* plug-ins/common/exchange.c
+	* plug-ins/common/film.c
+	* plug-ins/common/gif.c
+	* plug-ins/common/grid.c
+	* plug-ins/common/mapcolor.c
+	* plug-ins/common/mblur.c
+	* plug-ins/common/mng.c
+	* plug-ins/common/mosaic.c
+	* plug-ins/common/papertile.c
+	* plug-ins/common/png.c
+	* plug-ins/common/polar.c
+	* plug-ins/common/semiflatten.c
+	* plug-ins/common/sinus.c
+	* plug-ins/common/sparkle.c
+	* plug-ins/common/vpropagate.c
+	* plug-ins/common/warp.c
+	* plug-ins/common/whirlpinch.c
+	* plug-ins/gfig/gfig-style.c
+	* plug-ins/gfli/gfli.c
+	* plug-ins/ifscompose/ifscompose.c
+	* plug-ins/maze/handy.c
+	* plug-ins/pagecurl/pagecurl.c
+	* plug-ins/pygimp/gimpmodule.c
+	* plug-ins/script-fu/scripts/*.scm: changed accordingly.
+
+2004-09-22  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/view-actions.c (view_zoom_actions): mark menu label
+	as translatable (bug #153456).
+
+2004-09-22  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/siod-wrapper.c
+	* plug-ins/script-fu/scripts/mkbrush.scm
+	* plug-ins/script-fu/scripts/select-to-brush.scm
+	* plug-ins/script-fu/scripts/select-to-pattern.scm: applied a
+	patch from Kevin Cozens that adds constants for the directory
+	names exposed by libgimpbase. Fixes bug #153327.
+
+2004-09-22  Sven Neumann  <sven@gimp.org>
+
+	Converted the first bunch of Script-Fu to the new context API:
+
+	* plug-ins/script-fu/scripts/[3a-c]*.scm: push and pop a context.
+	Removed code that used to restore the context values changed by
+	the scripts.
+
+2004-09-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-proc-frame.[ch] (plug_in_proc_frame_init):
+	removed assertion about proc_rec != NULL because that happens
+	when query()ing and init()int plug-ins.
+
+	Replaced "context" by "main_context" plus "context_stack".
+
+	* app/plug-in/plug-in-context.c: implement plug_in_context_push()
+	and plug_in_context_pop().
+
+	* app/plug-in/plug-in-message.c
+	* app/plug-in/plug-in-progress.c: changed accordingly.
+
+	* tools/pdbgen/pdb/context.pdb: use the return values of
+	plug_in_context_push() and _pop().
+
+	* app/pdb/context_cmds.c: regenerated.
+
+	* plug-ins/script-fu/scripts/test-sphere.scm: use
+	gimp-context-push and gimp-context-pop instead of remembering the
+	old values for FG, BG etc.
+
+2004-09-22  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/Makefile.am
+	* tools/pdbgen/pdb/context.pdb: new files that will hold context
+	related PDB functions.
+
+	* tools/pdbgen/groups.pl
+	* app/pdb/Makefile.am
+	* app/pdb/context_cmds.c
+	* app/pdb/internal_procs.c
+	* app/pdb/progress_cmds.c
+	* libgimp/gimp_pdb.h
+	* libgimp/gimpcontext_pdb.[ch]: (re)generated.
+
+	* app/plug-in/Makefile.am
+	* app/plug-in/plug-in-context.[ch]: new files that will hold code
+	that implements a context stack in the plug-in's proc-frame.
+
+	* app/plug-in/plug-in.[ch]: new function plug_in_get_proc_frame().
+
+	* app/plug-in/plug-in-message.c
+	* app/plug-in/plug-in-progress.c: use the new function instead of
+	duplicating it all over the place.
+
+2004-09-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/Makefile.am
+	* app/plug-in/plug-in-proc.[ch]: removed...
+	* app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name.
+
+	* app/plug-in/plug-in-def.[ch]
+	* app/plug-in/plug-in-message.[ch]
+	* app/plug-in/plug-in-progress.[ch]
+	* app/plug-in/plug-in-rc.[ch]
+	* app/plug-in/plug-in-run.[ch]
+	* app/plug-in/plug-in.[ch]
+	* app/plug-in/plug-ins.[ch]
+	* app/actions/plug-in-actions.c
+	* app/actions/plug-in-commands.c
+	* app/file/file-open.[ch]
+	* app/file/file-save.[ch]
+	* app/file/file-utils.[ch]
+	* app/gui/gui-vtable.c
+	* app/menus/plug-in-menus.c
+	* app/widgets/gimpfiledialog.c
+	* app/widgets/gimpfileprocview.c
+	* app/widgets/gimppluginaction.c
+	* app/xcf/xcf.c
+	* tools/pdbgen/pdb/fileops.pdb
+	* tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some
+	minor cosmetic cleanups.
+
+	* app/pdb/fileops_cmds.c
+	* app/pdb/plug_in_cmds.c: regenerated.
+
+2004-09-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimplayertreeview.c
+	(gimp_layer_tree_view_floating_selection_changed): removed the
+	hack that was displaying "Floating Selection" instead of the
+	floating layer's real name.
+
+	* app/core/gimplayer.c: implement GimpViewable::get_description()
+	instead and special case floating selections with a two-line
+	text that contains "Floating Selection".
+
+	* app/core/gimplayer-floating-sel.c
+	* app/core/gimpimage-undo-push.c: emit "name_changed" on the layer
+	when it changes its state from floating to normal or vice versa
+	so the views can update accordingly.
+
+	* app/core/gimpselection.c: s/"Selection"/"Floated Layer"/.
+
+	* app/tools/gimpeditselectiontool.c:
+	s/"Floating Layer"/"Floating Selection"/.
+
+2004-09-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/Makefile.am
+	* app/plug-in/plug-in-proc-frame.[ch]: new files containing
+	utility functions for initializing/freeing PlugInProcFrames.
+	Added the progress stuff to the proc_frame.
+
+	* app/plug-in/plug-in.[ch]: removed the progress stuff from the
+	PlugIn struct and use the new proc_frame utility functions.
+
+	* app/plug-in/plug-in-message.c
+	* app/plug-in/plug-in-progress.c
+	* app/plug-in/plug-in-run.c: changed accordingly.
+
+2004-09-22  Michael Natterer  <mitch@gimp.org>
+
+	Prepare for enabling private contexts for plug-ins and scripts:
+
+	* app/plug-in/plug-in.[ch]: removed the "context" member from
+	the PlugIn struct and added it to PlugInProcFrame instead.
+
+	* app/plug-in/plug-in-message.c
+	* app/plug-in/plug-in-progress.c
+	* app/plug-in/plug-in-run.c: changed accordingly.
+
+2004-09-22  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/bumpmap.c: moved the preview to the left.
+
+2004-09-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-types.h
+	* app/plug-in/plug-in.[ch]: added struct PlugInProcFrame which
+	contains the ProcRecord, the proc's GMainLoop and its return
+	values.
+
+	Use the same struct for the plug-in's main proc and its
+	temp_procs, so we finally have one set of return values per call
+	frame, and not just one per plug-in.
+
+	Added plug_in_proc_frame_push()/pop() and changed
+	plug_in_main_loop[_quit]() accordingly.
+
+	* app/plug-in/plug-in-message.c
+	* app/plug-in/plug-in-progress.c
+	* app/plug-in/plug-in-run.c: changed accordingly.
+
+2004-09-22  Sven Neumann  <sven@gimp.org>
+
+	* app/text/gimptextlayout.c (gimp_text_get_pango_context):
+	workaround Pango bug #143542 (PangoFT2Fontmap leak, see also bug
+	#148997). Based on a patch by Robert Ögren.
+
+2004-09-22  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpviewabledialog.c: removed the prelit event box
+	from the header frame, use a smaller font for the subtitle,
+	removed the separator.
+
+	* app/dialogs/preferences-dialog.c: removed the prelit event box
+	from the header frame. Perhaps we should have subtitles here with
+	a more verbose description of the settings page?
+
+2004-09-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/file-actions.c (file_actions): resolved conflicting
+	mnemonics.
+
+2004-09-21  Sven Neumann  <sven@gimp.org>
+
+	* data/images/Makefile.am (imagedata_DATA): renamed gimp_splash.png
+	to gimp-splash.png.
+
+	* data/images/gimp-splash.png: new splash, courtesy of Dave Neary.
+
+	* app/gui/splash.c: look for gimp-splash.png in the users
+	directory, then in the systemwide images directory.
+
+2004-09-21  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-server.c: got rid of two the global
+	file descriptor sets. Use the client hash-table instead.
+
+2004-09-21  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-server.c: enabled build of the
+	Script-Fu server for the Win32 platform using the winsock API.
+
+	* plug-ins/script-fu/Makefile.am: link with -lwsock32 on Win32.
+
+	* plug-ins/script-fu/script-fu-console.c
+	* plug-ins/script-fu/script-fu.c
+	* plug-ins/script-fu/siod-wrapper.c: removed Win32 specific code
+	that isn't needed any longer.
+
+2004-09-21  Michael Natterer  <mitch@gimp.org>
+
+	For the sake of completeness, added a GUI for the hidden
+	"Open as Layer" feature:
+
+	* app/actions/file-actions.c
+	* app/actions/file-commands.[ch]: added "file-open-as-layer"
+	action and callback. Abuse the "gimage" field of GimpFileDialog to
+	indicate layer opening (it's otherwise unused for file-open).
+
+	* app/dialogs/file-open-dialog.c: if dialog->gimage is non-NULL,
+	open the selected files as layers for that image.
+
+	* app/widgets/gimphelp-ids.h: added GIMP_HELP_FILE_OPEN_AS_LAYER.
+
+	* menus/image-menu.xml.in: added it to the menu.
+
+2004-09-21  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/jpeg.c (save_dialog): let the dialog collapse
+	with the expander by making it not resizable.
+
+2004-09-21  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-close.c
+	(gimp_display_shell_close_dialog): resolved a mnemonics collision.
+
+2004-09-21  Dave Neary  <bolsh@gimp.org>
+
+	* plug-ins/common/psd.c: Correctly set overlay, hard light and
+	soft light modes from .psd files. Fixes bug #153229.
+
+2004-09-21  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/svg.c (SVG_DEFAULT_RESOLUTION): set to 90dpi as
+	a workaround for bug #143300.
+
+2004-09-20  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/imagemap/imap_cmd_guides.c
+	* plug-ins/imagemap/imap_default_dialog.c
+	* plug-ins/imagemap/imap_menu.c
+	* plug-ins/imagemap/imap_preferences.c
+	* plug-ins/imagemap/imap_tools.c: disabled functionality that doesn't
+	fully work yet. Bug #136713 now becomes an enhancement request.
+
+2004-09-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/bumpmap.c: added tooltips, enabled "Compensate
+	for darkening" by default, some minor cleanups.
+
+2004-09-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/dialogs-constructors.c: removed useless #includes.
+
+2004-09-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/buffers-commands.c
+	* app/actions/file-commands.c
+	* app/actions/layers-commands.c
+	* app/actions/plug-in-actions.c
+	* app/actions/tools-actions.c: removed useless #includes, cleanup.
+
+2004-09-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/dialogs.[ch] (dialogs_init): added GimpMenuFactory
+	parameter and removed inclusion on "menus/menus.h".
+
+	* app/menus/menus.[ch] (menus_init): added GimpActionFactory
+	parameter and removed inclusion of "actions/actions.h".
+
+	* app/gui/gui.c (gui_restore_callback): pass the factories to the
+	above functions.
+
+2004-09-20  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: bumped version number to 2.1.6.
+
+2004-09-20  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/deinterlace.c: added a preview. Not sure if it is
+	really useful...
+
+2004-09-20  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/shift.c: added a preview.
+
+2004-09-20  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcolorselect.c (gimp_color_select_xy_events):
+	removed "case GDK_CONFIGURE" because it's not needed and did
+	"break" instead of "return FALSE", causing random color changes
+	when resizing and initially showing the widget.
+
+2004-09-20  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.1.5 release.
+
+2004-09-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/Makefile.am (gimp_2_1_LDFLAGS): removed all -u hacks.
+
+	(gimp_2_1_LDADD)
+	(gimp_console_2_1_LDADD): reordered .a files correctly. The core
+	seems to be cleaned up enough to have proper dependencies now.
+
+2004-09-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/channels-commands.c
+	* app/actions/vectors-commands.c: removed massive code duplication
+	by factoring out the code that creates the "New Channel/Path" and
+	"Edit Channel/Path Attributes" dialogs out to utility functions.
+	GUI spacing and Code cleanup.
+
+	* app/actions/layers-commands.c: minor GUI spacing and code
+	cleanup.
+
+2004-09-19  Sven Neumann  <sven@gimp.org>
+
+	* app/base/tile-manager.c (tile_manager_get_memsize): count valid
+	tiles, not dirty ones.
+
+2004-09-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/bumpmap.c: some tweaks to the dialog layout.
+
+2004-09-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/qmask-commands.c (qmask_invert_cmd_callback): is a
+	GtkRadioAction callback but behaved like a GtkToggleAction
+	callback. Fixes bug #152948.
+
+2004-09-19  DindinX  <dindinx@gimp.org>
+
+	* plug-ins/common/bumpmap.c: use a GimpDrawablePreview instead of a
+	very complicated homemade preview.  Many small changes in the code
+	too, and some cleanups. I hope I didn't break anything.
+
+2004-09-19  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimppaintoptions-gui.c: clean up ugliness introduced
+	by my previous commit -- no functional change.
+
+2004-09-19  Sven Neumann  <sven@gimp.org>
+
+	Improved undo memory calculation for paint operations (bug #153035):
+
+	* app/base/tile-manager.[ch] (tile_manager_get_memsize): added a
+	"gboolean sparse" parameter to get more accurate results for
+	sparse tile-managers.
+
+	* app/core/gimpbuffer.c
+	* app/core/gimpdrawable.c
+	* app/core/gimpimage-undo-push.c
+	* app/core/gimpimage.c
+	* app/core/gimplayer.c
+	* app/core/gimpprojection.c: changed accordingly.
+
+2004-09-19  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/Makefile.am (libappdialogs_a_SOURCES): added authors.h.
+
+2004-09-19  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimppaintoptions-gui.c: rearrange tool options as
+	described in bug #153014.
+
+2004-09-19  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimperrordialog.c (gimp_error_dialog_add): fixed
+	handling of too many error messages.
+
+2004-09-19  Sven Neumann  <sven@gimp.org>
+
+	Try to make floating selections more obvious:
+
+	* app/widgets/gimplayertreeview.c
+	(gimp_layer_tree_view_floating_selection_changed): always display
+	"Floating Selection" as the name for a floating selection.
+
+	* app/core/gimpselection.c (gimp_selection_float): call the new
+	layer "Selection" instead of "Floating Selection". This is what
+	will be displayed if the FS is turned into a layer.
+
+	* app/actions/layers-commands.c (layers_edit_layer_query): don't
+	special case floating selections here.
+
+	* app/core/gimplayer-floating-sel.c: cosmetics.
+
+2004-09-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/postscript.c (ps_open): applied a patch by Peter
+	Kirchgessner that solves a problem with the recognition of the
+	bounding box. Fixes bug #152829.
+
+2004-09-19  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/gimprgb-parse.c (gimp_rgb_parse_hex): fixed gtk-doc
+	comment.
+
+2004-09-18  Simon Budig  <simon@gimp.org>
+
+	* libgimpwidgets/gimpcolorhexentry.c: Removed check for len % 3 == 0,
+	so that the entry accepts hex colors starting with "#" again.
+	Untabbified.
+
+2004-09-18  Manish Singh  <yosh@gimp.org>
+
+	* app/Makefile.am: remove LDFLAGS references to now private
+	file_open_dialog_show, file_open_location_dialog_show, and
+	file_save_dialog_show.
+
+2004-09-18  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/qmask-commands.c
+	* libgimpcolor/gimprgb.c (gimp_rgba_distance): just some cleanup.
+
+	* app/core/gimpimage-qmask.c (gimp_image_set_qmask_color): always
+	set gimage->qmask_color regardless of the qmask state.
+
+	* libgimpwidgets/gimpcolorbutton.c (gimp_color_button_new): set
+	the type before setting the color.
+
+2004-09-17  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcomponenteditor.c
+	(gimp_component_editor_renderer_update): use
+	gimp_component_editor_get_iter() instead of duplicating its code.
+
+2004-09-17  Simon Budig  <simon@gimp.org>
+
+	* app/widgets/gimpbrusheditor.[ch]: Added a slider for the
+	brush spacing to the brush editor. Should make it more obvious
+	how to change it.
+
+2004-09-17  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimp-edit.c (gimp_edit_paste): based on a patch from
+	Joao S. O. Bueno: Ensure that the pasted layer is always within
+	the image, if it fits and aligned at top left if it doesn't.
+	Fixes bug #142944.
+
+2004-09-16  Sven Neumann  <sven@gimp.org>
+
+	* INSTALL: updated.
+
+2004-09-16  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_set_logarithmic):
+	applied a patch by Joao S. O. Bueno that fixes bug #152820.
+
+2004-09-16  Dave Neary  <bolsh@gimp.org>
+
+	* plug-ins/script-fu/scripts/burn-in-anim.scm: patch from Kevin
+	Cozens which reinstates corona. Fixes bug #142282.
+
+2004-09-16  Michael Natterer  <mitch@gimp.org>
+
+	* configure.in: depend on GLib >= 2.4.5 and GTK+ >= 2.4.4.
+
+	* app/gui/gui.c: changed accordingly.
+
+	* app/sanity.c: ditto. Added check for GLib and put each check
+	into its own utility function. Enabled #if 0'ed check for
+	FreeType >= 6.2.7.
+
+	* app/widgets/gimpactiongroup.c
+	* app/widgets/gimpcursor.c
+	* app/widgets/gimpselectiondata.c
+	* app/widgets/gimpuimanager.c
+	* app/widgets/gimpwidgets-utils.c: removed workarounds for library
+	versions we refuse to start with.
+
+2004-09-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdnd.c (gimp_dnd_uri_list_dest_add): reverse
+	order of DND dests so "text/uri-list" is preferred again after my
+	DND change of 2004-06-29. Fixes dropping of multiple files.
+
+2004-09-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcomponenteditor.[ch]: set the viewable
+	renderer's "renderer" property to NULL when clearing the
+	view to work around bug #149906.
+
+2004-09-16  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpscanconvert.c (VALUE_TO_PIXEL): replaced a bitshift
+	with a binary and. Should be unnoticeably faster ;)
+
+2004-09-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/pdb/procedural_db.c: removed #if 0'ed code, took assignments
+	out of if()-conditions, minor cleanup.
+
+2004-09-16  Simon Budig  <simon@gimp.org>
+
+	* app/core/gimpscanconvert.c: Implemented an own rendering
+	callback for libart and use it instead of art_gray_svp_aa().
+	This now handles non-antialiased scan conversions itself. It
+	also basically shows the way to implement a LUT for the
+	scan conversion.
+
+2004-09-16  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/quit-dialog.c: removed code that isn't needed any
+	longer now that the dialog is a singleton.
+
+2004-09-15  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/mblur.c: fix the preview for the zoom blur mode.
+
+2004-09-15  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.c
+	(gimp_preview_area_[draw|blend|mask]): fixed code that handles
+	drawing outside of the preview area.
+
+	* plug-ins/common/unsharp.c (preview_update): draw the preview
+	directly from the pixel region.
+
+2004-09-15  Manish Singh  <yosh@gimp.org>
+
+	* modules/controller_linux_input.c: use guint16 instead of __u16.
+	Should fix bug #152746.
+
+2004-09-15  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablepreview.[ch]
+	* libgimp/gimpui.def: renamed gimp_drawable_preview_draw() to
+	gimp_drawable_preview_draw_buffer() and added a rowstride
+	parameter. Added new functions gimp_drawable_preview_get_drawable()
+	and gimp_drawable_preview_draw_region().
+
+	* plug-ins/common/mblur.c: added a preview that uses the
+	shadow tiles as the preview buffer and draws using the new
+	gimp_drawable_preview_draw_region() API.
+
+	* plug-ins/common/photocopy.c
+	* plug-ins/common/softglow.c: use gimp_drawable_preview_draw_region().
+
+	* plug-ins/common/cartoon.c
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/edge.c
+	* plug-ins/common/gauss.c
+	* plug-ins/common/grid.c
+	* plug-ins/common/neon.c
+	* plug-ins/common/noisify.c
+	* plug-ins/common/sel_gauss.c
+	* plug-ins/common/sharpen.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/struc.c
+	* plug-ins/common/unsharp.c
+	* plug-ins/common/wind.c: use gimp_drawable_preview_draw_buffer().
+
+2004-09-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimphelp-ids.h: added help IDs for the drawable- and
+	vectors-visible and -liked actions as well as for the layer mask
+	property action.
+
+	* app/actions/drawable-actions.c
+	* app/actions/vectors-actions.c: use them.
+
+	* app/actions/layers-actions.c
+	* app/actions/layers-commands.[ch]: ditto. Use
+	GIMP_STOCK_TRANSPARENCY for all layer opacity actions. Replaced
+	"paint_mode" by "mode" in all action and function/variable names
+	because this is the layer mode, not a paint mode.
+
+	* app/actions/channels-commands.c
+	* app/actions/layers-commands.c
+	* app/actions/vectors-commands.c: set the "activates-default"
+	property on the name entry in all "New Foo" and "Edit Foo
+	Attributes" dialogs except in the "New Layer" dialog.
+	Addresses bug #148026.
+
+	* menus/image-menu.xml.in: added a (commented out) layer
+	properties menu containing all the new actions.
+
+2004-09-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/layers-actions.c
+	* app/actions/layers-commands.[ch]: added actions and callbacks
+	"layers-preserve-transparency" and
+	"layers-paint-mode-first,last,previous,next". Update the "active"
+	state of the recently added layer mask property actions in
+	layers_actions_update().
+
+	* app/actions/drawable-actions.c
+	* app/actions/drawable-commands.[ch]: added actions and callbacks
+	for "drawable-visible" and "drawable-linked". Fixes bug #152597.
+
+	* app/actions/vectors-actions.c
+	* app/actions/vectors-commands.[ch]: same here ("vectors-visible"
+	and "vectors-linked").
+
+	* app/widgets/gimplayertreeview.c
+	(gimp_layer_tree_view_preserve_button_toggled): flush the image
+	so the new actions are updated. Compress preserve_trans undos.
+
+	* menus/image-menu.xml.in: added the layer mask property actions
+	to the Layers/Mask submenu.
+
+	* menus/layers-menu.xml: reordered the mask property actions
+	to have the same order as in the image menu.
+
+2004-09-15  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcontainertreeview.c
+	(gimp_container_tree_view_menu_position): improved the fix for bug
+	#152662 and removed trailing whitespace.
+
+2004-09-15  Nathan Summers  <rock@gimp.org>
+
+	* app/widgets/gimpcontainertreeview.c
+	(gimp_container_tree_view_menu_position): clamp the popup menu's Y
+	position to the visible area of the GtkTreeView.  Fixes #152662.
+
+2004-09-14  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpquerybox.c: set the "activates-default"
+	property on the entries in all query boxes so hitting "return"
+	confirms them. Addresses bug #148026.
+
+2004-09-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpbufferview.c: simplified the code which deals
+	with the global_buffer's preview. The new buffer view renderer
+	does the aspect ratio magic all by itself now.
+
+	* app/actions/image-commands.h: removed trailing whitespace.
+
+2004-09-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer
+	which knows how to preserve a GimpBuffer's aspect ratio if the
+	view's aspect ratio is different.
+
+	* app/widgets/gimpviewrenderer-utils.c
+	(gimp_view_renderer_type_from_viewable_type): use it for viewables
+	of type GimpBuffer. Fixes bug #152531
+
+2004-09-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/flarefx.c
+	* plug-ins/common/nova.c: embed the preview into a sunken frame
+	and put it into the upper left corner of the dialog.
+
+2004-09-14  Sven Neumann  <sven@gimp.org>
+
+	* app/dialogs/dialogs-constructors.[ch]
+	* app/dialogs/dialogs.c
+	* app/gui/gui.c: let the dialog factory handle the quit dialog
+	as singleton. Fixes bug #151914.
+
+	* app/dialogs/quit-dialog.c: added a warning here. We need a
+	container of dirty images for the above change to work correctly.
+
+2004-09-13  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/jpeg.c (save_dialog): make the "Save EXIF data"
+	toggle insensitive when no EXIF data is present (bug #140042).
+
+	* app/display/gimpdisplayshell-close.c: as suggested by the HIG,
+	ask the user to save the image when the last display is being
+	closed. Addresses some issues raised in bug #106726.
+
+2004-09-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/app_procs.c (app_run): install the message handler for the
+	"Gimp-Dialogs" domain.
+
+2004-09-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/file-commands.c: resurrected file_open_dialog_show()
+	and file_save_dialog_show() as private utility functions to get
+	rid of code duplication.
+
+2004-09-13  Michael Natterer  <mitch@gimp.org>
+
+	Manage the file-save dialog using the dialog factory and stop
+	making menu items insensitive while it is open. Fixes bug #81407.
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/file-dialog-utils.[ch]: removed these files.
+
+	* app/dialogs/file-save-dialog.[ch]: removed functions
+	file_save_dialog_show() and file_save_a_copy_dialog_show() and
+	changed internal function file_save_dialog_create() to
+	file_save_dialog_new().
+
+	* app/dialogs/dialogs.c
+	* app/dialogs/dialogs-constructors.[ch]: made it completely
+	managed by the dialog factory.
+
+	* app/actions/file-commands.c: create it using the dialog
+	factory. Attach it to the image so we open only one save
+	dialog per image.
+
+	* app/dialogs/file-open-dialog.c: added precondition checks
+	to file_open_dialog_new().
+
+2004-09-13  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/jpeg.c: some code cleanup.
+
+2004-09-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/dialogs/file-open-dialog.[ch]: removed function
+	file_open_dialog_show() and changed internal function
+	file_open_dialog_create() to file_open_dialog_new().
+
+	* app/dialogs/dialogs.c
+	* app/dialogs/dialogs-constructors.[ch]: made it completely
+	managed by the dialog factory.
+
+	* app/actions/file-commands.c: create it using the dialog factory.
+
+2004-09-13  Michael Natterer  <mitch@gimp.org>
+
+	* configure.in
+	* app/Makefile.am: added new directory app/dialogs and link
+	libappdialogs.c into the gimp binary.
+
+	* app/gui/Makefile.am
+	* app/gui/gui-types.h
+	* app/gui/gui-vtable.c
+	* app/gui/gui.c
+
+	* app/gui/about-dialog.[ch]
+	* app/gui/authors.h
+	* app/gui/color-notebook.[ch]
+	* app/gui/convert-dialog.[ch]
+	* app/gui/dialogs-constructors.[ch]
+	* app/gui/dialogs.[ch]
+	* app/gui/file-dialog-utils.[ch]
+	* app/gui/file-new-dialog.[ch]
+	* app/gui/file-open-dialog.[ch]
+	* app/gui/file-open-location-dialog.[ch]
+	* app/gui/file-save-dialog.[ch]
+	* app/gui/grid-dialog.[ch]
+	* app/gui/info-dialog.[ch]
+	* app/gui/info-window.[ch]
+	* app/gui/module-browser.[ch]
+	* app/gui/offset-dialog.[ch]
+	* app/gui/palette-import-dialog.[ch]
+	* app/gui/preferences-dialog.[ch]
+	* app/gui/quit-dialog.[ch]
+	* app/gui/resize-dialog.[ch]
+	* app/gui/resolution-calibrate-dialog.[ch]
+	* app/gui/stroke-dialog.[ch]
+	* app/gui/tips-dialog.[ch]
+	* app/gui/tips-parser.[ch]
+	* app/gui/user-install-dialog.[ch]: removed these files...
+
+	* app/dialogs/Makefile.am
+	* app/dialogs/dialogs-types.h
+
+	* app/dialogs/*.[ch]: ...and added them here. Changed some
+	filenames like module-browser -> module-dialog.
+
+	* app/app_procs.c
+	* app/actions/actions-types.h
+	* app/actions/actions.c
+	* app/actions/dialogs-actions.c
+	* app/actions/dialogs-commands.c
+	* app/actions/dockable-commands.c
+	* app/actions/drawable-commands.c
+	* app/actions/edit-commands.c
+	* app/actions/file-commands.c
+	* app/actions/gradient-editor-commands.c
+	* app/actions/image-commands.c
+	* app/actions/layers-commands.c
+	* app/actions/palettes-commands.c
+	* app/actions/select-commands.c
+	* app/actions/templates-commands.c
+	* app/actions/templates-commands.h
+	* app/actions/vectors-commands.c
+	* app/actions/view-commands.c
+	* app/display/gimpdisplayshell-cursor.c
+	* app/display/gimpdisplayshell-title.c
+	* app/display/gimpdisplayshell.[ch]
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpperspectivetool.c
+	* app/tools/gimprotatetool.c
+	* app/tools/gimpscaletool.c
+	* app/tools/gimpsheartool.c
+	* app/tools/gimptransformtool.[ch]
+	* app/tools/gimpvectortool.c
+	* app/widgets/gimpcolormapeditor.[ch]
+	* app/widgets/gimpcolorpanel.c
+	* app/widgets/gimpgradienteditor.[ch]
+	* app/widgets/gimppaletteeditor.[ch]
+	* app/widgets/gimptoolbox-color-area.c
+	* menus/toolbox-menu.xml.in
+	* tools/authorsgen/authorsgen.pl: changed accordingly.
+
+2004-09-13  Michael Natterer  <mitch@gimp.org>
+
+	Restore binary compatibility of the wire protocol that was
+	broken by the recent GPConfig changes:
+
+	* libgimpbase/gimpprotocol.[ch] (struct _GPConfig)
+	(_gp_config_read)
+	(_gp_config_write): argh, we can't use the two bytes padding
+	because that's just a binary compatible struct change, but inserts
+	two bytes into the byte stream that goes over the wire. Use the
+	first two bytes of the former "gdouble gamma" instead.
+
+	* app/plug-in/plug-in-run.c (plug_in_run)
+	* libgimp/gimp.c (gimp_config): changed accordingly.
+
+2004-09-13  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphelp.c: simulate the behaviour of GNU gettext and
+	look at the LANGUAGE environment variable if the locale is not "C".
+
+2004-09-13  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimpcroptool.c: Fix trailing whitespace introduced by me.
+	/me hides embarrassed in a corner...   :)
+
+2004-09-13  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimpcroptool.c: Fix warnings and coding style.
+
+2004-09-12  Nathan Summers  <rock@gimp.org>
+
+	* app/tools/gimpcroptool.c: disable crop and resize buttons while the
+	operation is being processed.  Fixes #152372.
+
+2004-09-12  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/aa.c (aa_dialog): use a combo box for format
+	selection.
+
+2004-09-12  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimppixelrgn.c: fixed gtk-doc comments, removed trailing
+	whitespace.
+
+2004-09-12  DindinX  <david@dindinx.org>
+
+	* libgimp/gimppixelrgn.c: some more fixes by nomis.
+
+2004-09-12  DindinX  <david@dindinx.org>
+
+	* libgimp/gimppixelrgn.c: nomis helped me to make some correction to
+	the documentation.
+
+2004-09-12  DindinX  <david@dindinx.org>
+
+	* libgimp/gimppixelrgn.c: more documentation.
+
+2004-09-11  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/edge.c: added a default value (TRUE) for the
+	update_preview toggle.
+
+	* plug-ins/common/wind.c: ported to GimpPreviewArea, so the preview is
+	much more useful now.
+
+2004-09-11  DindinX  <david@dindinx.org>
+
+	* libgimp/gimppixelrgn.c: added some gtk-doc documentation to pixel
+	region related functions. (work in progress)
+
+2004-09-11  Simon Budig  <simon@gimp.org>
+
+	* app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to
+	gimp_dialog_factories_toggle to make it possible to ensure a visible
+	toolbox.
+
+	* app/actions/dialogs-commands.c: Use the new parameter to ensure
+	toolbox visibility after the last image window closes.
+
+	* app/display/gimpdisplayshell-callbacks.c: Changed accordingly.
+
+	Fixes bug #137057 (the discussion is in bug #152285)
+
+2004-09-11  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/edge.c: ported to GimpPreviewArea. 100 less lines of
+	code and much more features!
+
+2004-09-11  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/oilify.c: some code cleanup and small optimisations.
+
+2004-09-10  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/xpm.c (query): fixed spelling.
+
+2004-09-10  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/widgets/gimperrorconsole.c: fix typo
+
+2004-09-10  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcolorselect.c: untabified, removed useless
+	inclusion of <gdk/gdkkeysyms.h>.
+
+2004-09-10  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpcolorselect.c: ported to GimpPreviewArea.
+	Destroy the GdkGC in unrealize() instead of in finalize().
+
+2004-09-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainertreeview-dnd.c
+	(gimp_container_tree_view_drop_status): always call
+	gdk_drag_status() before returning FALSE.
+
+	(gimp_container_tree_view_drag_motion): never return FALSE, an
+	impossible drop location is now reported by calling
+	gdk_drag_status() above. Always returning TRUE makes sure
+	gimp_container_tree_view_drag_leave() is called unconditionally
+	and can remove the scroll_timeout set in drag_motion().
+
+	Fixes bug #152193 and many other obscure DND crashes caused by the
+	scroll_timeout being invoked after the widget is destroyed.
+
+2004-09-10  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/xpm.c: improved PDB blurb and help. Very loosely
+	based on a patch attached to bug #151912.
+
+2004-09-10  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_thumb):
+	also handle GRAY and GRAYA thumbnails.
+
+	* tools/pdbgen/pdb/drawable.pdb
+	* tools/pdbgen/pdb/image.pdb: corrected documentation for
+	_gimp_drawable_thumbnail() and _gimp_image_thumbnail().
+
+	* app/pdb/drawable_cmds.c
+	* app/pdb/image_cmds.c
+	* libgimp/gimpdrawable_pdb.c
+	* libgimp/gimpimage_pdb.c: regenerated.
+
+2004-09-10  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.c: fixed positioning of the
+	navigation marker and handling of motion events.
+
+2004-09-10  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.c
+	* libgimpwidgets/gimppreviewarea.c: documented new functions.
+
+2004-09-09  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablepreview.c
+	* libgimpwidgets/gimppreview.[ch]: added a navigation popup
+	similar to the one in the image window. Needs some more work.
+
+2004-09-09  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/gimppreviewarea.c: added a utility function
+	gimp_preview_area_queue_draw(), which queue the right part of the
+	preview to be redrawn. And use it in all the drawing functions. This
+	fix a problem where the preview wasn't updated correctly after a
+	resize.
+
+2004-09-09  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/cartoon.c
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/gauss.c
+	* plug-ins/common/grid.c
+	* plug-ins/common/neon.c
+	* plug-ins/common/noisify.c
+	* plug-ins/common/photocopy.c
+	* plug-ins/common/sel_gauss.c
+	* plug-ins/common/sharpen.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/softglow.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/struc.c
+	* plug-ins/common/unsharp.c: pack all drawable previews expanding.
+	Also did some general cleanups like consistently naming the dialog
+	variable "dialog" and the main vbox "main_vbox".
+
+2004-09-09  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.[ch]: right-align the preview for RTL
+	layouts.
+
+2004-09-09  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.[ch]: allow to set a maximum size
+	and center the preview area if its allocation extends the maximum.
+
+	* libgimpwidgets/gimppreview.[ch]: derive from GtkVBox, moved the
+	toggle button out of the table and put the table into an aspect
+	frame. Added an API to set the preview boundaries. Set the maximum
+	size of the GimpPreviewArea from that function.
+
+	* libgimpwidgets/gimpwidgets.def: added new entries.
+
+	* libgimp/gimpdrawablepreview.c: use gimp_preview_set_bounds().
+
+	* plug-ins/common/gauss.c: pack the preview widget so that it
+	resizes with the dialog.
+
+2004-09-09  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_blend)
+	(gimp_preview_area_mask): optimized the case where both buffers have
+	the same alpha for a given pixel.
+
+2004-09-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpviewrendererbrush.c
+	* app/widgets/gimpviewrendererdrawable.c
+	* app/widgets/gimpviewrenderergradient.c
+	* app/widgets/gimpviewrendererimage.c
+	* app/widgets/gimpviewrendererimagefile.c
+	* app/widgets/gimpviewrendererlayer.c
+	* app/widgets/gimpviewrenderervectors.c: purely cosmetic cleanup.
+
+2004-09-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimppdbdialog.c (gimp_pdb_dialog_constructor): use
+	g_type_name(dialog_type) instead of just "pdb dialog" as name for
+	the dialog's private context.
+
+2004-09-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/convert-dialog.[ch] (convert_dialog_new): changed
+	GimpDisplay* parameter to GimpProgress* because that's what it's
+	used for.
+
+	* app/actions/image-commands.c (image_convert_cmd_callback):
+	changed accordingly.
+
+	* app/gui/convert-dialog.c: massively cleaned up internals. Use a
+	GimpViewableButton + GimpContainerEntry combo as in text options
+	for selecting the custom palette. Use a filtered container which
+	contains only palettes with a maximum of 256 colors.
+	Fixes bug #136574
+
+2004-09-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/file-open-location-dialog.[ch]: changed
+	file_open_location_dialog_show() to
+	file_open_location_dialog_new() and return the dialog.
+
+	* app/gui/dialogs.c
+	* app/gui/dialogs-constructors.[ch]: added a constructor for it
+	and let the dialog factory manage it entirely.
+
+	* app/actions/file-commands.c
+	(file_open_location_dialog_cmd_callback): use the dialog factory
+	to create it.
+
+2004-09-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdialogfactory.c
+	(gimp_dialog_factory_dialog_new_internal): renamed parameter
+	"gboolean raise_if_found" to "return_existing" and added
+	additional parameter "gboolean present".
+
+	(gimp_dialog_factory_dialog_new)
+	(gimp_dialog_factory_dialog_raise)
+	(gimp_dialog_factory_dockable_new): pass both parameters (passing
+	"present" as "raise_if_found" was not quite correct).
+
+2004-09-08  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/gimppreviewarea.c: fixed a stupid typo.
+
+2004-09-08  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_fill):
+	optimized solid color fills.
+
+2004-09-08  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.c: factored out common code.
+	Reduced indentation level by closing a switch earlier.
+
+2004-09-08  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/gimppreviewarea.c: (gimp_preview_area_blend)
+	use gimp_preview_area_draw when the opacity is 0 or 255, instead of
+	duplicating code.
+
+2004-09-07  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.def: added new entries.
+
+	* libgimpwidgets/test-preview-area.c: fit output into 80 columns.
+
+	* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw): some
+	code cleanup.
+
+2004-09-07  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/test-preview-area.c: added some tests for
+	gimp_preview_area_blend() and gimp_preview_area_mask().
+
+2004-09-07  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/gimppreviewarea.c
+	* libgimpwidgets/gimppreviewarea.h: added two functions:
+	gimp_preview_area_blend() to draw the blending of two buffers with
+	an opacity parameter, and gimp_preview_area_mask() to draw the
+	blending of two buffers, with a mask buffer. The code still needs some
+	polish, though.
+
+	* libgimp/gimpdrawablepreview.c
+	* libgimp/gimpdrawablepreview.h: use gimp_preview_area_mask() in
+	gimp_drawable_preview_draw(), so the previews are now much more
+	accurate (respecting the selection, if any).
+
+	Also made the buf parameter of gimp_drawable_preview_draw() a pointer
+	to constants.
+
+2004-09-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-draw.c
+	(gimp_display_shell_draw_grid): #define the constant crosshair
+	size for the INTERSECTION grid style instead of using an eeky
+	"const gint".
+
+2004-09-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/dialogs.c (toplevel_entries): added a foreign entry
+	"gimp-file-open-loaction-dialog".
+
+	* app/gui/file-open-location-dialog.c: register the dialog
+	with the toplevel dialog factory so it remembers its position.
+
+2004-09-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/context-actions.c
+	* app/actions/context-commands.[ch]: applied a heavily modified
+	patch from David Gowers which adds actions to modify the context's
+	paint_mode. Fixes bug #151471.
+
+	* menus/image-menu.xml.in: added them to the (commentd out)
+	"Context" submenu.
+
+2004-09-07  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/edge.c: indentation and whitespace cleanup.
+
+	* plug-ins/common/struc.c: minor coding style issues.
+
+2004-09-07  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/xwd.c (query): applied patch from Alan Horkan
+	which improves the blurb and help texts. Fixes bug #151912.
+
+	Unrelated: did coding style / indentation cleanup in the whole file.
+
+2004-09-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri):
+	simplified the code that selects an image file by its URI.
+
+2004-09-07  Simon Budig  <simon@gimp.org>
+
+	* app/widgets/gimpviewrendererbrush.c: Added an indicator for
+	generated brushes. Pretty straightforward, suggestions for
+	improvements are welcome.
+
+2004-09-06  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/struc.c: added a preview.
+
+2004-09-06  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimpcroptool.c: reordered info_dialog_hide() and
+	crop_tool_crop_image(), which avoids the repeated popping up
+	of the info dialog and avoids a crash.
+
+	Fixes bug #151712
+
+2004-09-05  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/cartoon.c: use gimp_preview_invalidate() where
+	appropriate.
+
+	* plug-ins/common/photocopy.c: Added a preview.
+
+2004-09-05  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: bumped version number to 2.1.5.
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select
+	the image file, not only the folder it lives in. Fixes bug #151638.
+
+2004-09-05  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/cartoon.c: Added a preview.
+
+2004-09-05  Simon Budig  <simon@gimp.org>
+
+	* plug-ins/common/autocrop.c: fix handling of layers with an
+	offset. Resize the image before cropping when the covered area
+	of a layer is partially outside the image area. Make math more
+	comprehensible.
+
+2004-09-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/convmatrix.c
+	* plug-ins/common/smooth_palette.c
+	* plug-ins/flame/flame.c: renamed functions from doit() to
+	something less silly.
+
+2004-09-05  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.1.4 release.
+
+2004-09-05  Simon Budig  <simon@gimp.org>
+
+	* tools/pdbgen/pdb/image.pdb: improved documentation for
+	gimp_image_resize_to_layers
+
+	* libgimp/gimp.def: added gimp_image_resize_to_layers
+
+	* app/pdb/image_cmds.c
+	* libgimp/gimpimage_pdb.c: regenerated
+
+2004-09-05  Simon Budig  <simon@gimp.org>
+
+	* app/core/gimpimage-resize.[ch]: Implement function to resize
+	the image to contain all layers completely. Untabified.
+
+	* app/actions/image-actions.c
+	* app/actions/image-commands.[ch]
+	* app/widgets/gimphelp-ids.h
+	* menus/image-menu.xml.in: Make it available in the GUI.
+
+	* tools/pdbgen/pdb/image.pdb: Make it available in the PDB.
+
+	* app/pdb/image_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpimage_pdb.[ch]: regenerated.
+
+2004-09-04  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/noisify.c: ported to GimpDrawablePreview.
+
+2004-09-04  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* libgimp/gimp.def
+	* libgimpbase/gimpbase.def
+	* libgimpwidgets/gimpwidgets.def: added the check(erboard) related
+	entries
+
+2004-09-04  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.[ch]: pass a GdkEventButton to
+	gimp_preview_area_menu_popup().
+
+	* libgimpwidgets/gimppreview.c: implement GtkWidget::popup_menu().
+
+2004-09-04  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/gimppreview.c: Changed the way we attach the preview
+	area frame to the table so very small drawables don't cause a
+	malicious bug.
+
+2004-09-04  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/sel_gauss.c: ported to GimpDrawablePreview.
+
+2004-09-04  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/sharpen.c: ported to GimpDrawablePreview.
+
+2004-09-03  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.[ch]: added
+	gimp_preview_area_menu_popup(). Not completely finished yet...
+
+	* libgimpwidgets/gimppreview.c: use the new function.
+
+2004-09-03  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_set_drawable):
+	take care of setting the colormap for indexed drawables.
+
+	* libgimpwidgets/gimppreview.c (gimp_preview_area_event): pan with
+	the first mouse button only. We will need the other buttons.
+
+2004-09-03  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/grid.c: ported to GimpDrawablePreview.
+
+2004-09-03  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/plasma.c (plasma_dialog): left-align the preview.
+
+	* plug-ins/common/grid.c (dialog): pack the preview as in other
+	plug-in dialogs and embed it into a GtkFrame.
+
+2004-09-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdevicestatus.c: removed "Configure input
+	devices" button. Fixes bug #150177.
+
+2004-09-03  Simon Budig  <simon@gimp.org>
+
+	* app/gui/info-window.c: Applied modified patch by Kevin Cozens
+	that implements a "Comments" tab in the image info dialog.
+
+	Fixes bug #151719.
+
+2004-09-03  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): swapped light
+	and gray checks to get a checkerboard that matches the image window.
+
+2004-09-03  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpbase/gimpprotocol.h (struct _GPConfig): replaced the
+	never used "gdouble gamma" with 8 reserved gint8 and stuffed two
+	gint8 behind "gint8 show_tool_tips" where they fit in in a binary
+	compatible way due to 32bit aligning of the following "gint32
+	min_colors". Use the latter ones for "check_size" and
+	"check_type".
+
+	* libgimpbase/gimpprotocol.c (_gp_config_read,write): changed
+	accordingly to pass the new stuff over the wire.
+
+	* app/plug-in/plug-in-run.c: ditto. Pass the transpareny values
+	from GimpDisplayConfig to plug-ins.
+
+	* libgimp/gimp.[ch] (gimp_config): remember the new config values.
+	(gimp_check_size,type): new functions returning the new config values.
+
+	* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_init):
+	use the new values to configure preview->area accordingly.
+
+2004-09-03  Sven Neumann  <sven@gimp.org>
+
+	* libgimpbase/gimpchecks.h
+	* libgimpbase/gimplimits.h: moved check size and check color
+	defines. It makes a lot more sense to keep them in gimpchecks.h.
+
+	* libgimpbase/gimpchecks.c (gimp_checks_get_shades): documented.
+
+	* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw):
+	added a sanity check so we don't crash if the drawable pointer
+	should ever be NULL here.
+
+2004-09-02  Helvetix Victorinox  <helvetix@gimp.org>
+
+	* app/composite/gimp-composite-*test.c: a regression test now
+	iterates over 8388625 pixels per pass.
+
+	* app/composite/gimp-composite-mmx.c
+	* app/composite/gimp-composite-sse.c
+	* app/composite/gimp-composite-sse2.c:
+	Ensured that a clobbered condition code register is reflected in
+	the clobbered register list for each asm() statement.
+	This should FIX bug #147013.
+
+2004-09-03  Sven Neumann  <sven@gimp.org>
+
+	* libgimpbase/Makefile.am
+	* libgimpbase/gimpchecks.[ch] added gimp_checks_get_shades().
+
+	* app/base/temp-buf.c
+	* app/display/gimpdisplayshell-render.c
+	* libgimpwidgets/gimppreviewarea.c: use the new function instead
+	of replicating these numbers in three different places.
+
+2004-09-03  DindinX  <david@dindinx.org>
+
+	* plug-ins/gimpressionist/*.c: made the code much more readable by
+	applying the gimp's coding standard (intentation, space, etc.), and
+	remove the GTK_DISABLE_DEPRECATED warnings, since these files don't use
+	any deprecated stuff anymore.
+
+2004-09-02  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* libgimp/gimpui.def
+	* libgimpbase/gimpbase.def
+	* libgimpwidgets/gimpwidgets.def: added the preview and progress
+	related entries
+
+2004-09-02  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/neon.c
+	* plug-ins/common/noisify.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/softglow.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/unsharp.c: fixed various coding style and naming
+	issues and added some missing signal connections to update the new
+	previews.
+
+2004-09-02  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/despeckle.c: don't assume the preview has always the
+	same size, and do the memory allocation in preview_update(). As a side
+	effect, this fix a segfault :-).  Also save the preview toggle state
+	between invocations.
+
+2004-09-02  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-render.c (check_combos): light and
+	dark check color were swapped for GIMP_CHECK_TYPE_GRAY_CHECKS.
+
+	* libgimpwidgets/gimppreviewarea.[ch]: added "check-size" and
+	"check-type" properties and draw the checkerboard accordingly.
+
+2004-09-02  Sven Neumann  <sven@gimp.org>
+
+	* app/base/base-enums.[ch]
+	* libgimpbase/gimpbaseenums.[ch]: moved GimpCheckSize and
+	GimpCheckType enums to libgimpbase. Correctly prefix the enum
+	values.
+
+	* app/base/temp-buf.c
+	* app/config/gimpdisplayconfig.c
+	* app/display/gimpdisplayshell-render.c
+	* app/pdb/fileops_cmds.c
+	* tools/pdbgen/pdb/fileops.pdb: changed accordingly.
+
+2004-09-02  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/script-fu-interface.c (script_fu_ok)
+	* plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc):
+	use a GString for assembling the commands string instead of
+	g_sprintf()ing into a buffer. Removes the need for a separate loop
+	over all args to determine the buffer's length and makes the
+	remaining code smaller and more readable.
+
+2004-09-02  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.[ch]: made gimp_preview_draw() public,
+	added some gtk-doc comments.
+	(gimp_preview_toggle_callback): immidiately invalidate the preview.
+
+	* plug-ins/common/gauss.c (gauss): fixed (and simplified) handling
+	of zero radii by using the new GimpPreview API.
+
+2004-09-01  Helvetix Victorinox  <helvetix@gimp.org>
+
+	* app/composite/gimp-composite-mmx.[ch]: Added
+	gimp_composite_addition_va8_va8_va8_mmx().
+
+	* app/composite/make-installer.py: Regression tests now include
+	printing the image type for each test.
+
+	* app/composite/gimp-composite-mmx-test.c
+	* app/composite/gimp-composite-regression.c
+	* app/composite/gimp-composite-sse-test.c
+	* app/composite/gimp-composite-sse2-test.c
+	* app/composite/gimp-composite-x86.h: regenerated.
+
+2004-09-02  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/borderaverage.c
+	* plug-ins/common/checkerboard.c
+	* plug-ins/common/diffraction.c
+	* plug-ins/common/illusion.c
+	* plug-ins/common/polar.c
+	* plug-ins/common/ripple.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/video.c: don't pass run_mode to
+	gimp_rgn_iterator_new(), it's unused. Removes the need for it being
+	a global variable.
+
+2004-09-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplay.c
+	* app/widgets/gimpprogressdialog.c: gracefully handle progress
+	calls after the widget is destroyed. Re-fixes bug #150194.
+
+2004-09-01  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablepreview.[ch]
+	* libgimpwidgets/gimppreview.[ch]: always show the "Preview" check
+	button. Simplified the preview APIs, moved the "size" style
+	property to the GimpPreview class.
+
+	* etc/gtkrc: changed the example accordingly.
+
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/gauss.c
+	* plug-ins/common/neon.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/softglow.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/unsharp.c: follow change in GimpDrawablePreview API.
+
+2004-09-01  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/script-fu-types.h (struct SFOption): changed
+	"guint history" to "gint history".
+
+	* plug-ins/script-fu/script-fu-interface.c: added callbacks for
+	string entries and combo boxes and connect *all* widgets to callbacks.
+
+	(script_fu_ok): don't touch the widgets at all but get the values
+	directly now that the callbacks correctly write them to their
+	structs.
+
+	(script_fu_reset): don't copy the default values manually but
+	simply set the default values on the widgets; their callbacks will
+	do the rest.
+
+	* plug-ins/script-fu/script-fu-scripts.c (script_fu_add_script):
+	added some line breaks and spaces to make it more readable.
+
+2004-09-01  Michael Natterer  <mitch@gimp.org>
+
+	* libgimp/Makefile.am
+	* libgimp/gimpui.h
+	* libgimp/gimpuitypes.h
+	* libgimp/gimpprogressbar.[ch]: new widget GimpProgressBar which
+	automatically redirects any progress calls to itself while
+	it exists.
+
+	* plug-ins/script-fu/script-fu-interface.c: removed all progress
+	callbacks and simply use a GimpProgressBar.
+
+2004-09-01  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.[ch]: set a busy cursor while the
+	preview is being recalculated.
+
+	* libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_original):
+	do nothing if there's no drawable.
+
+2004-09-01  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): oops, swapped x
+	and y variables.
+
+	* libgimpwidgets/gimppreview.c: some minor changes, mainly cleanup.
+
+2004-09-01  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/gimpfu.py
+	* plug-ins/pygimp/gimpmodule.c: Hacked up support for the new
+	progress interface. Emphasis on hacked.
+
+	* plug-ins/pygimp/gimpmodule.c: Wrapped gimp_extension_enable(). Minor
+	cleanups.
+
+	* plug-ins/pygimp/pygimp-image.c
+	* plug-ins/pygimp/pygimp-tile.c: Minor cleanups.
+
+2004-08-31  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/plug-ins/gimpcons.py
+	* plug-ins/pygimp/plug-ins/pdbbrowse.py: remove deprecated mainloop
+	calls.
+
+2004-09-01  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablepreview.c: increased default preview size to
+	150 pixels. Added a border of 2 pixels around the bounding box of
+	the selection.
+
+	* libgimpwidgets/gimppreview.[ch]: only show the GDK_FLEUR cursor
+	if there's something to pan. Set the correct page size on the
+	scrollbar adjustments.
+
+2004-09-01  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.[ch]: added new function
+	gimp_preview_area_set_offsets().
+
+	* libgimpwidgets/gimppreview.c: use the new function to let the
+	checkerboard scroll with the preview.
+
+2004-09-01  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.[ch]: delay the emission of the
+	"invalidated" signal using a timeout. Removed hack that used to
+	invalidate the preview on button-release.
+
+	* plug-ins/common/unsharp.c: no need to fiddle with the slider
+	update policies any longer.
+
+2004-09-01  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to
+	gimp_dialog_factory_dialog_new() to let the caller decide whether
+	the window should be presented or not.
+
+	* app/actions/dialogs-commands.c
+	* app/actions/image-commands.c
+	* app/actions/templates-commands.c
+	* app/gui/gui-vtable.c
+	* app/gui/gui.c
+	* app/widgets/gimpsessioninfo.c: changed accordingly. Do not let
+	gimp_dialog_factory_dialog_new() present the dialog if we need to
+	change it after creation. This avoids annoying resizes, noticeable
+	especially with the error dialog.
+
+2004-08-31  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpdockable.c
+	* libgimp/gimpdrawablepreview.c: converted tabs to spaces.
+
+2004-08-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablepreview.c: added a style property for the
+	minimum size.
+
+	* etc/gtkrc: show how to adjust the size of GimpDrawablePreviews.
+
+2004-08-31  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdatafactoryview.c
+	(gimp_data_factory_view_activate_item): emit "clicked" on the
+	edit_button only if it exists and is sensitive. Fixes bug #151343.
+
+2004-08-31  Manish Singh  <yosh@gimp.org>
+
+	* app/plug-in/plug-in.c (plug_in_open): cast plug_in_recv_message
+	to GSourceFunc.
+
+2004-08-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.c: handle the widget size dynamically.
+	Hide scrollbars when there's nothing to scroll.
+
+	* libgimp/gimpdrawablepreview.c: simplified a lot. The scrollbars
+	are handled completely in the GimpPreview widget now.
+
+2004-08-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.c: removed the hardcoded preview size,
+	removed some redundant assertions.
+
+2004-08-31  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.[ch]: removed the GUI code...
+	Also did some minor cleanups.
+
+	* plug-ins/script-fu/script-fu-interface.[ch]: ...and added it here.
+
+	* plug-ins/script-fu/script-fu-types.h: new file keeping the
+	various struct defs needed by both the above files.
+
+	* plug-ins/script-fu/Makefile.am
+	* plug-ins/script-fu/siod-wrapper.c: changed accordingly.
+
+2004-08-31  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback):
+	notify the "update" property on the preview, not the toggle.
+
+2004-08-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreview.c: allow to pan the preview with all
+	mouse buttons. Set a cursor to indicate that panning is possible.
+
+2004-08-31  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/gimppreview.c
+	* libgimpwidgets/gimppreview.h: renamed the "updated" signal to
+	"invalidated" and the confusing "update" virtual function to "draw".
+
+	Gave the properties saner names, too.
+
+	Removed _get_width and _get_height functions in favor of a _get_size
+	one.
+
+	Added gimp_preview_invalidate function that emits the "invalidated"
+	signal if needed.
+
+	* libgimp/gimpdrawablepreview.c
+	* libgimp/gimpdrawablepreview.h: modified accordingly and fixed the
+	scrollbar range.
+
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/gauss.c
+	* plug-ins/common/neon.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/softglow.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/unsharp.c: modified accordingly.
+
+2004-08-31  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.c: removed the script title
+	label and moved the "About" button to the action_area. Minor
+	cleanups.
+
+2004-08-31  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable-transform.[ch]: added GimpProgress
+	parameter to gimp_drawable_transform_affine().
+
+	* tools/pdbgen/pdb/edit.pdb
+	* tools/pdbgen/pdb/transform_tools.pdb: show progress for "blend"
+	and all transform functions.
+
+	* app/pdb/edit_cmds.c
+	* app/pdb/transform_tools_cmds.c: regenerated.
+
+2004-08-31  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/curve_bend.c: don't use GDK_TOP_LEFT_ARROW
+	to restore the default cursor, simply pass NULL to
+	gdk_window_set_cursor().
+
+2004-08-31  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintoptions.[ch]: added "GimpPaintInfo *paint_info"
+	member and construct property. Changed gimp_paint_options_new()
+	to take only a GimpPaintInfo parameter.
+
+	* app/core/gimpitem.c (gimp_item_stroke)
+	* app/core/gimppaintinfo.c (gimp_paint_info_new): changed accordingly.
+
+	* app/core/gimpchannel.c (gimp_channel_stroke)
+	* app/vectors/gimpvectors.c (gimp_vectors_stroke): use
+	paint_options->paint_info->paint_type directly instead of casting
+	to GimpToolOptions and using
+	tool_options->tool_info->paint_info->paint_type (eek). Fixes crash
+	when stroking via the PDB because newly created GimpToolOptions
+	instances have no "tool_info" pointer yet.
+
+	* tools/pdbgen/pdb/paint_tools.pdb: changed all paint PDB wrappers
+	accordingly.
+
+	* app/pdb/paint_tools_cmds.c: regenerated.
+
+2004-08-31  Michael Natterer  <mitch@gimp.org>
+
+	* app/config/gimpconfig.c (gimp_config_iface_duplicate): set
+	construct_param->foo, not construct_param*s*->foo, so we don't set
+	the first construct param again and crash.
+
+2004-08-31  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/cubism.c: added "..." to the progress text.
+
+2004-08-31  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/file-actions.c (file_actions): added "..." to "Revert".
+
+2004-08-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpuitypes.h
+	* libgimpwidgets/gimpwidgetstypes.h: moved the GimpDrawablePreview
+	typedef to the header file that it belongs to.
+
+	* libgimp/gimpdrawablepreview.[ch]: minor include cleanups and
+	gtk-doc fixes.
+
+2004-08-31  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/gauss.c (gauss_dialog): update the preview when
+	the blur radius is being changed. gimp_coordinates_new() seems to
+	be broken though; there shouldn't be two signal connections needed
+	here.
+
+2004-08-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablepreview.[ch]
+	* libgimpwidgets/gimppreview.[ch]: minor code cleanup, fixes to
+	gtk-doc comments and to the handling of object properties.
+
+2004-08-31  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/gimppreview.c
+	* libgimpwidgets/gimppreview.h: added a GimpPreview widget, abstract
+	base for a GimpDrawablePreview.
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgets.h
+	* libgimpwidgets/gimpwidgetstypes.h: modified accordingly.
+
+	* libgimp/gimpdrawablepreview.c
+	* libgimp/gimpdrawablepreview.h: added a GimpDrawablePreview widget
+	to ease	the use of previews by plug-ins.
+
+	* libgimp/Makefile.am
+	* libgimp/gimpui.h: Changed accordingly.
+
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/gauss.c
+	* plug-ins/common/neon.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/softglow.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/unsharp.c: use a GimpDrawablePreview with these
+	plug-ins.
+
+2004-08-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-progress.[ch]: added boolean return values
+	to plug_in_progress_install(), uninstall() and cancel(). Added
+	checks to make sure the installed progress_callback exists, has
+	the correct signature and was installed by this plug-in.
+
+	* tools/pdbgen/pdb/progress.pdb: use the return values to let the
+	PDB wrappers succeed/fail.
+
+	* app/pdb/progress_cmds.c: regenerated.
+
+2004-08-30  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* libgimp/gimp.def: added gimp_progress_install &
+	gimp_progress_uninstall
+
+2004-08-30  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpregioniterator.c: document the fact that "run_mode"
+	is unused. Also did some code cleanup.
+
+2004-08-30  Michael Natterer  <mitch@gimp.org>
+
+	* libgimp/gimpregioniterator.c: always update the progress.
+	Makes all "run_mode" parameters useless.
+
+2004-08-30  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/gauss.c: add "..." to the progress text.
+
+2004-08-30  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpprogress.c: added some gtk-doc comments, could be
+	improved further.
+
+2004-08-30  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/colortoalpha.c
+	* plug-ins/common/compose.c
+	* plug-ins/common/decompose.c
+	* plug-ins/common/film.c
+	* plug-ins/fits/fits.c: always use the progress API, not doing it
+	in non-interactive mode has always been wrong.
+
+2004-08-30  Manish Singh  <yosh@gimp.org>
+
+	* libgimp/gimpprogress.[ch] (gimp_progress_uninstall): return the
+	user_data pointer on uninstall. Eases language binding work.
+
+2004-08-30  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpbrushmenu.c (gimp_brush_select_preview_draw): fixed
+	drawing of brushes that extend beyond the preview.
+
+2004-08-30  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set):
+	avoid excessive use of strdup() and strcmp(). The strings are all
+	constant anyway.
+
+2004-08-30  Michael Natterer  <mitch@gimp.org>
+
+	Brought the PDB progress into a working state. Fixes bug #6010,
+	addresses bugs #97266 and #135185 and unfortunately reopens bug
+	#150194 (will fix that later).
+
+	* libgimpbase/gimpbaseenums.h: added enum GimpProgressCommand.
+
+	* app/core/gimppdbprogress.c
+	* libgimp/gimpprogress.c: use the enum instead of integer
+	constants for the different progress commands. Cleanup.
+
+	* app/plug-in/plug-in-progress.c
+	* app/plug-in/plug-in-run.c
+	* app/plug-in/plug-in.c: switch back to real refcounting for
+	plug_in->progress (reopens bug #150194) and enabled the PDB
+	progress code.
+
+	* plug-ins/script-fu/script-fu-scripts.c: cleaned up the
+	progress stuff and the script-fu interface a bit.
+
+	* plug-ins/pygimp/gimpenums.py
+	* plug-ins/script-fu/script-fu-constants.c
+	* tools/pdbgen/enums.pl: regenerated.
+
+2004-08-29  Manish Singh  <yosh@gimp.org>
+
+	* app/plug-in/plug-in.c (plug_in_open): set can_recurse on the
+	recv_message watch, so we don't block on recursive calls to the
+	handler. plug_in_recv_message needs some refcounting help now
+	though.
+
+2004-08-29  Helvetix Victorinox  <helvetix@gimp.org>
+
+	* app/composite/gimp-composite-x86.h
+	* app/composite/gimp-composite-sse.c
+	* app/composite/gimp-composite-sse2.c: Fixed a bunch of
+	warnings due to bad type casting.
+
+	* app/composite/gimp-composite-mmx.c
+	* app/composite/gimp-composite-sse.c
+	* app/composite/gimp-composite-x86.h
+	* app/composite/gimp-composite-sse2.c:
+	The last changes to fix the the clobber registers bug #147013.
+	Commented out some dead code to be reviewed later.
+
+2004-08-29  Michael Natterer  <mitch@gimp.org>
+
+	Added an API to allow plug-ins to embed the progress for the
+	actions they trigger into their own GUI (attention: half-done and
+	broken code ahead...)
+
+	* app/core/Makefile.am
+	* app/core/core-types.h
+	* app/core/gimppdbprogress.[ch]: new object implementing dispatching
+	progress calls to a temporary PDB procedure in a plug-in.
+
+	* app/Makefile.am: force to link gimppdbprogress.o, bah!
+
+	* app/plug-in/plug-in-progress.[ch]: added API to install,
+	uninstall and cancel a PDB progress for this plug-in, but disabled
+	the implementation because it doesn't work yet.
+
+	* tools/pdbgen/pdb/progress.pdb: added pdb wrappers for the new
+	install, uninstall and cancel functions.
+
+	* libgimp/Makefile.am
+	* libgimp/gimp.h
+	* libgimp/gimpprogress.[ch]: added an API around the PDB progress
+	stuff.
+
+	* app/pdb/internal_procs.c
+	* app/pdb/progress_cmds.c
+	* libgimp/gimpprogress_pdb.[ch]: regenerated.
+
+	* plug-ins/script-fu/script-fu-scripts.c: use the new API to show
+	the progress in the script-fu dialog.
+
+2004-08-29  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* libgimpwidgets/gimpwidgets.def: added
+	gimp_scale_entry_set_logarithmic
+
+2004-08-29  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpconfigwriter.c: don't emit critical warnings
+	about a messed up state of GimpConfigWriter if the writer is
+	disabled because of a write error that occured earlier.
+
+2004-08-29  DindinX  <david@dindinx.org>
+
+	* app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize.
+
+	* app/core/core-enums.c: Regenerated.
+
+	* app/actions/dockable-actions.c
+
+	* app/config/gimpcoreconfig.c
+	* app/config/gimpcoreconfig.h
+	* app/config/gimpdisplayconfig.c
+	* app/config/gimpdisplayconfig.h
+
+	* app/core/gimpundo.c
+
+	* app/display/gimpnavigationeditor.c
+
+	* app/gui/dialogs.c
+	* app/gui/file-open-location-dialog.c
+
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimptextoptions.c
+
+	* app/widgets/gimpbrushselect.c
+	* app/widgets/gimpcontainerpopup.c
+	* app/widgets/gimpcontainerview.c
+	* app/widgets/gimpdialogfactory.c
+	* app/widgets/gimpfontselect.c
+	* app/widgets/gimpgradientselect.c
+	* app/widgets/gimppaletteselect.c
+	* app/widgets/gimppatternselect.c
+	* app/widgets/gimpselectioneditor.c
+	* app/widgets/gimpsessioninfo.c
+	* app/widgets/gimptemplateeditor.c
+	* app/widgets/gimpundoeditor.c
+	* app/widgets/gimpundoeditor.h
+	* app/widgets/gimpviewablebutton.c: Changed accordingly.
+
+2004-08-28  Helvetix Victorinox  <helvetix@gimp.org>
+
+	* app/composite/gimp-composite-sse.c
+	* app/composite/gimp-composite-sse2.c: More updates to accomodate
+	the clobber registers. Additional progress against bug #147013.
+
+	* app/composite/gimp-composite-sse.h: Fixed a bug where the wrong
+	manifest constant definition caused sse2 instructions to never be
+	compiled.
+
+2004-08-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/vpropagate.c (run): fixed confusion about which
+	mode to use when being run with last values (bug #151308).
+
+2004-08-28  Simon Budig  <simon@gimp.org>
+
+	* plug-ins/common/plugindetails.c: workaround to avoid a warning
+	by gcc about the use of "%c" in the format string for strftime.
+
+2004-08-28  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao
+	S. O. Bueno which adds an API that allows to make the scale widget
+	of a GimpScaleEntry behave logarithmic. Fixes bug #149420.
+
+	* app/widgets/gimpbrusheditor.c: use the new functionality for the
+	radius control.
+
+2004-08-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/compose.c (compose_dialog): applied patch from
+	Markus Triska that improves which layers are choosen by
+	default (bug #148172).
+
+2004-08-28  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimage-contiguous-region.c
+	(find_contiguous_region_helper): applied a patch from Eric Cheung
+	that changes the function to use a GQueue to implement recursion
+	instead of recursive function calls. Fixes bug #151124.
+
+	* plug-ins/common/noisify.c (noisify_dialog): left-align the
+	preview.
+
+2004-08-28  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphelp-ids.h
+	* app/widgets/gimptoolbox.c (toolbox_create_image_area): added a
+	help-id for the image area.
+
+2004-08-27  Michael Natterer  <mitch@gimp.org>
+
+	Moved the gimp_progress_init() and gimp_progress_update() PDB
+	functions to their own group because they don't belong to the
+	"Plug-In" namespace and will soon get more functions.
+
+	* tools/pdbgen/pdb/plug_in.pdb: removed the progress stuff...
+
+	* tools/pdbgen/pdb/progress.pdb: ...and added it here.
+
+	* tools/pdbgen/Makefile.am
+	* tools/pdbgen/groups.pl
+	* app/pdb/Makefile.am
+	* libgimp/Makefile.am: changed accordingly.
+
+	* app/pdb/progress_cmds.c
+	* libgimp/gimpprogress_pdb.[ch]: new generated files.
+
+	* app/pdb/internal_procs.c
+	* app/pdb/plug_in_cmds.c
+	* libgimp/gimp_pdb.h
+	* libgimp/gimpplugin_pdb.[ch]: regenerated.
+
+2004-08-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainereditor.c
+	(gimp_container_editor_construct): call
+	gimp_container_editor_select_item() manually at construction time
+	so views show the initially selected object's state correctly
+	(e.g. the brush spacing). Fixes bug #151227.
+
+2004-08-27  DindinX  <david@dindinx.org>
+
+	* app/widgets/gimpnavigationpreview.c
+	* app/widgets/gimpnavigationpreview.h: renamed these files to ...
+
+	* app/widgets/gimpnavigationview.c
+	* app/widgets/gimpnavigationview.h: to these.
+	And renamed the GimpNavigationPreview type to GimpNavigationView.
+
+	Hopefully, this is the last change in file names for the Preview->View
+	renaming process.
+
+	* app/display/gimpnavigationeditor.c
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h: Changed accordingly.
+
+2004-08-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpitem.[ch]: removed "gboolean use_default_values"
+	from GimpItem::stroke().
+
+	* app/core/gimpchannel.c
+	* app/core/gimpselection.c
+	* app/vectors/gimpvectors.c: changed accordingly.
+
+2004-08-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpitem.c (gimp_item_stroke): implement the whole
+	paint_options fiddling here instead of in each subclass and pass
+	either GimpStrokeOptions or GimpPaintOptions (instead of
+	GimpStrokeOptions or GimpPaintInfo) to GimpItem::stroke().
+
+	Also copied code (that needs to be abstracted to a utility
+	function) from the tool_manager which makes sure we really use the
+	global brush, pattern etc. if these options are checked in prefs.
+	Fixes bug #150716.
+
+	* app/core/gimpchannel.c (gimp_channel_stroke)
+	* app/vectors/gimpvectors.c (gimp_vectors_stroke): removed the
+	duplicated code mentioned above and simply use the paint_options
+	passed.
+
+2004-08-26  DindinX  <david@dindinx.org>
+
+	* app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is
+	really derived from GimpViewRenderer and not from
+	GimpViewRendererDrawable.
+
+2004-08-26  DindinX  <david@dindinx.org>
+
+	* app/widgets/gimppreviewrenderer-utils.c
+	* app/widgets/gimppreviewrenderer-utils.h
+	* app/widgets/gimppreviewrendererbrush.c
+	* app/widgets/gimppreviewrendererbrush.h
+	* app/widgets/gimppreviewrendererdrawable.c
+	* app/widgets/gimppreviewrendererdrawable.h
+	* app/widgets/gimppreviewrenderergradient.c
+	* app/widgets/gimppreviewrenderergradient.h
+	* app/widgets/gimppreviewrendererimage.c
+	* app/widgets/gimppreviewrendererimage.h
+	* app/widgets/gimppreviewrendererimagefile.c
+	* app/widgets/gimppreviewrendererimagefile.h
+	* app/widgets/gimppreviewrendererlayer.c
+	* app/widgets/gimppreviewrendererlayer.h
+	* app/widgets/gimppreviewrenderervectors.c
+	* app/widgets/gimppreviewrenderervectors.h: Renamed all these files...
+
+	* app/widgets/gimpviewrenderer-utils.c
+	* app/widgets/gimpviewrenderer-utils.h
+	* app/widgets/gimpviewrendererbrush.c
+	* app/widgets/gimpviewrendererbrush.h
+	* app/widgets/gimpviewrendererdrawable.c
+	* app/widgets/gimpviewrendererdrawable.h
+	* app/widgets/gimpviewrenderergradient.c
+	* app/widgets/gimpviewrenderergradient.h
+	* app/widgets/gimpviewrendererimage.c
+	* app/widgets/gimpviewrendererimage.h
+	* app/widgets/gimpviewrendererimagefile.c
+	* app/widgets/gimpviewrendererimagefile.h
+	* app/widgets/gimpviewrendererlayer.c
+	* app/widgets/gimpviewrendererlayer.h
+	* app/widgets/gimpviewrenderervectors.c
+	* app/widgets/gimpviewrenderervectors.h: ... to these names. And also
+	changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones.
+
+	* app/tools/gimppaintoptions-gui.c
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpcomponenteditor.c
+	* app/widgets/gimpfiledialog.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimpview.c
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpviewrenderer.c
+	* app/widgets/gimpviewrenderer.h: modified accordingly.
+
+2004-08-26  Sven Neumann  <sven@gimp.org>
+
+	* app/sanity.c (sanity_check_filename_encoding): try to convert
+	the result of gimp_directory() to UTF-8 and bail out with a
+	moderately helpful error message if this conversion fails. Works
+	around bug #150917. Also marked these strings for translation.
+
+2004-08-26  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush
+	as the default tool as suggested in bug #151091.
+
+2004-08-26  DindinX  <david@dindinx.org>
+
+	* app/widgets/gimppreview-popup.c
+	* app/widgets/gimppreview-popup.h
+	* app/widgets/gimppreviewrenderer.c
+	* app/widgets/gimppreviewrenderer.h: really removed these files from
+	cvs.
+
+2004-08-25  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/gifload.c: Guard against bogus logical screen
+	dimensions. Fixes bug #151053.
+
+2004-08-26  DindinX  <david@dindinx.org>
+
+	* app/widgets/gimppreview-popup.c
+	* app/widgets/gimppreview-popup.h: renamed these files...
+
+	* app/widgets/gimpview-popup.c
+	* app/widgets/gimpview-popup.h: .. to these files, and changed the
+	GimpPreviewPopup type to GimpViewPopup.
+
+	* app/widgets/gimppreviewrenderer.c
+	* app/widgets/gimppreviewrenderer.h: renamed these files...
+
+	* app/widgets/gimpviewrenderer.c
+	* app/widgets/gimpviewrenderer.h: .. to these files, and changed
+	GimpPreviewRenderer to GimpViewRenderer.
+
+	This is the second step of the great Preview->View renaming process.
+
+	* app/display/gimpdisplayshell-layer-select.c
+	* app/display/gimpnavigationeditor.c
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpbrushfactoryview.c
+	* app/widgets/gimpbufferview.c
+	* app/widgets/gimpcellrendererviewable.c
+	* app/widgets/gimpcellrendererviewable.h
+	* app/widgets/gimpcomponenteditor.c
+	* app/widgets/gimpcontainerbox.c
+	* app/widgets/gimpcontainercombobox.c
+	* app/widgets/gimpcontainereditor.c
+	* app/widgets/gimpcontainerentry.c
+	* app/widgets/gimpcontainergridview.c
+	* app/widgets/gimpcontainerpopup.c
+	* app/widgets/gimpcontainertreeview-dnd.c
+	* app/widgets/gimpcontainertreeview.c
+	* app/widgets/gimpcontainerview.c
+	* app/widgets/gimpdatafactoryview.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpnavigationpreview.c
+	* app/widgets/gimppatternfactoryview.c
+	* app/widgets/gimppreviewrenderer-utils.c
+	* app/widgets/gimppreviewrendererbrush.c
+	* app/widgets/gimppreviewrendererbrush.h
+	* app/widgets/gimppreviewrendererdrawable.c
+	* app/widgets/gimppreviewrendererdrawable.h
+	* app/widgets/gimppreviewrenderergradient.c
+	* app/widgets/gimppreviewrenderergradient.h
+	* app/widgets/gimppreviewrendererimage.c
+	* app/widgets/gimppreviewrendererimage.h
+	* app/widgets/gimppreviewrendererimagefile.c
+	* app/widgets/gimppreviewrendererimagefile.h
+	* app/widgets/gimppreviewrendererlayer.c
+	* app/widgets/gimppreviewrenderervectors.c
+	* app/widgets/gimpselectioneditor.c
+	* app/widgets/gimptemplateview.c
+	* app/widgets/gimptooloptionseditor.c
+	* app/widgets/gimptoolview.c
+	* app/widgets/gimpview.c
+	* app/widgets/gimpview.h
+	* app/widgets/gimpviewablebutton.c
+	* app/widgets/widgets-enums.h
+	* app/widgets/widgets-types.h: Modified accordingly.
+
+2004-08-25  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop
+	adding message boxes and redirect messages to stderr if there are
+	too many messages.
+
+2004-08-25  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* devel-docs/ggr.txt: fix incorrect statement, add note re SVG.
+
+2004-08-25  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat().
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimperrordialog.[ch]: added new dialog that adds a new
+	GimpMessageBox for each message added. Fixes bug #92604.
+
+	* app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box()
+	functionality.
+
+	* app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog.
+
+	* app/gui/dialogs-constructors.[ch]
+	* app/gui/dialogs.c: manage GimpErrorDialog as singleton.
+
+	* app/gui/gui-vtable.c (gui_message): use the new error dialog.
+
+	* app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL
+	domain.
+
+	* app/widgets/gimperrorconsole.c (gimp_error_console_add): fail
+	when being called with a NULL domain.
+
+2004-08-25  DindinX  <david@dindinx.org>
+
+	* app/display/gimpnavigationeditor.[ch]: eradicate some more previews
+	in favor of views.
+
+2004-08-25  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* devel-docs/Makefile.am
+	* devel-docs/ggr.txt: added new file decribing the ggr (Gimp
+	gradient) file format.
+
+2004-08-25  DindinX  <david@dindinx.org>
+
+	* app/display/gimpnavigationview.c
+	* app/display/gimpnavigationview.h: renamed these files to...
+
+	* app/display/gimpnavigationeditor.c
+	* app/display/gimpnavigationeditor.h: ... these files, and of course
+	changed GimpNavigationView to GimpNavigationEditor since it is really
+	inherited from GimpEditor anyway.
+
+	This will leave the gimp_navigation_view namespace for the renaming
+	from gimp_navigation_preview.
+
+	* app/display/Makefile.am
+	* app/display/display-types.h
+	* app/display/gimpdisplayshell-callbacks.c
+	* app/gui/dialogs-constructors.c: Changed accordlingly.
+
+2004-08-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-title.c
+	(gimp_display_shell_format_title): print bad '%' sequences
+	literally instead of warning (g_warning() is for programming
+	errors only and must never be triggered by bad or intermediate
+	user input). Fixes bug #150676
+
+2004-08-24  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpmessagebox.c: put the icon to the right for RTL
+	layouts.
+
+	* app/display/gimpdisplayshell-close.c
+	* app/gui/quit-dialog.c: use a GimpMessageBox.
+
+2004-08-24  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpmessagebox.[ch]: added API to change the labels.
+	Modeled after the proposed new API for GtkMessageDialog.
+
+	* app/widgets/gimpwidgets-utils.c: changed accordingly.
+
+2004-08-24  DindinX  <david@dindinx.org>
+
+	* app/widgets/gimppreview.c
+	* app/widgets/gimppreview.h: renamed these two files to...
+
+	* app/widgets/gimpview.c
+	* app/widgets/gimpview.h: ... these files.
+
+	Also renamed GimpPreview to GimpView.
+	This is the first step of the great Preview->View renaming process.
+
+	* app/actions/palettes-commands.c
+
+	* app/display/gimpdisplayshell-layer-select.c
+	* app/display/gimpnavigationview.c
+
+	* app/gui/palette-import-dialog.c
+
+	* app/tools/gimppaintoptions-gui.c
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpaction.c
+	* app/widgets/gimpactiongroup.c
+	* app/widgets/gimpbrusheditor.c
+	* app/widgets/gimpbufferview.c
+	* app/widgets/gimpcontainerbox.c
+	* app/widgets/gimpcontainergridview.c
+	* app/widgets/gimpcontainergridview.h
+	* app/widgets/gimpdevicestatus.c
+	* app/widgets/gimpdnd.c
+	* app/widgets/gimpdockbook.c
+	* app/widgets/gimpfiledialog.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimpnavigationpreview.c
+	* app/widgets/gimpnavigationpreview.h
+	* app/widgets/gimppaletteeditor.c
+	* app/widgets/gimppreview-popup.c
+	* app/widgets/gimppropwidgets.c
+	* app/widgets/gimpselectioneditor.c
+	* app/widgets/gimpthumbbox.c
+	* app/widgets/gimptoolbox-image-area.c
+	* app/widgets/gimptoolbox-indicator-area.c
+	* app/widgets/gimptooloptionseditor.c
+	* app/widgets/gimpviewabledialog.c
+	* app/widgets/widgets-types.h: changed accordingly.
+
+2004-08-24  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox.
+
+	* app/widgets/gimpwidgets-utils.c: use it for message dialogs.
+
+2004-08-23  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
+	the filename if gtk_file_chooser_set_uri() failed.
+
+	* app/actions/file-commands.c
+	* app/gui/file-save-dialog.c: trivial cleanups.
+
+	* app/widgets/gimpwidgets-utils.c: removed an unused extern
+	variable declaration.
+
+2004-08-23  DindinX  <david@dindinx.org>
+
+	* app/tools/tools-utils.c: fixed a typo that broke the build.
+
+2004-08-22  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/Makefile.am
+	* app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(),
+
+	* app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain().
+
+	* app/tools/gimppainttool.c: changed accordingly.
+
+	* app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain()
+	instead of duplicating that functionality.
+
+	* app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain()
+	instead of implementing completely different constraints.
+
+2004-08-22  Simon Budig  <simon@gimp.org>
+
+	* app/vectors/gimpbezierstroke.c: Implemented the ellipse basic
+	shape differently to avoid possible rounding issues with
+	the _arcto () command.
+
+	* app/vectors/gimpvectors-import.c: properly close the rounded
+	rectangles.
+
+2004-08-21  Sven Neumann  <sven@gimp.org>
+
+	* app/vectors/gimpvectors-import.c (parse_svg_transform): support
+	optional center coordinates for the "rotate" transformations.
+	(parse_svg_transform): apply transformations in reverse order. The
+	SVG spec is rather confusing here.
+
+2004-08-21  Sven Neumann  <sven@gimp.org>
+
+	* app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed
+	a bug I introduced with my last commit.
+
+	* app/vectors/gimpvectors-import.c: added support for the basic
+	SVG shape "rect". Fixed handling of SVG lengths in basic shapes.
+
+2004-08-21  Sven Neumann  <sven@gimp.org>
+
+	* app/vectors/gimpbezierstroke.[ch]: added new function
+	gimp_bezier_stroke_new_ellipse() that provides a simple API to
+	create a bezier stroke that represents an ellipse.
+
+	* app/vectors/gimpvectors-import.c: added support for the basic
+	SVG shapes "circle" and "ellipse".
+
+2004-08-21  Simon Budig  <simon@gimp.org>
+
+	* plug-ins/common/gih.c: Fix some GUI issues. Make the relation
+	between the dimension parameter and the rank thingies more clear
+	also changed to a nicer layout.
+
+2004-08-21  Sven Neumann  <sven@gimp.org>
+
+	* app/vectors/gimpvectors-import.c: added support for the basic
+	SVG shapes "polyline" and "polygon".
+
+2004-08-21  Sven Neumann  <sven@gimp.org>
+
+	* app/vectors/gimpvectors-import.c: added support for importing
+	the basic SVG shape "line". Other shapes will follow...
+
+2004-08-21  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/layers-actions.[ch]
+	* app/actions/layers-commands.[ch]
+	* app/widgets/gimplayertreeview.c: added actions to handle layer
+	masks as suggested in bug #150446.
+
+	* menus/layers-menu.xml: added menu entries for new actions,
+	commented out raise/lower menu entries.
+
+2004-08-20  Sven Neumann  <sven@gimp.org>
+
+	* modules/controller_linux_input.c: declare local function as static.
+
+2004-08-19  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* plug-ins/common/guillotine.c: modified the coordinate insertion
+	into the file name to leave the file extension intact, changed the
+	format of the coordinates. Fixes bug #101901.
+
+2004-08-18  Manish Singh  <yosh@gimp.org>
+
+	* app/widgets/gimpcellrendereraccel.c
+	* app/widgets/gimphistogrambox.c
+	* plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts.
+
+2004-08-18  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/color-notebook.c: no need to set a size_request here.
+
+	* libgimpwidgets/gimpcolorselection.c: HIG-ified spacings.
+
+	* libgimpwidgets/gimpcolorscales.c
+	* modules/colorsel_cmyk.c: don't set a minimum width on the color
+	scales. Improves behaviour for narrow color dockables.
+
+2004-08-18  Sven Neumann  <sven@gimp.org>
+
+	* modules/colorsel_triangle.c: fixed crashes that occured with
+	small sizes, some code cleanups and a simple optimization.
+
+2004-08-18  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR.
+
+	* app/widgets/gimpdock.c
+	* app/widgets/gimpdockable.c: help-ids are never used directly,
+	use the defines from app/widgets/gimphelp-ids.h instead.
+
+2004-08-17  Simon Budig  <simon@gimp.org>
+
+	* modules/colorsel_triangle.c: Made the triangle colorselector
+	resizeable. Removed minimum size request (would probably need some
+	testing for *very* small sizes though).
+
+2004-08-17  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/widgets/gimpdock.c
+	* app/widgets/gimpdockable.c: add help-ids.
+
+2004-08-17  Sven Neumann  <sven@gimp.org>
+
+	* app/plug-in/plug-in-progress.c (plug_in_progress_start): reset
+	the "cancel" signal handler id when a new progress is set.
+
+2004-08-17  Sven Neumann  <sven@gimp.org>
+
+	* modules/colorsel_cmyk.c: minor cleanups.
+
+	* modules/colorsel_water.c: let the widget take the available
+	space, don't set a minimum size.
+
+2004-08-17  Sven Neumann  <sven@gimp.org>
+
+	* app/plug-in/plug-in-progress.c
+	* app/plug-in/plug-in-run.c
+	* app/plug-in/plug-in.c: don't keep a strong reference to the
+	GimpProgress object, instead use a weak reference and deal with
+	the progress being destroyed while the plug-in is running.
+	Fixes bug #150194.
+
+2004-08-16  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed
+	labels in CMYK mode. Fixes bug #150213.
+
+2004-08-16  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/iwarp.c: fixed a typo preventing the preview to be
+	redrawn correctly in some case. Reported by AndyFitz.
+
+2004-08-15  Sven Neumann  <sven@gimp.org>
+
+	* modules/colorsel_triangle.c: minor cleanups.
+
+	* modules/colorsel_water.c: GimpPreviewArea seems like overkill
+	here, use a GtkDrawingArea instead.
+
+2004-08-15  DindinX  <david@dindinx.org>
+
+	* modules/colorsel_triangle.c
+	* modules/colorsel_water.c: Replaced the GtkPreviews by
+	GimpPreviewAreas.
+
+2004-08-14  Manish Singh  <yosh@gimp.org>
+
+	* libgimpbase/gimpprotocol.c (_gp_params_read): make sure array
+	length values are not negative, to prevent bad calls to g_new.
+	Addresses bug #150154.
+
+2004-08-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/help/Makefile.am: no need to link gimp-help-lookup with
+	any GIMP libraries.
+
+	* plug-ins/help/domain.[ch]: allow to specify the location of the
+	index files independently from the base URL.
+
+	* plug-ins/help/help.c: changed accordingly.
+
+	* plug-ins/help/gimp-help-lookup.c: added command-line options to
+	specify base URI and root directory for index files.
+
+2004-08-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/help/locales.c (locales_parse): don't mess up the order
+	of languages.
+
+	* plug-ins/help/gimp-help-lookup.c: parse command-line options,
+	added --help output.
+
+2004-08-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/help/help.[ch]: moved some defines to the header file.
+
+	* plug-ins/help/domain.c: trivial change to remove the libgimpbase
+	dependency.
+
+	* plug-ins/help/Makefile.am
+	* plug-ins/help/gimp-help-lookup.c: added a very simple
+	command-line tool that allows to lookup a help-id.
+
+2004-08-13  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/edge.c: update the preview when the user choose a
+	different algorithm from the combo box. This was one of the main
+	reasons to have a preview here, after all.
+
+2004-08-13  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/edge.c (edge_dialog): use a combo box instead of
+	too many radio buttons.
+
+2004-08-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new):
+	make sure that all actions, even if they have no menu proxy, can
+	be invoked by their accelerators. Fixes bug #149938.
+
+	* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
+	removed the same code here.
+
+	* app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new
+	function which disconnects from "accel_changed" of the accel_group
+	before upchaining (== before emitting "destroy").
+
+	The above changes make this one redundant, but since the crash in
+	bug #149938 was triggered by "accel_changed" emitted in the middle
+	of g_object_unref(tree_model), it feels better to be paranoic here
+	(fiddling with objects in destruction is no fun).
+
+	(gimp_action_view_accel_edited): don't warn if assigning the same
+	accel to the same action again.
+
+	(gimp_action_view_new): don't leak all accel_closures.
+
+2004-08-12  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/edge.c: added a preview.
+
+2004-08-12  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/sel_gauss.c
+	* plug-ins/common/unsharp.c: place the preview widget into the
+	upper left corner like all other plug-ins do.
+
+	* plug-ins/help/domain.c: added some (disabled) debug output.
+
+2004-08-12  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/sel_gauss.c: added a preview.
+
+	* plug-ins/common/unsharp.c: removed unused variables.
+
+2004-08-12  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/context-actions.c: changed the icons to indicate
+	what part of the context is affected by the action. Looks better
+	in the shortcut editor.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/cartoon.c
+	* plug-ins/common/neon.c
+	* plug-ins/common/photocopy.c
+	* plug-ins/common/softglow.c: added four new plug-ins contributed
+	by Spencer Kimball. Ported them from 1.2 to 2.1 APIs.
+
+	* plug-ins/common/plugin-defs.pl: added them here.
+
+	* plug-ins/common/mkgen.pl: removed tab insanity now that
+	libgimpoldpreview is gone.
+
+	* plug-ins/common/.cvsignore
+	* plug-ins/common/Makefile.am: regenerated.
+
+2004-08-11  DindinX  <david@dindinx.org>
+
+	Bad DindinX! Don't break the build!
+
+	* configure.in
+	* plug-ins/common/mkgen.pl
+	* plug-ins/common/plugin-defs.pl: removed libgimpoldpreview from
+	here too.
+
+	* plug-ins/common/Makefile.am: regenerated.
+
+2004-08-11  DindinX  <david@dindinx.org>
+
+	Removed the GimpOldPreview stuff. Die, crap, die!
+
+	* plug-ins/libgimpoldpreview/*: removed.
+
+	* plug-ins/Makefile.am
+	* plug-ins/common/Makefile.am: changed accordingly.
+
+	* plug-ins/common/max_rgb.c
+	* plug-ins/common/noisify.c
+	* plug-ins/common/tileit.c: removed last forgotten
+	#include "libgimpoldpreview.h".
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainercombobox.[ch]
+	* app/widgets/gimpcontainertreeview.c: when removing the last item
+	from the view, manually clear all GimpCellRendererViewables'
+	"renderer" properties; otherwise we have stale GimpPreviewRenderers
+	with still-refed viewables hanging around in the cells.
+	Works around GTK+ bug #149906.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp.c
+	* app/core/gimpimagefile.c: converted tabs to spaces, cosmetic
+	changes.
+
+2004-08-11  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/waves.c: GimpPreviewArea-ified.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	Restored sane sorting order for menus which are created
+	entirely by plug-ins (like Xtns/Script-Fu/...).
+
+	* app/menus/plug-in-menus.c (plug_in_menus_build_path): made it
+	return the built path. For each sub-menu created, add a "Menus"
+	placeholder and a separator. Make sure all sub-menus end up in the
+	"Menus" placeholder. More readable because we can use the path
+	returned by the recursive invocation now.
+
+	(plug_in_menus_add_proc): simplified by using the path
+	plug_in_menus_build_path() returns.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpprogress.[ch]: added virtual function
+	gboolean GimpProgressInterface::is_active().
+
+	* app/display/gimpdisplay.c
+	* app/display/gimpstatusbar.c
+	* app/widgets/gimpfiledialog.c
+	* app/widgets/gimpprogressbox.c
+	* app/widgets/gimpprogressdialog.c
+	* app/widgets/gimpthumbbox.c: implement it.
+
+	* app/plug-in/plug-in.h: removed "gboolean progress_active" and
+	added "gulong progress_cancel_id" instead.
+
+	* app/plug-in/plug-in-progress.c: changed accordingly. Make sure
+	we correctly handle the "cancel" connections of progress instances
+	passed from other plug-ins.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-message.c
+	* app/plug-in/plug-in-run.c (plug_in_temp_run)
+	* libgimp/gimp.c (gimp_temp_proc_run): removed ENABLE_TEMP_RETURN
+	#define and all code which was in #ifndef ENABLE_TEMP_RETURN.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp-gui.[ch]: added "display_ID" to gimp_new_progress().
+
+	* app/gui/gui-vtable.c: changed accordingly.
+
+	* app/plug-in/plug-in-progress.[ch]: reenabled showing the
+	progress in a particular display.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* etc/controllerrc: added a commented-out midi controller entry
+	with some example mappings.
+
+2004-08-11  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/plasma.c: converted to GimpPreviewArea.
+
+2004-08-11  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/noisify.c: converted to GimpPreviewArea.  Also added
+	scrollbars to move around.  The preview was rather useless without
+	them.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable-blend.c
+	* app/core/gimpprogress.c: some progress cleanup.
+
+	* app/display/gimpstatusbar.c (gimp_statusbar_progress_start): no
+	need to warn if there is already a progress active, just silently
+	return NULL as all other GimpProgressInterface implementors.
+
+	* app/plug-in/plug-in-progress.c: several progress fixes.
+	It's still a mess.
+
+	* plug-ins/common/url.c: don't show progress depending on
+	run_mode. Run the actual file plug-in with the same run_mode we
+	were invoked with.
+
+2004-08-11  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/file-open-location-dialog.c
+	* app/widgets/gimpprogressbox.c: increased horizontal size request
+	to reduce resizing.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails):
+	fixed annoying resizing when thumbnailing exactly one image.
+
+2004-08-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring
+	a label and a progressbar. Implements GimpProgressIterface.
+
+	* app/widgets/gimpprogressdialog.[ch]: replaced label and progress
+	by a GimpProgressBox. Delegate most progress functionality to it.
+
+	* app/widgets/gimpwidgets-utils.[ch]: factored out utility
+	function gimp_dialog_set_sensitive().
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive):
+	use it.
+
+	* app/gui/file-open-location-dialog.c (file_open_location_response):
+	embed the called file procedure's progress using a GimpProgressBox.
+
+2004-08-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpfiledialog.[ch]
+	(gimp_file_dialog_set_sensitive): new function which works on all
+	widgets in the dialog except the cancel button.
+
+	Remember if the active progress is cancelable and added two
+	booleans "busy" and "canceled". Added GtkDialog::response()
+	implementation which, if the dialog is busy, cancels the active
+	progress and sets the dialog's "canceled" state.
+
+	Moved the progress bar right above the action area so it is next
+	to the cancel button and in the same place for both open and save
+	dialogs.
+
+	* app/gui/file-open-dialog.c
+	* app/gui/file-save-dialog.c: use the new API to make image loading
+	and saving cancelable again.
+
+	* app/widgets/gimpthumbbox.c: use the same stuff to make
+	thumbnailing cancelable. Increased the minimum height a bit so it
+	doesn't resize when the progress bars are shown.
+
+2004-08-10  Michael Natterer  <mitch@gimp.org>
+
+	Redid the whole internal progress stuff: don't pass around
+	progress_callback and progress_data; instead, provide a
+	pointer to a GimpProgressInterface which can be implemented
+	by a variety of backends.
+
+	Addresses (but not yet fixes) bugs #6010, #97266 and #135185.
+
+	* app/display/Makefile.am
+	* app/display/gimpprogress.[ch]: removed the old progress hack.
+
+	* app/core/Makefile.am
+	* app/core/core-types.h
+	* app/core/gimpprogress.[ch]: implement GimpProgressInterface.
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpprogressdialog.[ch]: the standalone progress
+	dialog as widget implementing GimpProgressInterface.
+
+	* app/display/gimpdisplay.c
+	* app/display/gimpstatusbar.[ch]
+	* app/widgets/gimpfiledialog.[ch]
+	* app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface
+	implementation to these classes.
+
+	* app/core/gimp-gui.[ch]
+	* app/gui/gui-vtable.c: replaced the old progress vtable entries
+	by two new to create and destroy a GimpProgressDialog in case
+	no other progress is available.
+
+	* app/pdb/procedural_db.[ch]
+	* app/plug-in/plug-in-run.[ch]
+	* tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and
+	all plug-ins.
+
+	* app/plug-in/plug-in.[ch]
+	* app/plug-in/plug-ins.c
+	* app/plug-in/plug-in-message.c
+	* app/plug-in/plug-in-progress.c: handle the case there the
+	plug-in was crated with a progress as well as the case where it
+	wasn't.
+
+	* app/app_procs.c
+	* app/batch.c
+	* app/xcf/xcf.c
+	* app/file/file-open.[ch]
+	* app/file/file-save.[ch]
+	* app/widgets/gimphelp.c
+	* app/widgets/gimpbrushselect.c
+	* app/widgets/gimpfontselect.c
+	* app/widgets/gimpgradientselect.c
+	* app/widgets/gimppaletteselect.c
+	* app/widgets/gimppatternselect.c: changed accordingly.
+
+	* app/core/gimpimagefile.[ch]
+	* app/display/gimpdisplayshell-dnd.c
+	* app/gui/file-open-dialog.c
+	* app/gui/file-open-location-dialog.c
+	* app/gui/file-save-dialog.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file
+	related functions. Embed the progress in the file dialog where
+	possible.
+
+	* app/core/gimpdrawable-blend.[ch]
+	* app/core/gimpdrawable-transform.[ch]
+	* app/core/gimpimage-convert.[ch]
+	* app/core/gimpimage-flip.[ch]
+	* app/core/gimpimage-resize.[ch]
+	* app/core/gimpimage-rotate.[ch]
+	* app/core/gimpimage-scale.[ch]
+	* app/core/gimpitem-linked.[ch]
+	* app/core/gimpitem.[ch]
+	* app/core/gimpchannel.c
+	* app/core/gimpdrawable.c
+	* app/core/gimplayer.c
+	* app/core/gimpselection.c
+	* app/vectors/gimpvectors.c: replaced callback/data by GimpProgress.
+
+	* app/tools/gimpblendtool.c
+	* app/tools/gimptransformtool.c
+	* app/gui/convert-dialog.c
+	* app/actions/documents-commands.c
+	* app/actions/file-commands.c
+	* app/actions/image-commands.c
+	* app/actions/layers-commands.c
+	* app/actions/plug-in-commands.c
+	* app/actions/vectors-commands.c
+	* tools/pdbgen/pdb/convert.pdb
+	* tools/pdbgen/pdb/edit.pdb
+	* tools/pdbgen/pdb/image.pdb
+	* tools/pdbgen/pdb/layer.pdb: changed callers accordingly.
+
+	* app/pdb/*_cmds.c: regenerated.
+
+2004-08-10  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/blinds.c: GimpPreviewArea-ified.
+
+2004-08-10  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/AlienMap2.c: Ported to GimpPreviewArea, use an enum
+	for the color model instead of some defines and use gboolean instead
+	of gint where appropriate.
+
+2004-08-10  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpbrushgenerated.c (gimp_brush_generated_load):
+	plugged more file descriptor leaks.
+
+2004-08-10  DindinX  <david@dindinx.org>
+
+	* app/core/gimpbrushgenerated.c: don't leak a file descriptor when
+	reading a bad .vbr file.
+
+2004-08-10  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/unsharp.c: don't show progress on the image
+	window while updating the preview.
+
+2004-08-09  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/unsharp.c (unsharp_region): reset the progress
+	when done; some code cleanup.
+
+2004-08-09  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/unsharp.c: continuously show the (original) image
+	during a scrollbar movement.  This makes it easier to navigate.
+
+2004-08-09  Michael Natterer  <mitch@gimp.org>
+
+	Applied (slightly modified) patch from Shlomi Fish which adds a
+	progress bar to the RGB -> INDEXED conversion. Fixes bug #145274
+	and shows that we really really need a GimpProgressInterface in
+	the core to give progress users full access to the progress API.
+
+	* app/core/gimpimage-convert.[ch]: added special
+	GimpImageConvertProgress function typedef to cope with the
+	different stages of converting.  Support passing such a callback &
+	data to gimp_image_convert() and update the progress accordingly.
+
+	* app/gui/convert-dialog.[ch]: added a convert progress callback
+	and pass it to gimp_image_convert().
+
+	* app/actions/image-commands.c
+	* tools/pdbgen/pdb/convert.pdb: changed accordingly.
+
+	* app/pdb/convert_cmds.c: regenerated.
+
+2004-08-09  Sven Neumann  <sven@gimp.org>
+
+	* data/misc/gimp.desktop.in.in: added GenericName and Version,
+	updated Categories.
+
+2004-08-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-ins.c
+	(plug_ins_file_register_magic)
+	(plug_ins_file_register_mime): don't dereference
+	gimp->current_plug_in->plug_in_def if it's NULL.
+	Fixes bug #149678.
+
+	(plug_ins_file_register_mime): moved returning the proc_def inside
+	the right if() statement.
+
+2004-08-09  Hans Breuer  <hans@breuer.org>
+
+	* app/core/gimp-edit.c (gimp_edit_paste_as_new):
+	gimp_create_display() with the right parameters order
+
+	* app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons)
+	handle gtk_style_lookup_icon_set() returnig NULL
+
+	* app/gimpcore.def app/widgets/makefile.msc
+	  themes/default/images/makefile.msc : updated
+
+2004-08-09  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/postscript.c (save_ps_header): use the basename
+	as Title, not the full filename. Fixes bug #149669.
+
+2004-08-08  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/siod/sliba.c (array_prin1): when printing a
+	character array, don't flush the buffer for each byte but wait
+	until it is filled.
+
+2004-08-08  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/siod-wrapper.[ch] (siod_output_string): use
+	g_strdup_vprintf() instead of guessing the string length. Also
+	declare the function using G_GNUC_PRINTF().
+
+2004-08-08  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/ifscompose/README.ifscompose: fix out of date info,
+	pointed out by the author.
+
+2004-08-08  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/Makefile.am: do not build test-preview-area by
+	default, put it into EXTRA_PROGRAMS. Fixes parallel builds.
+
+2004-08-08  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_sensitive):
+	new function which checks a GimpImageType against the
+	proc_def->image_types_val mask.
+
+	* app/actions/plug-in-actions.c: use the new function here. Also
+	separated setting the "Repeat last" and "Reshow last" actions'
+	labels from setting their sensitivity and made them use the same
+	sensitivity logic as all other plug-in actions. Fixes bug #149567.
+
+2004-08-07  Simon Budig  <simon@gimp.org>
+
+	* libgimpwidgets/gimpcolorscales.c: emit the COLOR_CHANGED signal
+	when the hex entry is changed.
+
+2004-08-07  Sven Neumann  <sven@gimp.org>
+
+	* app/sanity.c: abort if the configured filename encoding can't be
+	converted to UTF-8. Fixes bug #149464 for the HEAD branch.
+
+2004-08-07  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpgradientmenu.c (gimp_gradient_select_preview_expose):
+	corrected dither offset.
+
+2004-08-07  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/max_rgb.c: use a GimpPreviewArea instead of
+	GimpOldPreview.
+
+2004-08-07  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpgradientmenu.c: use a GtkDrawingArea instead of
+	GtkPreview.
+
+	* libgimp/gimpbrushmenu.c
+	* libgimp/gimppatternmenu.c: minor cleanup.
+
+2004-08-07  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/jigsaw.c: ported to GimpPreviewArea, did some
+	cleanup and removed tabs.
+
+2004-08-07  Sven Neumann  <sven@gimp.org>
+
+	* configure.in:  bumped version number to 2.1.4.
+
+2004-08-07  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/illusion.c: ported to GimpPreviewArea.
+
+2004-08-07  DindinX  <david@dindinx.org>
+
+	* libgimpwidgets/gimppreviewarea.c: fixed the rendering for INDEXED
+	and INDEXEDA image types.
+
+	* plug-ins/common/grid.c: ported to GimpPreviewArea.
+
+2004-08-06  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/glasstile.c: ported to GimpPreviewArea.
+
+2004-08-06  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/nlfilt.c: ported to GimpPreviewArea.
+
+2004-08-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimptransformtool.h: removed the recently added
+	"gdouble aspect_ratio"...
+
+	* app/tools/gimpscaletool.[ch]: ...and added it where it belongs.
+
+2004-08-06  Michael Natterer  <mitch@gimp.org>
+
+	Transform tool cleanup:
+
+	* app/tools/gimptransformtool.[ch]: added new virtual function
+	GimpTransformTool::dialog_update().
+	Made wrapper for ::recalc() public and function
+	transform_bounding_box() private.
+	Call ::dialog_update() and transform_bounding_box() from the
+	::recalc() wrapper.
+
+	* app/tools/gimpperspectivetool.[ch]
+	* app/tools/gimprotatetool.[ch]
+	* app/tools/gimpscaletool.[ch]
+	* app/tools/gimpsheartool.[ch]: turned all info_dialog update
+	functions into GimpTransformTool::dialog_update() implementations
+	and don't call them from ::recalc(), also removed calls to
+	transform_bounding_box(); both functions are called by the parent
+	class now. Call gimp_transform_tool_recalc() when dialog values
+	were changed, not the tool's internal function.
+	Moved all static variables to the instance structs.
+
+2004-08-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari
+	Pollak which enables controlling the shear direction from the
+	dialog and changing the shear direction without hitting "Reset".
+	Fixes bug #149467.
+
+	Also moved all static variables to the GimpShearTool struct and
+	converted tabs to spaces.
+
+2004-08-06  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/nova.c: ported to GimpPreviewArea.
+
+2004-08-06  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.1.3 release.
+
+2004-08-06  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/polar.c: ported to GimpPreviewArea (from
+	GimpOldPreview).
+
+2004-08-06  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/test-color-parser.c: include <glib-object.h>.
+
+2004-08-06  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/depthmerge.c:
+	* plug-ins/common/despeckle.c: removed unused variables.
+
+2004-08-06  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/flarefx.c: ported to GimpPreviewArea (from
+	GimpOldPreview)
+
+2004-08-06  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/twain/Makefile.am (EXTRA_DIST): forgot to remove
+	tw_sess.c here.
+
+2004-08-05  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/wind.c: ported to GimpPreviewArea (from
+	GimpOldPreview)
+
+2004-08-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpiscissorstool.c: increased the handle size from 8
+	to 9 pixels (which is the same as in the path tool) as suggested
+	in bug #134250.
+
+2004-08-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpstatusbar.c: make the cursor coordinates label
+	insensitive when displaying out-of-image coordinates.
+
+2004-08-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/config/gimprc-blurbs.h (INSTALL_COLORMAP_BLURB):
+	s/pseudocolor visuals/8-bit (256 colors) displays/.
+	Fixes bug #137078.
+
+2004-08-05  Michael Natterer  <mitch@gimp.org>
+
+	Enabled previewing items without selecting them in all list and
+	grid views using mouse button 2. Implicitly enables previewing of
+	items in container popups and thus fixes bug #121011:
+
+	* app/widgets/gimppreview.c (gimp_preview_button_press_event)
+	* app/widgets/gimpcellrendererviewable.c
+	(gimp_cell_renderer_viewable_clicked): show the preview also on
+	mouse button 2 click.
+
+	* app/widgets/gimpcontainertreeview.c
+	(gimp_container_tree_view_button_press): dispatch mouse button 2
+	clicks to GimpCellRendererViewable, but don't select or change
+	anything in the tree_view.
+
+	Unrelated cleanup:
+
+	* app/widgets/gimppreview.c (gimp_preview_button_press_event):
+	don't offset bevent->x,y by widget->allocation.x,y before calling
+	gimp_preview_popup_show() ...
+
+	* app/widgets/gimppreview-popup.c (gimp_preview_popup_show):
+	... instead, do it here generically (check if the parent widget is
+	GTK_WIDGET_NO_WINDOW()).
+
+2004-08-05  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpintstore.c (gimp_int_store_add_empty):
+	allocate the empty_iter using g_new0(). Fixes valgrind warnings
+	about reads from uninitialized memory.
+
+2004-08-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/context-actions.c: use GTK_STOCK_JUMP_TO for
+	all "Set" actions (like context-foreground-red-set).
+
+2004-08-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpscaletool.c
+	* app/tools/gimptransformtool.h: applied patch from Jordi Gay
+	(attached to bug #131111) which adds an aspect ratio spinbutton to
+	the scale dialog and keeps the aspect ratio intact when width or
+	height are changed using the dialog. Fixes bug #132274.
+
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpscaletool.c: don't set the aspect spinbuttons to
+	"wrap" and decrease their climb_rate.
+
+2004-08-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/context-actions.c
+	* app/actions/context-commands.[ch]
+	* menus/image-menu.xml.in: added actions, callbacks and menu items
+	for the brush shape and spikes.
+
+2004-08-04  Simon Budig  <simon@gimp.org>
+
+	* plug-ins/common/grid.c: changed the default colors for the
+	first invocation to the current foregroud color which is more
+	likely to be useful than the blue shades.
+
+2004-08-04  Sven Neumann  <sven@gimp.org>
+
+	* themes/Default/images/Makefile.am
+	* themes/Default/images/stock-brush-generated-*-16.png: removed ...
+
+	* themes/Default/images/stock-shape-*-16.png: ... and added back
+	with more generic names.
+
+	* libgimpwidgets/gimpstock.[ch]
+	* app/widgets/gimpbrusheditor.c: changed accordingly.
+
+	* app/tools/gimpinkoptions-gui.c: use the new stock icons here as
+	well.
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpblobeditor.[ch]: added a simple blob shape
+	editor widget factored out of app/tools/gimpinkoptions-gui.c.
+
+2004-08-04  Simon Budig  <simon@gimp.org>
+
+	* app/core/gimpbrushgenerated.c: Enhanced the range of the hardness
+	parameter to make more soft brushes possible. Please note that this
+	makes existing generated brushes look more soft. But since people
+	apparently rarely use more than one or two generated brushes and
+	these get changed frequently I guess it should be OK.
+
+2004-08-04  Michael Natterer  <mitch@gimp.org>
+
+	Allow URI drops from apps linked against GLib < 2.4.4 to GIMP
+	linked against GLib >= 2.4.5. Fixes bug #148140.
+
+	* app/core/gimp-utils.[ch]: added gimp_check_glib_version().
+
+	* app/widgets/gimpselectiondata.c: added runtime check for GLib
+	versions that encode file:// URIs correctly (>= 2.4.5). For older
+	(broken) GLibs, leave the code path as is, for newer (fixed) ones,
+	perform an additional check if the dropped URI is in the (broken)
+	escaped-UTF-8 format and convert it to local filename encoding.
+
+	* app/gui/gui.c: warn the user that non-ASCII filenames can't
+	be used when linked against GLib 2.4.4.
+
+2004-08-04  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp.[ch]: changed member "ProcRecord *last_plug_in"
+	to "PlugInProcDef *last_plug_in". Added function
+	gimp_set_last_plug_in() and signal Gimp::last-plug-in-changed.
+
+	* app/actions/plug-in-commands.c
+	* app/plug-in/plug-in-run.c: changed accordingly.
+
+	* app/actions/plug-in-actions.c: factored out updating of the
+	"Reshow Last" and "Rerun Last" actions to a private function.
+	Connect each "plug-in" action group to Gimp::last-plug-in-changed
+	and update the actions' label and sensitivity in the
+	callback. Fixes bug #149139.
+
+2004-08-04  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h"
+
+2004-08-04  Manish Singh  <yosh@gimp.org>
+
+	* configure.in: Really really really really fix WINDRES logic.
+
+2004-08-03  DindinX  <david@dindinx.org>
+
+	* plug-ins/winicon/icodialog.c: ported to GimpPreviewArea. Still needs
+	work.
+
+2004-08-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainergridview.c
+	(gimp_container_grid_view_item_context): ref/unref the view around
+	the calls to gimp_container_view_item_selected() and _item_context()
+	because the former may destroy the view which leads to a crash
+	when trying the latter. Fixes bug #148955.
+
+2004-08-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress):
+	new function which checks if undo compression is possible:
+
+	(1) is the image dirty? Fixes bug #148853.
+	(2) is redo stack empty?
+	(3) do both the passed undo object_type and undo_type
+	    match the top undo item?
+
+	Consistently name the GType and GimpUndoType passed to undo
+	functions "object_type" and "undo_type" to avoid confusion.
+
+	* app/actions/layers-commands.c
+	* app/tools/gimpeditselectiontool.c
+	* app/tools/gimptexttool.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimplayertreeview.c: use the new utility function
+	instead of checking the above conditions manually.
+
+2004-08-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpbrushgenerated.c (gimp_brush_generated_load): don't
+	leak the brush's name if parsing the shape fails.
+
+	(gimp_brush_generated_dirty): shut up bogus compiler warnings
+	about uninitialized variables.
+
+2004-08-03  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/imagemap/imap_preview.c
+	* plug-ins/imagemap/imap_preview.h: ported to GimpPreviewArea.
+
+2004-08-03  DindinX  <david@dindinx.org>
+
+	* plug-ins/ifscompose/ifscompose.c: ported to GimpPreviewArea.
+
+2004-08-03  DindinX  <david@dindinx.org>
+
+	* plug-ins/fp/fp.c: converted to GimpPreviewArea.
+
+2004-08-03  DindinX  <david@dindinx.org>
+
+	* plug-ins/rcm/rcm_callback.c
+	* plug-ins/rcm/rcm_dialog.c
+	* plug-ins/rcm/rcm_misc.c: Ported to GimpPreviewArea.
+
+2004-08-02  Simon Budig  <simon@gimp.org>
+
+	* app/widgets/gimpbrusheditor.c: Fixed brush spacing for brushes
+	with >= 2 spikes. Spotted by Joao S. O. Bueno.
+
+	Fixes bug #149099.
+
+2004-08-02  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/whirlpinch.c: ported to GimpPreviewArea.
+
+2004-08-02  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/video.c: ported to GimpPreviewArea.
+
+2004-08-02  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/unsharp.c: ported to GimpPreviewArea. Centered the
+	preview, too.
+
+2004-08-01  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/tileit.c: ported to GimpPreviewArea.
+
+2004-08-01  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/sinus.c: ported to GimpPreviewArea.
+
+2004-08-01  Manish Singh  <yosh@gimp.org>
+
+	* configure.in: Really really really fix WINDRES logic.
+
+2004-08-01  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/mkgen.pl: update install-% rule to match newer
+	libtool commands.
+
+	* plug-ins/common/Makefile.am: regenerated.
+
+2004-08-01  Manish Singh  <yosh@gimp.org>
+
+	* configure.in: Really really fix WINDRES logic.
+
+2004-08-01  Manish Singh  <yosh@gimp.org>
+
+	* configure.in: Really fix WINDRES logic.
+
+2004-08-01  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/scatter_hsv.c: ported to GimpPreviewArea.
+
+2004-08-01  Hans Breuer  <hans@breuer.org>
+
+	* app/display/makefile.msc app/widgets/makefile.msc : build
+	but *dont link* display-enums.obj, widget-enums.obj and
+	gimpdisplayoptions.obj. They must be in the dll
+	* app/makefile.msc : build gimp.exe and gimp-console.exe both
+	using the same gimp-core.dll
+	* app/gimpcore.def : new file, exports for gimp-core.dll
+	* app/Makefile.am : added to EXTRA_DIST
+
+	* cursors/makefile.msc : new file to create gimp-tool-cursors.h
+	* cursors/Makefile.am : added to EXTRA_DIST
+
+	* **/makefile.msc : updated
+
+	* app/main.c app/app_procs.c : moved code to close the console
+	from the former to the later. It only is to be used if The Gimp
+	is not build as console app.
+
+	* plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same
+	drawable twice
+	* plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid
+	crashing on File/Import
+
+2004-08-01  Simon Budig  <simon@gimp.org>
+
+	* app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially
+	reset the number of spikes to 2.
+
+2004-08-01  Simon Budig  <simon@gimp.org>
+
+	* app/core/gimpbrushgenerated.[ch]: Added optional spikes for
+	the generated brushes, enabling star shaped generated brushes.
+
+	* app/widgets/gimpbrusheditor.[ch]: GUI for this.
+
+	* app/core/gimpbrush.c: changed accordingly.
+
+2004-08-01  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/mapcolor.c
+	* plug-ins/common/sample_colorize.c: ported to GimpPreviewArea.
+
+	* plug-ins/common/newsprint.c: ported to GimpPreviewArea, even though
+	it should use some pngs instead.
+
+2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* configure.in: modified the checks. hopefully it works on all
+	platforms this time.
+
+2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* configure.in: move an AM_CONDITIONAL out of an if block
+
+2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* configure.in: added checks for windres. Fixes bug #148443
+	together with my last commit.
+
+2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* app/Makefile.am: added checks and rules to build and link the
+	win32 icon resource if the resource compiler windres is found by
+	configure. First part of a fix for bug #148443.
+
+2004-08-01  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* libgimpwidgets/gimpwidgets.def: added gimp_preview_area_fill
+
+2004-08-01  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/flame/flame.c: ported to GimpPreviewArea.
+
+2004-08-01  Simon Budig  <simon@gimp.org>
+
+	* app/core/core-enums.h
+	* app/core/gimpbrushgenerated.[ch]: Implement three different
+	brush shapes for generated brushes.
+
+	* app/core/gimpbrush.c: changed accordingly.
+	* app/core/core-enums.c: regenerated.
+
+	* app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape.
+	* themes/Default/images/stock-brush-generated-*-16.png: New stock
+	icons for the brush shapes.
+
+	* themes/Default/images/Makefile.am
+	* libgimpwidgets/gimpstock.[ch]: changed accordingly
+
+	untabified the files touched.
+
+2004-08-01  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/iwarp.c: ported to GimpPreviewArea.
+
+2004-07-31  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/gqbist.c: ported to GimpPreviewArea.
+
+2004-07-31  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/fractaltrace.c: ported to GimpPreviewArea.
+
+2004-07-31  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/exchange.c: ported to GimpPreviewArea.
+
+2004-07-31  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/emboss.c: ported to GimpPreviewArea.
+
+2004-07-31  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/diffraction.c: ported to GimpPreviewArea.
+
+2004-07-31  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/despeckle.c: use even more GimpPreviewArea's
+	facilities.
+
+	* plug-ins/common/destripe.c: ported to GimpPreviewArea.
+
+2004-07-31  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gflare/gflare.c: ported to GimpPreviewArea.
+
+2004-07-31  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/despeckle.c: ported to GimpPreviewArea.
+
+2004-07-31  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/brush.c
+	* plug-ins/gimpressionist/orientmap.c
+	* plug-ins/gimpressionist/paper.c
+	* plug-ins/gimpressionist/preview.c
+	* plug-ins/gimpressionist/size.c:
+	Converted the code from using GtkPreview to GimpPreviewArea.
+
+2004-07-30  Seth Burgess  <sjburges@gimp.org>
+
+	* plug-ins/common/gauss.c: added some non-interactive modes (if called
+	from the pdb with RUN_INTERACTIVE).
+
+2004-07-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpcolorselect.c: minor cleanup.
+
+2004-07-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimppatternmenu.c: ported to GimpPreviewArea.
+
+	* libgimp/gimpbrushmenu.c: some small changes for consistency.
+
+2004-07-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.[ch]: added new function
+	gimp_preview_area_fill().
+
+	* libgimpwidgets/test-preview-area.c: added a test for new function.
+
+	* libgimp/gimpbrushmenu.c: ported to GimpPreviewArea.
+
+2004-07-31  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/depthmerge.c: use a GimpPreviewArea instead of a
+	GtkPreview. Some code cleanup, too.
+
+2004-07-31  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpmenu.c (gimp_menu_make_preview): use a GtkImage and
+	a GdkPixbuf instead of the deprecated GtkPreview widget.
+
+2004-07-30  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/curve_bend.c: Use a GimpPreviewArea instead of
+	GtkPreview.
+
+2004-07-30  Sven Neumann  <sven@gimp.org>
+
+	Applied a bunch of small changes contributed by Tim Mooney to fix
+	stack corruption on Tru64 and Aix (bug #129867).
+
+	* app/Makefile.am
+	* plug-ins/script-fu/Makefile.am: changed the dependency order so
+	that $(REGEXREPL) is linked earlier.
+
+	* regexrepl/regex.[ch]: fixed check for __STDC__, merged upstream
+	fix for re_max_failures value.
+
+2004-07-30  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: always do the check for perl and use the
+	substituted perl executable name in the call for gimp-mkenums.
+	Fixes the build on platforms where perl is not available as
+	/usr/bin/perl. Closes bug #148813.
+
+	* app/widgets/gimpenumstore.c: added missing include.
+
+2004-07-30  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/channel_mixer.c: GtkPreview->GtkDrawingArea, plus
+	some minor code cleanups.
+
+2004-07-30  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/CML_explorer.c: Transformed one GtkPreview to a
+	GimpPreviewArea and the other to a simple GtkDrawingArea, since this
+	makes the code simpler.
+
+2004-07-30  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
+	corrected a typo causing mayhem in previews of non-alpha grayscale
+	images. Fixes bug #148873.
+
+2004-07-30  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/ccanalyze.c (fillPreview): optimized preview
+	filling a little bit, removed trailing whitespace.
+
+2004-07-30  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/ccanalyze.c: converted to use a GimpPreviewArea,
+	and some small cleanups (g_malloc to g_new, removing tabs)
+
+2004-07-30  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw):
+	optimized alpha blending.
+
+2004-07-30  Sven Neumann  <sven@gimp.org>
+
+	Applied a bunch of AIX portability fixes (bug #148813):
+
+	* configure.in: when testing for Xmu library, link with -lXt -lX11.
+
+	* app/gui/tips-parser.c
+	* app/gui/user-install-dialog.c
+	* app/tools/tools-enums.h
+	* app/widgets/gimpdasheditor.c
+	* app/widgets/widgets-enums.h
+	* libgimpthumb/gimpthumb-error.h
+	* libgimpwidgets/gimpcolorbutton.c
+	* plug-ins/common/edge.c: removed trailing commas from enums.
+
+	* plug-ins/common/snoise.c: renamed defines to avoid collision
+	with system headers.
+
+	* plug-ins/imagemap/imap_cmd_move.c: no C++ style comments.
+
+	* app/paint-funcs/paint-funcs-generic.h
+	* app/paint-funcs/paint-funcs.c: use integers for bit fields.
+
+2004-07-30  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/bumpmap.c: removed preview code that isn't used
+	any longer.
+
+2004-07-30  DindinX  <david@dindinx.org>
+
+	* plug-ins/common/bumpmap.c: use GimpPreviewArea instead of
+	GtkPreview (which leads to much simpler code)
+
+2004-07-29  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppreviewarea.c: only invalidate the buffer
+	on size_allocate; allocate a new one on the next call to
+	gimp_preview_area_draw(). Fixed buffer offset in expose method.
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/test-preview-area.c: more a benchmark than a
+	test; quite similar to testrgb from the GTK+ source tree.
+
+2004-07-29  DindinX  <david@dindinx.org>
+
+	* plug-ins/FractalExplorer/Dialogs.c: converted all GtkPreview
+	widgets to GimpPreviewArea.
+
+2004-07-29  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpmodule/gimpmoduledb.c: converted tabs to spaces, removed
+	unused #if 0'ed prototype and unused #includes, minor cleanups.
+
+2004-07-29  Shlomi Fish <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/*.[ch]: normalized the names of the fields
+	of gimpressionist_vals_t.
+
+2004-07-29  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgets.def
+	* libgimpwidgets/gimpwidgets.h
+	* libgimpwidgets/gimpwidgetstypes.h
+	* libgimpwidgets/gimppreviewarea.[ch]: added GimpPreviewArea, a
+	replacement for GtkPreview, loosely based on patches from Geert
+	Jordaens and David Odin. Fixes bug #144759.
+
+	* plug-ins/common/sharpen.c: use the new widget instead of a
+	GtkPreview; saves about 100 lines of rather complex code :)
+
+2004-07-29  Michael Natterer  <mitch@gimp.org>
+
+	* etc/controllerrc: changed default configuration of the keyboard
+	controller: scroll the display one step on cursor_key, scroll by
+	one page on <shift>+cursor_key and scroll to top/bottom/left/right
+	on <control>+cursor_key. Fixes bug #53988.
+
+	Moved the old opacity-modifying actions to <alt>+cursor_key.
+
+2004-07-29  Michael Natterer  <mitch@gimp.org>
+
+	Replaced the concept of having a boolean indicating if an undo
+	step dirties the image by a bitfield indicating which parts
+	of the image are dirtied:
+
+	* app/core/core-enums.[ch]: reordered two values in enum
+	GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask.
+
+	The values of GimpDirtyMask are still questionable and will
+	probably change...
+
+	* app/core/gimpimage.[ch]: removed signal "undo_start" and added
+	a GimpDirtyMask parameter to the "dirty" and "clean" signals.
+
+	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced
+	"gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass
+	it to gimp_image_dirty().
+
+	(gimp_image_undo_group_start): added *ugly* code which tries to
+	figure GimpDirtyMask from the group's GimpUndoType and store it in
+	the GimpUndoGroup. Call gimp_image_dirty() instead of the removed
+	gimp_image_undo_start(). This means the undo group now dirties the
+	image just like one of its undo steps, but that's no problem since
+	undoing cleans it in the same way.
+
+	* app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g
+
+	(gimp_undo_pop): emit clean/dirty signals *before* performing the
+	actual undo step so listeners can detach from the image before it
+	is changed by undo.
+
+	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a
+	GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push().
+
+	* app/core/gimpimagemap.[ch]: removed "gboolean interactive"
+	because it makes no sense to use GimpImageMap noninteractively.
+	Don't freeze()/thaw() undo while the image_map is active which
+	fixes many ways of trashing the image's undo state but probably
+	introduces new ways of doing evil things.
+
+	* app/display/gimpdisplay-foreach.c
+	* app/display/gimpdisplayshell-handlers.c: changed according
+	to the GimpImage::clean()/dirty() signal changes. Small fixes
+	in the quit dialog's dirty image container.
+
+	* app/tools/gimptoolcontrol.[ch]: added member and API to
+	set/get the dirty_mask.
+
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpimagemaptool.c
+	* app/tools/gimpiscissorstool.c
+	* app/tools/gimptexttool.c
+	* app/tools/gimptransformtool.c: whenever setting "preserve" to
+	FALSE, also set a "dirty_mask" which specifies on which image
+	changes the tool wants to be canceled.
+
+	* app/tools/tool_manager.c: removed "undo_start" connection and
+	connect to both "dirty" *and* "clean" to check if the active_tool
+	needs to be canceled. Cancel the tool only if the dirty_mask
+	passed in the signal has common bits with the tool's dirty_mask.
+
+	Fixes bug #109561 and probably opens some new ones...
+
+2004-07-29  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* libgimp/gimp.def
+	* libgimp/gimpui.def: added some missing symbols
+
+2004-07-29  Sven Neumann  <sven@gimp.org>
+
+	* libgimpbase/gimpbase.def: added new symbols.
+
+2004-07-29  Michael Natterer  <mitch@gimp.org>
+
+	Added support for motion event history as provided by some input
+	device drivers. If you have a tablet driver supporting this,
+	please try and report back.
+
+	* app/display/gimpdisplayshell.h (struct GimpDisplayShell): added
+	member "guint32 last_motion_time".
+
+	* app/display/gimpdisplayshell-callbacks.c
+	(gimp_display_shell_tool_events): remember the last_motion_time on
+	button_press() and after motion() and ask the current device for
+	its motion history; in motion(), if the active_tool asks for exact
+	motions, check if the input device recorded a motion history and
+	process the history instead of the motion event.
+
+	(gimp_display_shell_get_time_coords): new utility function which
+	gets GimpCoords from a GdkTimeCoord struct as used by the motion
+	history.
+
+2004-07-29  Shlomi Fish <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/repaint.c: converted a multiple if into
+	a nested one.
+
+2004-07-29  Sven Neumann  <sven@gimp.org>
+
+	* app/core/core-enums.h: removed enums GimpImageType and
+	GimpImageBaseType ...
+
+	* libgimpbase/gimpbaseenums.h: ... and added them here. Also moved
+	all enums from gimpbasetypes.h to this new file.
+
+	* libgimpbase/Makefile.am
+	* tools/pdbgen/Makefile.am: changed accordingly.
+
+	* app/core/core-enums.c
+	* libgimp/gimpenums.h
+	* libgimpbase/gimpbaseenums.c
+	* tools/pdbgen/enums.pl: regenerated.
+
+	* libgimpbase/gimpparasite.c
+	* libgimpbase/gimpprotocol.c
+	* libgimp/gimp.c: include <glib-object.h>
+
+	* libgimpbase/gimpbasetypes.[ch]: added API to set and get a
+	translation domain on a GType. This is used for translatable enum
+	values.
+
+	* libgimpbase/gimputils.[ch]: added API to retrieve the translated
+	name for an enum value.
+
+	* app/widgets/gimpenumstore.c
+	* app/widgets/gimpenumwidgets.c: use the new API in libgimpbase.
+
+2004-07-29  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawable.c: fixed gtk-doc comments.
+
+2004-07-29  Dave Neary  <bolsh@gimp.org>
+
+	* app/core/gimpdrawable-transform.c: Stop signed ints overflowing
+	while getting the mean by replacing (a + b) / 2 with a / 2 + b / 2.
+	Fixes bug #128594 for drawables less than 32K wide.
+
+2004-07-29  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/preferences-dialog.c: renamed "Cleared saved foobar now"
+	buttons to "Reset saves foobar to default values". Fixes bug #5673.
+	Added mnemonics for all the configure/save/reset buttons.
+
+2004-07-29  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.c (script_fu_free_script):
+	applied patch by Kevin Cozens that moves a g_free() to the right
+	place (bug #148729).
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/actions.c (action_groups): register the
+	GIMP_STOCK_VISIBLE icon with the "view" action group.
+
+2004-07-28  Shlomi Fish <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/brush.c: removed a redundant parameter
+	from one of the internal functions.
+	* plug-ins/gimpressionist/utils.c: Made sure that resources that
+	are selected by the presets will position their list views
+	accordingly.
+
+2004-07-28  Sven Neumann  <sven@gimp.org>
+
+	* autogen.sh: if the check for libtoolize fails, try glibtoolize.
+
+2004-07-28  Shlomi Fish <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/presets.c: created a base function for
+	two functions with duplicate code.
+
+2004-07-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_default_dialog.c: no need to include
+	"libgimp/stdplugins-intl.h" here.
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/preferences-dialog.c (prefs_dialog_new): reordered
+	buttons in the Interface -> Keyboard Shortcuts section to be
+	consistent with other sections which provide configure/save/clear
+	buttons.
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init)
+	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init):
+	don't call gimp_tool_control_set_preserve (tool->control, FALSE)
+	because these tools don't cache any image state and don't care
+	about the image changing under their feet.
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell.c (gimp_display_shell_reconnect):
+	emit "reconnect" *before* emitting scale and scroll events so
+	listeners (the navigation view) can switch to the new image at the
+	right time.
+
+2004-07-28  Sven Neumann  <sven@gimp.org>
+
+	Applied a patch from Brion Vibber that makes the TWAIN plug-in
+	available on Mac OS X (bug #147962):
+
+	* configure.in
+	* plug-ins/Makefile.am: check for Mac OS X twain support.
+
+	* plug-ins/twain/Makefile.am
+	* plug-ins/twain/tw_local.h
+	* plug-ins/twain/tw_mac.c
+	* plug-ins/twain/tw_platform.h
+	* plug-ins/twain/tw_win.c: new files with platform specific code.
+
+	* plug-ins/twain/README
+	* plug-ins/twain/tw_dump.[ch]
+	* plug-ins/twain/tw_func.[ch]
+	* plug-ins/twain/tw_util.[ch]
+	* plug-ins/twain/twain.c: changed accordingly.
+
+	* plug-ins/twain/gimp-twain.png: twain application icon used by
+	the Mac port.
+
+	* plug-ins/twain/tw_sess.c: removed, doesn't seem to be used.
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/image.pdb (image_is_dirty): fix typo in
+	parameter description.
+
+	* app/pdb/image_cmds.c
+	* libgimp/gimpimage_pdb.c: regenerated.
+
+2004-07-28  DindinX  <david.odin@cpe.fr>
+
+	* plug-ins/common/unsharp.c: Added a toggle button to enable/disable
+	preview updating. Should fix #144972.
+
+2004-07-28  DindinX  <david.odin@cpe.fr>
+
+	* plug-ins/common/shift.c
+	* plug-ins/common/sinus.c
+	* plug-ins/common/snoise.c
+	* plug-ins/common/spheredesigner.c: added missing calls to
+	g_rand_free (), remove tabs while I was at it.
+
+	* plug-ins/common/smooth_palette.c: minor cleanup
+
+	* plug-ins/common/spread.c: removed tabs.
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-enums.h: added still unused flags type
+	GimpDirtyMask.
+
+	* app/base/Makefile.am
+	* app/core/Makefile.am
+	* app/display/Makefile.am
+	* app/paint/Makefile.am
+	* app/text/Makefile.am
+	* app/tools/Makefile.am
+	* app/widgets/Makefile.am
+	* libgimpthumb/Makefile.am: changed calls to gimp-mkenums to
+	support GTypeFlags and to make the value arrays private to the
+	get_type() functions.
+
+	* app/base/base-enums.c
+	* app/core/core-enums.c
+	* app/display/display-enums.c
+	* app/paint/paint-enums.c
+	* app/text/text-enums.c
+	* app/tools/tools-enums.c
+	* app/widgets/widgets-enums.c: regenerated.
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimpclone.c: converted tabs to spaces.
+
+2004-07-28  DindinX  <david.odin@cpe.fr>
+
+	* plug-ins/common/spread.c: fix a smallish memory leak.
+
+2004-07-28  Sven Neumann  <sven@gimp.org>
+
+	* tools/gimp-mkenums: synced with glib-mkenums (execept for the
+	newly added template feature).
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	* libgimp/gimpbrushselect.c
+	* libgimp/gimpfontselect.c
+	* libgimp/gimpgradientselect.c
+	* libgimp/gimppalettemenu.c
+	* libgimp/gimppaletteselect.c
+	* libgimp/gimppatternselect.c (gimp_*_select_destroy): don't
+	leak the selected object's name and its data (brush mask etc).
+
+	* libgimp/gimpfontmenu.c: moved the icon to the left side of the
+	button.
+
+	* libgimp/gimppalettemenu.c: ditto. Added "Since: GIMP 2.2" to
+	API docs.
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpactiongroup.c
+	(gimp_action_group_set_action_label): forgot to strip mnemonics
+	here.
+
+2004-07-28  Michael Natterer  <mitch@gimp.org>
+
+	Enabled disabling all menu mnemonics. Addresses bug #120034:
+
+	* app/config/gimpguiconfig.[ch]
+	* app/config/gimprc-blurbs.h: added boolean RESTART property
+	"menu-menonics".
+
+	* app/gui/preferences-dialog.c: added a GUI for it.
+
+	* app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY
+	property "mnemonics".
+
+	(gimp_action_group_add_*_actions): call gimp_strip_uline() on
+	the actions' labels if mnemonics is FALSE.
+
+	* app/widgets/gimpactionfactory.[ch]
+	* app/actions/actions.c: pass gui_config->menu_menmonics to
+	all action groups.
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* menus/image-menu.xml.in: commented out "Context" menu now that
+	we have a shortcut editor.
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpgradient-load.c: don't leak empty SVG gradients.
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/image-commands.c: include "libgimpbase/gimpbase.h",
+	not an individual header out of libgimpbase.
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* libgimpbase/Makefile.am
+	* libgimpbase/gimpbase.h
+	* libgimpbase/gimpbase.def
+	* libgimpbase/gimpmemsize.[ch]: added new files with memsize
+	related functions (moved here from gimputil.c) and
+	GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]).
+
+	* libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here.
+
+	* libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from
+	app/config/gimpconfig-types.[ch]).
+
+	* libgimpbase/gimpbase-private.c
+	* libgimp/gimptile.c
+	* libgimp/gimpunitcache.c
+	* plug-ins/help/domain.c
+	* app/xcf/xcf-read.c: need to include glib-object.h.
+
+	* plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT.
+
+	* app/config/gimpconfig-types.[ch]: removed code that lives in
+	libgimpbase now.
+
+	* app/config/gimpconfig-deserialize.c: changed accordingly.
+
+	* app/config/gimpbaseconfig.c
+	* app/config/gimpdisplayconfig.c
+	* app/core/gimpcontext.c
+	* app/gui/grid-dialog.c
+	* app/tools/gimpcolortool.c
+	* app/widgets/gimpaction.c
+	* app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h
+	any longer.
+
+004-07-27  Michael Natterer  <mitch@gimp.org>
+
+	* libgimp/Makefile.am
+	* libgimp/gimp.h
+	* libgimp/gimpui.h
+	* libgimp/gimppalettemenu.[ch]
+	* libgimp/gimppaletteselect.[ch]: added palette select wrapper and
+	widget (straight copy & string replace of the font select stuff).
+	Fixes bug #136130.
+
+	* plug-ins/script-fu/script-fu-enums.h
+	* plug-ins/script-fu/script-fu-scripts.c
+	* plug-ins/script-fu/siod-wrapper.c: added SF_PALETTE so it can
+	be used in scripts.
+
+	* plug-ins/script-fu/scripts/test-sphere.scm: added a palette
+	parameter to the test script.
+
+2004-07-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage.c (gimp_image_finalize): remove the image
+	from the image hash table and set its "gimp" pointer to NULL
+	*after* all layers, channels, vectors and the selection are
+	finalized; otherwise these items have no chance of removing
+	themselves from the item hash table (because image->gimp is
+	already NULL). Spotted by pgimeno and nomis.
+	(should be backported after it got some testing)
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change.
+
+2004-07-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make
+	sure we always set a non-null URI.
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphelp-ids.h removed unused help IDs
+	GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs
+	for these entries are generated from the procedure names.
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphelp.c (gimp_help): print the help-id and
+	help-domain to stdout if gimp was started with the --verbose
+	command-line option.
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters):
+	show extensions in the filters menu. Is this a good idea at all?
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpbrushmenu.c
+	* libgimp/gimppatternmenu.c: attempt to make the brush and pattern
+	selectors look less like buttons (supposed to fix bug #147777).
+
+2004-07-27  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpcolorhexentry.c (gimp_color_hex_entry_events):
+	also accept the short hexadecimal notation (3 hex digits).
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/Makefile.am (libgimpwidgetsinclude_HEADERS):
+	added new files.
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets.
+
+	* app/widgets/gimpcomponenteditor.c
+	* app/widgets/gimpcontainertreeview.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimptoolview.c
+	* app/widgets/widgets-types.h: changed accordingly.
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgets.def
+	* libgimpwidgets/gimpwidgets.h
+	* libgimpwidgets/gimpwidgetsmarshal.list
+	* libgimpwidgets/gimpwidgetstypes.h
+	* libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell
+	renderer moved here from app/widgets.
+
+	* libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the
+	new toggle cell renderer.
+
+2004-07-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/pdb/procedural_db.[ch] (procedural_db_free_data): new
+	function which clears the whole list of data set by plug-ins.
+
+	(procedural_db_free): use it.
+
+	* app/actions/plug-in-actions.c
+	* app/actions/plug-in-commands.[ch]: added action, callback and
+	confirmation dialog for "Reset all filters to default values".
+	Somehow addresses bug #81015.
+
+	* app/widgets/gimphelp-ids.h: added a help ID for the new action.
+
+	* menus/image-menu.xml.in: added it to the "Filters" submenu.
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpcellrenderercolor.c
+	(gimp_cell_renderer_color_get_size): fine-tuning.
+
+2004-07-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR.
+
+	* app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor
+	to GimpParamSpecRGB.
+
+	* app/config/gimpconfig-deserialize.c
+	* app/config/gimpconfig-dump.c
+	* app/config/gimpconfig-serialize.c
+	* app/config/gimpscanner.c
+	* app/core/gimp-utils.c
+	* app/core/gimpcontext.c
+	* app/core/gimpgrid.c
+	* app/display/gimpdisplayoptions.c
+	* app/text/gimptext.c
+	* app/tools/gimpcolortool.c
+	* app/widgets/gimpaction.c
+	* app/widgets/gimpcolorbar.c
+	* app/widgets/gimppropwidgets.c: changed accordingly.
+
+2004-07-26  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: added a de-allocation to the PPM's
+	allocated by the size map dialog.
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpgradient-load.c: load all linear gradients from an
+	SVG file, not only the first one.
+
+2004-07-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdatafactory.h: added "gboolean writable" to the
+	GimpDataFactoryLoaderEntry struct. Return a GList* instead of
+	GimpData* from GimpDataLoadFunc so it's possible to load more than
+	one data object from one file.
+
+	* app/core/gimpdatafactory.c (gimp_data_factory_load_data):
+	changed accordingly: add all items of the returned lists to the
+	data factory. Make the data object writable only if it's in the
+	writable path *and* its loader entry says it's a writable format
+	*and* the returned list contains exactly one element.
+
+	* app/core/gimp.c (gimp_real_initialize): declare all loader
+	entries as writable where we have code to read and write exactly
+	one object per file; all others are not writable.
+
+	* app/core/gimpbrush.[ch]
+	* app/core/gimpbrushgenerated.[ch]
+	* app/core/gimpbrushpipe.[ch]
+	* app/core/gimpgradient-load.[ch]
+	* app/core/gimppalette.[ch]
+	* app/core/gimppattern.[ch] (all load functions): return a list
+	containing the loaded object instead of the object itself.
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgets.def
+	* libgimpwidgets/gimpwidgets.h
+	* libgimpwidgets/gimpwidgetstypes.h
+	* libgimpwidgets/gimpcellrenderercolor.[ch]: added a GimpRGB cell
+	renderer.
+
+	* libgimpwidgets/gimpcolorarea.[ch]: exported the function that
+	renders the color to a buffer for internal use in libgimpwidgets.
+
+	* libgimpwidgets/gimpcolorhexentry.c: use the new cell renderer
+	for the completion popup.
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/gimpcolor.def
+	* libgimpwidgets/gimpwidgets.def: added new symbols.
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/gimprgb.[ch]: register GimpRGB as a boxed type.
+
+	* libgimpcolor/gimpadaptivesupersample.c
+	* libgimpcolor/gimpcolorspace.c
+	* libgimpcolor/gimprgb-parse.c
+	* libgimp/gimp.h: include <glib-object.h> instead of <glib.h>.
+
+2004-07-26  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: placed all the orientation map-related
+	public functions in orientmap.h. Now we're freeing the PPM's that it
+	is allocating by a call to orientation_map_free_resources().
+
+2004-07-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-types.h: removed unused typedef
+	GimpDataObjectLoaderFunc.
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/gimprgb-parse.c
+	* libgimpcolor/gimprgb.h: added new function gimp_rgb_list_names()
+	that gives access to the list of SVG color keywords.
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgets.h
+	* libgimpwidgets/gimpwidgetstypes.h
+	* libgimpwidgets/gimpcolorhexentry.[ch]: added new widget that
+	allows to enter colors in hex notation or by using color names.
+
+	* libgimpwidgets/gimpcolorscales.c: use a GimpColorHexEntry.
+
+2004-07-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpeditselectiontool.[ch]: renamed init_edit_selection()
+	to gimp_edit_selection_tool_start(). Removed enum EditType.
+
+	* app/tools/tools-enums.h: added enum GimpTranslateMode instead.
+
+	* app/tools/gimpmovetool.c: changed accordingly.
+
+	* app/tools/gimpselectiontool.[ch]: added protected utility
+	function gimp_selection_tool_start_edit().
+
+	* app/tools/gimpfreeselecttool.c
+	* app/tools/gimpfuzzyselecttool.c
+	* app/tools/gimprectselecttool.c: use the new function instead of
+	duplicating the same code three times, don't include
+	"gimpeditselectiontool.h".
+
+	* app/tools/gimpiscissorstool.c: don't include
+	"gimpeditselectiontool.h".
+
+2004-07-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpeditselectiontool.c: don't freeze()/thaw() the
+	image's undo to prevent live-movement from ending up on the undo
+	stack. Instead, just stop pushing undo steps after the initial
+	movement. Simplifies edit_select's undo code quite a bit and fixes
+	bug #148458.
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpcolorscales.c (gimp_color_scales_hex_events):
+	accept SVG color names in the hex entry. Not very intuitive but
+	probably a nice experts feature and it can be improved later.
+
+2004-07-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/main.c (main): use #ifdef GIMP_UNSTABLE instead of looking
+	at GIMP_MINOR_VERSION.
+
+	* app/app_procs.c: don't #include "tools/gimp-tools.h".
+
+2004-07-26  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/bmp/bmp.h
+	* plug-ins/bmp/bmpread.c: applied a patch by Brion Vibber that
+	fixes extra data overflow, nonstandard 16bpp field arrangement
+	and unrecognized compression (bug #143682).
+
+2004-07-25  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/decompose.c: clamp results of LAB decomposition
+	so that out-of-gamut conversions do not overflow and get badly
+	distorted.  Fixes bug #147603.  Note that it would probably be a
+	good idea to do similar things for other conversion types.
+
+2004-07-25  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: converted checks for initialization of
+	ppm's done by checking the "col" buffer, to macro calls.
+
+2004-07-25  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: fixed bug #148088: ("Gimpressioinst
+	crashes if given malicious presets with out of range values, in
+	the radio buttons group numeric values: "placetype", "orienttype",
+	etc. ").
+
+	This was done by adding clamps to the relevant values in the preset.
+
+2004-07-25  Raphaël Quinet  <quinet@gamers.org>
+
+	* INSTALL: Minor fixes and improvements.  Suggest using a
+	different prefix and setting PKG_CONFIG_LIBDIR if old versions of
+	GTK+ libs are found and cannot be removed without breaking other
+	packages.
+
+2004-07-23  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: created a header "orientation.h"
+	for the Orientation tab specific declarations.
+
+2004-07-23  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimppixbuf.c (gimp_pixbuf_from_data): added missing code
+	for grayscale previews.
+
+2004-07-23  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpgradient-load.c (svg_parser_end_element): fixed
+	handling of the last gradient segment and did some code cleanup.
+
+2004-07-23  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpgradient-load.c (gimp_gradient_load_svg): improved
+	error message.
+	(svg_parser_end_element): don't crash on empty gradient definitions.
+
+2004-07-23  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/test-color-parser.c: added more test samples.
+
+	* libgimpcolor/gimprgb-parse.c: fixed a bug that I found with the
+	new tests.
+
+	* app/core/gimpgradient-load.c: changed SVG parser to handle
+	gradients that are defined more deeply in the SVG hierarchy. Added
+	a simplistic CSS style parser to deal with gradient definitions
+	that use CSS to define the gradient stop properties (closes bug
+	#148127).
+
+2004-07-23  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdatafactory.c: some newlines to improve error
+	messages.
+
+	* app/core/gimpgradient-load.c (gimp_gradient_load_svg): fixed
+	error handling.
+
+2004-07-23  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/Makefile.am
+	* libgimpcolor/test-color-parser.c: added a simple unit test
+	framework for the color parser.
+
+	* libgimpcolor/gimprgb-parse.c: fixed parsing of rgba() values.
+
+	* libgimpmath/test-md5.c: minor cleanup.
+
+2004-07-23  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/gimprgb-parse.c (gimp_rgba_parse_css): added support
+	for the "transparent" color name.
+
+2004-07-22  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/gimprgb-parse.c
+	* libgimpcolor/gimprgb.h: improved the CSS color parser code,
+	added new function gimp_rgba_parse_css(), added support for HSL
+	color values.
+
+2004-07-22  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/gimprgb-parse.c
+	* libgimpcolor/gimprgb.h: use a signed integer to pass the string
+	length to the new parser functions. The API explicitely asks for
+	-1 to be passed...
+
+	* app/core/gimp.c
+	* app/core/gimpgradient-load.[ch]
+	* app/core/gimpgradient.h: added preliminary support for loading
+	simple SVG gradients (see bug #148127).  Be careful with this new
+	feature; editing the loaded gradient will cause the SVG file to be
+	overwritten! Work in progress...
+
+2004-07-22  Sven Neumann  <sven@gimp.org>
+
+	* app/core/Makefile.am
+	* app/core/gimpgradient-load.[ch]
+	* app/core/gimpgradient-save.[ch]
+	* app/core/gimpgradient.[ch]: moved gradient file handling out of
+	gimpgradient.c to new files.
+
+	* app/core/gimp.c
+	* app/actions/gradients-commands.c: changed accordingly.
+
+	* libgimpcolor/gimpcolor.def: added gimp_rgb_parse_name.
+
+2004-07-22  Michael Natterer  <mitch@gimp.org>
+
+	* data/misc/gimp.desktop.in.in (MimeType): image/g -> image/g3fax.
+
+2004-07-22  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpactionview.c: rephrased the text for the dialog
+	that appears if a new shortcut collides with an existing one.
+
+	* libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name()
+	which accepts RGB colors in hexadecimal notation or as SVG color
+	keywords.
+
+2004-07-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell.c (gimp_display_shell_resume):
+	s/pause/resume/ in the API docs.
+
+2004-07-22  Michael Natterer  <mitch@gimp.org>
+
+	* tools/gimp-remote.c (main): correctly convert relative paths to
+	URIs. Append the resulting URI only if it's not NULL.
+
+2004-07-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimptoolbox.c (toolbox_create_tools): connect to
+	"accel-changed" of the accel_group using connect_object(), not
+	just connect() so we don't crash when it's emitted after the
+	toolbox is destroyed.
+
+2004-07-21  Ray Strode  <rstrode@redhat.com>
+
+	* gimp/data/misc/gimp.desktop.in.in: Add MimeType line to desktop
+	file for new MIME system.
+
+2004-07-21  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/gif.c: declared global const variable as static.
+	Fixes compiler warnings seen with gcc 3.4.1 (don't ask me why).
+
+2004-07-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimptemplateeditor.c
+	* plug-ins/common/gif.c
+	* plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of
+	text views. Fixes bug #148025.
+
+2004-07-21  Michael Natterer  <mitch@gimp.org>
+
+	Enabled the various "Clear saved foobar now" buttons in prefs:
+
+	* app/gui/session.[ch]
+	* app/menus/menus.[ch]
+	* app/widgets/gimpdevices.[ch]: implemented the _clear()
+	functions: unlink() the rc file and set an internal flag that it
+	has been deleted. Added "gboolean always_save" parameter to the
+	_save() functions and don't save anything if it is FALSE and the
+	internal deletion flag has been set.
+
+	* app/gui/gui.c
+	* app/widgets/gimpdevicestatus.c: changed accordingly.
+
+	* app/gui/preferences-dialog.c: added callbacks for all "Save now"
+	and "Clear now" buttons and show error messages if clearing fails.
+	Inform the user that she has to restart GIMP to see the effect of
+	the clearing.
+
+2004-07-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpmarshal.list
+	* app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete"
+	parameter to the GimpCellRendererAccel::accel_edited() signal.
+
+	* app/widgets/gimpactionview.c: distinguish between deletion of an
+	accelerator and the user entering an invalid accelerator.
+
+2004-07-21  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: normalized the identifiers in
+	placement.c.
+
+2004-07-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/context-actions.c: changed names of actions which
+	select brushes, patterns etc. from e.g. "context-brush-first" to
+	"context-brush-select-first".
+
+	* menus/image-menu.xml.in: changed accordingly.
+
+2004-07-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/preferences-dialog.c: remember the keyboard shortcut
+	dialog and show it only once.
+
+	* app/widgets/gimpactionview.c
+	* app/widgets/gimpcellrendereraccel.c: minor cleanups.
+
+	Seems to work pretty well now and thus fixes bug #142922.
+
+2004-07-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpmarshal.list
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcellrendereraccel.[ch]: new cell renderer
+	which displays an accelerator and allows to edit it (ripped
+	out of libegg and modified).
+
+	* app/widgets/gimpactionview.c: use the new renderer and connect
+	to its "accel-edited" signal (its callback is one huge mess that
+	needs to be cleaned up). Added ugly hack to work around GTK+ API
+	limitation that seems to prevent implementing a shortcut editor in
+	a sane way.
+
+	* app/actions/file-actions.c
+	* app/actions/image-actions.c
+	* app/actions/tools-actions.c: added ugly hacks here, too.
+
+	* app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut
+	editor by Close.
+
+2004-07-20  Sven Neumann  <sven@gimp.org>
+
+	* configure.in (ALL_LINGUAS): added back "pa" for Punjabi now that
+	the missing po files have been added (tips/pa.po is still missing
+	though).
+
+2004-07-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpactionfactory.[ch]
+	* app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id"
+	properties to GtkActionGroup and allow to register them in the
+	GimpActionFactory.
+
+	* app/actions/actions.c: register user visible labels and icons
+	with all action groups.
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpactionview.[ch]: new widget which shows a
+	treeview of action groups and their actions & shortcuts.
+
+	* app/widgets/gimpaction.[ch]: added gimp_action_name_compare()
+	utility function.
+
+	* app/widgets/gimpwidgets-utils.[ch]: added
+	gimp_get_accel_string() utility function.
+
+	* app/widgets/gimpcontrollers.[ch]: added
+	gimp_controllers_get_ui_manager() which will be used for setting
+	up the controller mapping dialog.
+
+	* app/gui/preferences-dialog.c: added a "Configure Keyboard
+	Shortcuts" button which pops up a GimpActionView. Work in
+	progress...
+
+2004-07-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/image-actions.c: make sure that the "image-new" and
+	"image-new-from-image" actions always have the same shortcut.
+
+2004-07-20  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/Lighting/lighting_main.c
+	* plug-ins/Lighting/lighting_main.h
+	* plug-ins/Lighting/lighting_preview.c
+	* plug-ins/Lighting/lighting_preview.h
+	* plug-ins/Lighting/lighting_shade.c
+	* plug-ins/Lighting/lighting_ui.c: completely reworked UI for
+	lighting page.  Now supports up to 6 lights (more is trivial).
+	Added ability to temporarily isolate selected light.  Added
+	light intensity controls.  Can interactively position each light
+	(does not quite work yet for directional lights).
+
+2004-07-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/tools-actions.c: added an icon to the
+	"tools-visibility" action.
+
+2004-07-20  Sven Neumann  <sven@gimp.org>
+
+	* app/composite/gimp-composite.c (gimp_composite_init): now that
+	the output depends on --verbose, enable it for stable releases also.
+
+2004-07-20  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/presets.c: fixed the incorrect strings
+	for input and output of the preset's fields. (a relic of an
+	irresponsible search-and-replace script).
+
+	* plug-ins/gimpressionist/: normalized the identifiers of
+	orientmap.c.
+
+2004-07-20  Helvetix Victorinox  <helvetix@gimp.org>
+
+	* app/composite/Makefile.am (regenerate): Updated make-installer.py
+	command line to take advantage of the new compile time method of
+	determining which instruction set to compile.
+
+	* app/composite/gimp-composite.c (gimp_composite_init): Print the
+	list of active instruction sets if the --verbose command line
+	switch is ON (via be_verbose)
+
+	* app/composite/gimp-composite-x86.h: Factored code from the mmx,
+	and sse implementations.
+
+	* app/composite/make-installer.py: Raised the number of test
+	iterations from 1 to 10.
+
+	* app/composite/gimp-composite-3dnow.[ch]
+	* app/composite/gimp-composite-3dnow-test.c
+	* app/composite/gimp-composite-3dnow-installer.c
+	* app/composite/gimp-composite-altivec.[ch]
+	* app/composite/gimp-composite-altivec-test.c
+	* app/composite/gimp-composite-altivec-installer.c
+	* app/composite/gimp-composite-mmx.[ch]
+	* app/composite/gimp-composite-altivec-test.c
+	* app/composite/gimp-composite-altivec-installer.c
+	* app/composite/gimp-composite-sse.[ch]
+	* app/composite/gimp-composite-sse-test.c
+	* app/composite/gimp-composite-sse-installer.c
+	* app/composite/gimp-composite-sse2.[ch]
+	* app/composite/gimp-composite-sse2-test.c
+	* app/composite/gimp-composite-sse2-installer.c
+	* app/composite/gimp-composite-vis.[ch]
+	* app/composite/gimp-composite-vis-test.c:
+	Regenerated sources via make-installer.py
+
+2004-07-20  Sven Neumann  <sven@gimp.org>
+
+	* app/app_procs.c
+	* app/base/base.[ch]
+	* app/composite/gimp-composite.[ch]: pass "be_verbose" to the base
+	and composite subsystems.
+
+2004-07-20  Sven Neumann  <sven@gimp.org>
+
+	* autogen.sh: added some empty lines to improve readability of the
+	output in case of problems.
+
+	* configure.in: bumped version number to 2.1.3.
+
+2004-07-19  Helvetix Victorinox  <helvetix@gimp.org>
+
+	* app/composite/gimp-composite-mmx.c
+	(xxxgimp_composite_dodge_rgba8_rgba8_rgba8_mmx)
+	* app/composite/gimp-composite-mmx.c
+	(xxxgimp_composite_divide_rgba8_rgba8_rgba8_mmx)
+	* app/composite/gimp-composite-mmx.c
+	(gimp_composite_difference_rgba8_rgba8_rgba8_mmx)
+	* app/composite/gimp-composite-mmx.c
+	(gimp_composite_darken_rgba8_rgba8_rgba8_mmx): More clobber
+	register corrections.
+
+2004-07-20  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.1.2 release.
+
+2004-07-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/winicon/icoload.c
+	* plug-ins/winicon/icosave.c: added explicit casts to please the
+	compiler.
+
+2004-07-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gimpressionist/Makefile.am (gimpressionist_sources):
+	added paper.h.
+
+	* plug-ins/MapObject/Makefile.am (MapObject_SOURCES): added back
+	arcball.h.
+
+	* plug-ins/MapObject/mapobject_main.c
+	* plug-ins/MapObject/mapobject_preview.c: no need to include
+	arcball.h here.
+
+	* plug-ins/gfig/Makefile.am (SUBDIRS): added back gfig-examples
+
+	* plug-ins/gfig/gfig-examples/Makefile.am: cleanup.
+
+2004-07-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/Lighting/lighting_ui.c: fixed some GUI issues:
+	left-align labels, use stock buttons, added line-breaks to make
+	the code fit into 80 columns.
+
+2004-07-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/Lighting/lighting_ui.c: fixed a couple of issues with
+	the new code: don't include individual glib headers, never ever
+	use sprintf(), mark user-visible strings for translations, use
+	default messages, removed trailing whitespace.
+
+2004-07-19  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/Lighting/lighting_ui.c: added ability to save and load
+	presets for lights.
+
+2004-07-19  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/orientation.c: normalized some variables
+	in the module and fixed some indentation.
+
+2004-07-19  Helvetix Victorinox  <helvetix@gimp.org>
+
+	* app/composite/gimp-composite-mmx.c
+	(gimp_composite_addition_rgba8_rgba8_rgba8_mmx)
+	* app/composite/gimp-composite-mmx.c
+	(gimp_composite_burn_rgba8_rgba8_rgba8_mmx)
+	* app/composite/gimp-composite-x86.h: Correction of clobbered
+	register lists, as additional progress against bug #147013.
+
+2004-07-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpmarshal.list: removed unused VOID:UINT,STRING.
+
+2004-07-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/file-open-location-dialog.c
+	(file_open_location_dialog_show): added the "web" icon left of
+	label & entry.
+
+2004-07-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintcore.h: removed enum GimpPaintCoreState.
+
+	* app/paint/paint-enums.h: added enum GimpPaintState (with values
+	that have a name space).
+
+	* app/paint/gimppaintcore.[ch]
+	* app/paint/gimpairbrush.c
+	* app/paint/gimpbrushcore.c
+	* app/paint/gimpclone.c
+	* app/paint/gimpconvolve.c
+	* app/paint/gimpdodgeburn.c
+	* app/paint/gimperaser.c
+	* app/paint/gimpink.c
+	* app/paint/gimppaintbrush.c
+	* app/paint/gimppaintcore-stroke.c
+	* app/paint/gimpsmudge.c
+	* app/tools/gimppainttool.c: changed accordingly.
+
+	* app/tools/gimpinktool.c: removed unused #include.
+
+2004-07-19  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
+	moved variable declarations to the scope they are being used in,
+	removed trailing whitespace, minor cleanups.
+
+2004-07-19  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/core/gimpchannel-combine.c: put in two lines accidentally
+	omitted in previous change, improve doc comment.
+
+2004-07-19  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpbase/gimpwin32-io.h: added copyright header, added
+	#defines for access(), F_OK, R_OK and X_OK.
+
+	* app/core/gimpdata.c: include the above instead of defining
+	the workarounds here.
+
+	* app/base/tile-swap.c
+	* app/config/gimpconfig-dump.c
+	* libgimpthumb/gimpthumb-utils.c
+	* libgimpthumb/gimpthumbnail.c: for consistency, #include
+	gimpwin32-io.h with "" instead of <>.
+
+2004-07-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse):
+	comments not intended for gtk-doc must not start with '/**'.
+
+2004-07-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in.h (struct _PlugIn): removed obsolete
+	compile-time check for GLIB >= 2.3.5.
+
+2004-07-19  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* ChangeLog: Fixed a copy-and-paste error with the dates of my commits.
+	* plug-ins/gimpressionist/ppmtool.c: removed a few commented-out
+	asserts, and the function that was used to implement them.
+
+2004-07-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/widgets-types.h: reordered and commented to match
+	API docs.
+
+2004-07-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_browse.[ch]: renamed struct member
+	file_selection to file_chooser.
+
+2004-07-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/config/config-types.h: removed GimpConfigInterface typedef,
+	added comments to typedefs which don't belong here.
+
+	* app/config/gimpconfig.h: added GimpConfigInterface typedef.
+
+	* app/core/core-types.h
+	* app/display/display-types.h: added commented out typedefs for
+	types that live in config-types.h for obscure reasons.
+
+	* app/core/core-types.h: reordered stuff to match the order in the
+	API docs (makes keeping stuff in sync much easier).
+
+2004-07-19  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/repaint.c: replaced a few if's+destructors
+	pairs for ppm_ with just the destructors.
+
+2004-07-19  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/repaint.c: normalized some identifiers of
+	repaint.c, and corrected some indentation there.
+
+2004-07-18  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/core/gimpchannel-combine.c: improve anti-aliasing for
+	elliptical selections, as described in bug #147836.
+
+2004-07-18  Sven Neumann  <sven@gimp.org>
+
+	* app/composite/gimp-composite-mmx.h: don't start a comment with
+	/** unless it's meant to be parsed by gtk-doc.
+
+	* app/actions/Makefile.am:
+	* app/actions/file-dialog-commands.[ch]: removed, not used any
+	longer.
+
+2004-07-18  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/paint/gimpink-blob.c (blob_make_convex): Check if the
+	array index is legal before using it, not the other way around.
+	Fixes bug #144856.
+
+2004-07-17  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/polar.c (dialog_update_preview): Fixed a
+	write to unallocated memory that was causing crashes in various
+	spots.
+
+2004-07-17  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/polar.c (polarize_func): moved array
+	initialization out of variable declaration. Fixes bug #147799.
+
+2004-07-17  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimphelp-ids.h: added the removed help IDs back.
+
+	* app/widgets/gimpfileprocview.[ch]: cache all file_procs' help
+	IDs and added gimp_file_proc_view_get_help_id() which returns the
+	selected item's help ID.
+
+	* app/widgets/gimpfiledialog.c: added a custom help func which
+	shows the help for the selected file_proc if the proc_view has the
+	focus.
+
+2004-07-17  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB
+	for "file-open-location".
+
+	* app/widgets/gimpfiledialog.c: create the scrolled window with
+	shadow_type GTK_SHADOW_IN.
+
+	* app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip
+	procedures that register a prefix (the URL loader).
+
+	* app/widgets/gimphelp-ids.h: removed help IDs that used to be
+	used from the file-open and file-save menus.
+
+	* plug-ins/common/xwd.c (query): "X window dump" seems to be more
+	appropriate than "X window image".
+
+2004-07-17  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/Makefile.am
+	* app/actions/file-dialog-actions.[ch]
+	* app/actions/file-open-actions.[ch]
+	* app/actions/file-save-actions.[ch]: these aren't needed any
+	longer.
+
+	* app/actions/actions.c: changed accordingly.
+
+	* app/menus/Makefile.am
+	* app/menus/file-dialog-menu.[ch]
+	* app/menus/file-open-menu.[ch]
+	* app/menus/file-save-menu.[ch]: these aren't needed any longer.
+
+	* app/menus/menus.c: changed accordingly.
+
+	* menus/Makefile.am
+	* menus/file-open-menu.xml
+	* menus/file-save-menu.xml: these are also not needed any longer.
+
+2004-07-17  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/bmp/bmpwrite.c (WriteImage): Applied a patch from
+	Brion Vibber that fixes corruption when saving RLE-encoded
+	BMPs on big endian hosts. Fixes bug #147759.
+
+2004-07-17  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: normalized the identifiers of
+	general.c and general.h. Also, renamed a callback from _store
+	to simply _callback to avoid confusion with the _store methods.
+	Some of the member variables of the pcvals struct were changed
+	as a result.
+
+2004-07-16  Helvetix Victorinox  <helvetix@gimp.org>
+
+	* app/composite/gimp-composite-mmx.[ch]
+	* app/composite/gimp-composite-sse.[ch]
+	* app/composite/gimp-composite-sse2.[ch]:
+
+	We've had trouble compiling with the Intel compiler which
+	identifies itself as GCC, but doesn't support the same extended
+	assembly features/misfeatures as GCC.  With the help of the Intel
+	compiler group, we've determined that the Intel compiler can be
+	identified at compile time by the definition of the preprocessor
+	variable __INTEL_COMPILER.
+
+	These changes make all of the assembly code currently written to
+	simply avoid the Intel compiler.
+
+	This is an interim solution to get a build working despite the
+	Intel compiler.  A more correct solution has been identified, see
+	the discussion of bug #147013 for more information.
+
+2004-07-17  Sven Neumann  <sven@gimp.org>
+
+	* app/xcf/xcf.c (xcf_init): also register the internal XCF
+	handlers according to the new scheme.
+
+	* plug-ins/common/Makefile.am
+	* plug-ins/common/plugin-defs.pl
+	* plug-ins/common/hrz.c: removed the HRZ file plug-in since it
+	doesn't seem to be very useful.
+
+2004-07-17  Sven Neumann  <sven@gimp.org>
+
+	* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add)
+	(plug_ins_init_file): use g_slist_prepend() instead of
+	g_slist_append().
+
+	* plug-ins/common/url.c (query): ported to the new PDB registration
+	scheme.
+
+2004-07-16  Sven Neumann  <sven@gimp.org>
+
+	* app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures
+	by their menu labels.
+
+	* app/widgets/gimpfileprocview.c: removed the sort function here.
+
+2004-07-16  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpfileprocview.[ch]: added new widget that offers
+	a treeview on file procedures.
+
+	* app/widgets/gimpfiledialog.[ch]: replaced the file type option
+	menu with the new GimpFileProcView widget.
+	(gimp_file_dialog_set_image): reset the file type to Automatic
+	(fixes bug #141535).
+
+	* app/actions/file-commands.c
+	* app/gui/file-open-dialog.[ch]
+	* app/gui/file-save-dialog.[ch]: changed accordingly.
+
+	* plug-ins/common/bz2.c
+	* plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2"
+	extension. It's redundant and breaks the code that sets the
+	extension from the selected file-type.
+
+	* plug-ins/common/dicom.c: register a shorter menu label.
+
+	* plug-ins/common/gbr.c
+	* plug-ins/common/gih.c
+	* plug-ins/common/pat.c
+	* plug-ins/common/url.c: register stock icons.
+
+2004-07-16  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/Lighting/lighting_main.[ch]
+	* plug-ins/Lighting/lighting_preview.[ch]
+	* plug-ins/Lighting/lighting_shade.c
+	* plug-ins/Lighting/lighting_ui.c:  Made this plug-in support
+	multiple light sources; implemented three, architecture now
+	supports any number.  Changed material properties to more intuitve
+	names; added "metallic" property.  Cleaned out some unused,
+	commented-out code.
+
+2004-07-16  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb.pl: include "libgimpbase/gimpbase.h" instead of
+	"libgimpbase/gimpparasite.h" for getting the GimpParasite type.
+
+	* tools/pdbgen/app.pl
+	* tools/pdbgen/pdb/drawable.pdb
+	* tools/pdbgen/pdb/edit.pdb
+	* tools/pdbgen/pdb/gradients.pdb
+	* tools/pdbgen/pdb/guides.pdb
+	* tools/pdbgen/pdb/image.pdb: removed redundant #includes.
+
+	* tools/pdbgen/pdb/plug_in.pdb: standardized "success" logic.
+	Consistently fail if there is no currently queried plugin.
+
+	* app/pdb/*.c: regenerated.
+
+2004-07-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-transform.c: made gtk-doc even
+	happier; clarified meaning of the "use_offsets" parameter.
+
+2004-07-16  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdata.c:
+	* app/display/gimpcanvas.c:
+	* app/display/gimpdisplayshell.c
+	* app/display/gimpdisplayshell-transform.c: corrected API
+	documentation, removed trailing whitespace.
+
+	Please do always build the documentation if you add or change any
+	gtk-doc comments.
+
+2004-07-15  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/display/gimpcanvas.c:
+	* app/display/gimpdisplayshell-transform.c: added gtk-doc
+	comments for all public functions that lack them.
+
+	* app/display/gimpdisplayshell.c: added a couple of
+	gtk-doc comments.
+
+2004-07-15  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/core/gimpdata.c: added gtk-doc comments for
+	public functions.
+
+2004-07-15  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: normalized the identifiers of
+	paper.c and paper.h. Made one variable local to the function
+	instead of module static.
+
+2004-07-15  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: normalized the ppmtools.c and
+	ppmtool.h identifiers. Also fixed some (but not all) of the
+	syntax.
+
+2004-07-15  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/winicon/icoload.c:
+	* plug-ins/winicon/icosave.c: Applied a patch from Brion Vibber
+	that fixes byte-swapping on big endian hosts. Fixes bug #147610.
+
+2004-07-15  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/helpbrowser/dialog.c
+	* plug-ins/helpbrowser/uri.c: don't warn if no help pages are
+	installed and the Home button is clicked.
+
+2004-07-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/file/file-open.c (file_open_layer): don't crash if no
+	layer or only one layer is visible. Fixes bug #143804.
+
+	* app/app_procs.c (app_run): fixed log domain registration.
+
+2004-07-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpviewable.[ch]: corrected API docs and fixed
+	function parameter names to silent gtk-doc warnings.
+
+2004-07-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/app_procs.c (app_run): register a log handler for the
+	"Gimp-Menus" domain.
+
+2004-07-15  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/mng.c: cleanup.
+
+2004-07-15  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/core/gimpviewable.c: added gtk-doc comments for public
+	functions.
+
+2004-07-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/file-commands.h: reordered to match the .c file.
+
+	* app/core/gimpitem.c
+	* app/vectors/gimpvectors-import.c: fixed API docs.
+
+2004-07-14  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/png.c:
+	* plug-ins/common/mng.c: Fixed erroneously reported warning
+	message when saving indexed layers with an alpha channel but
+	no transparent pixels.
+
+2004-07-14  Sven Neumann  <sven@gimp.org>
+
+	* app/app_procs.c (app_run): register a log handler for the
+	"Gimp-Actions" domain.
+
+2004-07-14  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* devel-docs/objects.txt: . . . and removed because it is
+	redundant with devel-docs/app/app.hierarchy.
+
+2004-07-14  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* devel-docs/objects.txt:  added file containing a map of Gimp's
+	GObject hierarchy .
+
+2004-07-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpstatusbar.[ch]: massively changed: removed
+	message_ids, the message mem chunk and all signals. Added new
+	function gimp_statusbar_replace() which updates a message without
+	moving it to the top of the stack. Fixes bug #120175.
+
+	* app/display/gimpdisplayshell-title.[ch]: renamed
+	gimp_display_shell_update_title() to
+	gimp_display_shell_title_update() and switched from pop()/push()
+	to replace() so the title message keeps its place in the stack.
+	Added new function gimp_display_shell_title_init() which push()es
+	the title message to the stack.
+
+	* app/display/gimpdisplayshell.c (gimp_display_shell_new): call
+	gimp_display_shell_title_init() so the "title" message is at the
+	bottom of the stack.
+
+	* app/display/gimpdisplayshell-callbacks.c
+	* app/display/gimpdisplayshell-handlers.c: changed accordingly.
+
+2004-07-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-console.[ch]
+	* plug-ins/script-fu/script-fu.c
+	* plug-ins/script-fu/siod-wrapper.[ch]
+	* plug-ins/script-fu/siod/slib.c: applied a patch from Kevin
+	Cozens that removes an unneeded pipe which was causing problems
+	on long output from the SIOD interpreter (bug #139200). Also
+	shortened the welcome message.
+
+2004-07-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/pagecurl/pagecurl.c: GUI polishing.
+
+2004-07-14  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: Added more underscores to identifiers.
+	Fixed some of the style issues (added whitespace before the '(' in
+	function calls).
+
+2004-07-14  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/mng.c: Now writes a global palette chunk, and
+	empty palette chunks for the frames that use it. This saves a
+	bit of diskspace.
+
+2004-07-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage.c: added properties "gimp", "id", "width",
+	"height" and "base-type". Moved all code from gimp_image_new()
+	to GObject::constructor().
+
+	* app/core/gimpimage-convert.c
+	* app/core/gimpimage-crop.c
+	* app/core/gimpimage-resize.c
+	* app/core/gimpimage-rotate.c
+	* app/core/gimpimage-scale.c
+	* app/core/gimpimage-undo-push.c: set "width", "height" and
+	"base-type" with g_object_set() so "notify" is emitted on the
+	properties.
+
+	* app/core/gimpimage-undo.c (gimp_image_undo_pop_stack):
+	freeze/thaw property notifications around undoing/redoing so they
+	are not emitted in the middle of the undo operation.
+
+2004-07-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpitem.c: converted tabs to spaces, cleanup,
+	reviewed new API docs.
+
+2004-07-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/tiff.c: applied a patch done by Brion Vibber
+	and Philip Lafleur that fixes loading of CMYK TIFF images on
+	big-endian hardware (bug #147328).
+
+2004-07-14  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/mng.c (respin_cmap): Properly check the return
+	value of find_unused_ia_color(). The plugin will now save indexed
+	MNGs correctly; fixes bug #139947. Also converted tabs to spaces.
+
+2004-07-14  Michael Natterer  <mitch@gimp.org>
+
+	Code review & cleanup:
+
+	* app/config/gimpguiconfig.[ch]: removed transparency-size,
+	transparency-type and snap-distance properties...
+
+	* app/config/gimpdisplayconfig.[ch]: ...and added them here.
+
+	* app/display/gimpdisplayshell.c
+	* app/tools/gimpmovetool.c: changed accordingly.
+
+	* app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a
+	"max_memsize" parameter instead of looking it up in GimpGuiConfig.
+
+	* app/actions/image-commands.c: changed accordingly.
+
+	* app/core/gimparea.c
+	* app/core/gimpdrawable.c: converted tabs to spaces, cleanup.
+
+	* app/core/gimpprojection.[ch]: renamed IdleRenderStruct to
+	GimpProjectionIdleRender, reordered functions, cleanup.
+
+	* app/display/gimpdisplay-handlers.c
+	* app/display/gimpdisplay.c: removed unused #includes.
+
+	* app/display/gimpdisplayshell.[ch]
+	* app/display/gimpdisplayshell-close.c: renamed
+	shell->warning_dialog to shell->close_dialog, some random
+	cleanups.
+
+	* app/display/gimpdisplayshell-handlers.c
+	* app/widgets/gimpselectioneditor.c: minor coding style cleanup.
+
+2004-07-13  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* app/core/gimpitem.c: added documentation comments to some
+	of the functions.
+
+2004-07-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/Makefile.am
+	* app/display/gimpdisplayshell-close.[ch]: new files for
+	gimp_display_shell_close() and its dialog & callback.
+
+	* app/display/gimpdisplayshell.[ch]: removed from here.
+
+	* app/actions/view-actions.c (view_close_view_cmd_callback):
+	changed accordingly.
+
+2004-07-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/pagecurl/pagecurl.c: code cleanup. Use enums instead of
+	a plethora of booleans. Added some macros for readability. Allow
+	to use a reversed gradient for colorizing the curl.
+
+2004-07-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/Makefile.am
+	* app/core/core-types.h
+	* app/core/gimppickable.[ch]: new interface which has
+	get_image_type(), get_tiles() and get_color_at() methods.
+
+	* app/core/gimpdrawable.[ch]
+	* app/core/gimpimagemap.[ch]
+	* app/core/gimpprojection.[ch]: implement GimpPickableInterface
+	and removed public get_colot_at() functions.
+
+	* app/core/gimpimage-pick-color.[ch]: removed typedef
+	GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use
+	gimp_pickable_pick_color() instead.
+
+	* app/core/gimpimage-contiguous-region.c
+	* app/core/gimpimage-crop.c
+	* app/gui/info-window.c
+	* app/paint/gimpconvolve.c
+	* app/paint/gimpsmudge.c
+	* app/tools/gimpbycolorselecttool.c
+	* app/tools/gimpimagemaptool.c
+	* app/widgets/gimpselectioneditor.c: use GimpPickable functions
+	instead of the various get_color_at() functions. Simplifies code
+	which has a "sample_merged" boolean. Various cleanups.
+
+2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/presets.c: Added underscores between
+	words in function names according to the GIMP's (and common
+	sense) convention.
+
+2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: Moved the global declarations of
+	img_has_alpha and create_colorpage to more specialized headers.
+
+2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/: Added the paper.h header for the functions
+	defined in the paper.c module. (thus removing more declarations
+	from gimpressionist.h)
+
+2004-07-13  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-preview.[ch}
+	* plug-ins/gfig/gfig.h: Made Cancel work properly.  Moved "show grid",
+	"snap to grid", and "show image" checkbuttons back onto main
+	interface.  Eliminated GtkPreview and removed undef of
+	GTK_DISABLE_DEPRECATED from gfig-preview.c.  Removed some
+	unused code.
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gflare/gflare.c (preview_handle_idle): use
+	gtk_widget_queue_draw_area() instead of the deprecated
+	gtk_widget_draw() routine.
+
+	* plug-ins/gimpressionist/orientmap.c
+	* plug-ins/gimpressionist/paper.c
+	* plug-ins/gimpressionist/sizemap.c: use gtk_widget_queue_draw()
+	instead of the deprecated gtk_widget_draw() routine.
+
+2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/preview.c
+	* plug-ins/gimpressionist/sizemap.c:
+	eliminated two compile-time warnings.
+
+2004-07-13  Michael Natterer  <mitch@gimp.org>
+
+	Added a GimpProjection object which maintains the idle projection
+	logic that was in GimpDisplay and takes care of constructing the
+	projection even without any display open. Makes color picking and
+	other reads from the projection work without display and fixes the
+	major bug that we were constructing the projection n times (!)
+	for n displays.
+
+	* app/core/Makefile.am
+	* app/core/gimpimage-projection.[ch]: removed.
+
+	* app/core/core-types.h
+	* app/core/gimpmarshal.list
+	* app/core/gimparea.[ch]
+	* app/core/gimpprojection.[ch]
+	* app/core/gimpprojection-construct.[ch]: new files assembled from
+	the pieces of gimpdisplay.c and gimpimage-projection.c.
+
+	* app/core/gimpimage.[ch]: create a GimpProjection.
+	Removed explicit projection realloc calls because the projection
+	connects to the relevant GimpImage signals now.
+	Added gimp_image_coords_in_active_drawable().
+
+	* app/display/Makefile.am
+	* app/display/gimpdisplay-area.[ch]: removed.
+
+	* app/display/gimpdisplay.[ch]: stripped away the idle render stuff
+	and just keep a list of update_areas which is painted on flush().
+	Removed gimp_display_coords_in_active_drawable().
+
+	* app/display/gimpdisplay-foreach.[ch]: removed
+	gimp_display_finish_draw().
+
+	* app/core/gimpchannel.c
+	* app/core/gimpimage-contiguous-region.c
+	* app/core/gimpimage-convert.c
+	* app/core/gimpimage-crop.c
+	* app/core/gimpimage-merge.c
+	* app/core/gimpimage-pick-color.c
+	* app/core/gimpimage-scale.c
+	* app/core/gimppalette-import.c
+	* app/display/gimpdisplay-handlers.c
+	* app/display/gimpdisplayshell-render.c
+	* app/display/gimpdisplayshell.c
+	* app/gui/info-window.c
+	* app/tools/gimpbucketfilltool.c
+	* app/tools/gimpbycolorselecttool.c
+	* app/tools/gimpclonetool.c
+	* app/tools/gimpcolortool.c
+	* app/tools/gimpeditselectiontool.c
+	* app/tools/gimpfliptool.c
+	* app/tools/gimpimagemaptool.c
+	* app/tools/gimpiscissorstool.c
+	* app/tools/gimppainttool.c
+	* app/tools/gimpselectiontool.c
+	* app/tools/gimptransformtool.c
+	* app/widgets/gimpselectioneditor.c: changed accordingly.
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppixmap.[ch]: declared GimpPixmap as deprecated.
+
+	* libgimpwidgets/gimpwidgets.[ch]: ditto for gimp_pixmap_button_new().
+
+	* plug-ins/Lighting/ChangeLog: removed outdated and unused ChangeLog.
+
+	* plug-ins/Lighting/Makefile.am
+	* plug-ins/Lighting/*.xpm: removed XPM files...
+
+	* configure.in
+	* plug-ins/Lighting/images: ... and added them as PNG images here.
+	These should be redone with antialiased edges.
+
+	* plug-ins/Lighting/lighting_stock.[ch]
+	* plug-ins/Lighting/lighting_ui.c: register stock icons and use
+	those instead of GimpPixmaps.
+
+	* plug-ins/MapObject/Makefile.am
+	* plug-ins/MapObject/*.xpm: removed duplicated XPM files.
+
+	* plug-ins/MapObject/mapobject_stock.[ch]: register stock icons
+	reusing the generated header from the Lighting plug-in.
+
+	* plug-ins/MapObject/mapobject_ui.c: use them.
+
+	* plug-ins/pagecurl/pagecurl.c: undef GIMP_DISABLE_DEPRECATED until
+	GimpPixmap has been replaced here as well.
+
+2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/presets.c: fixed bug #147483 (gimpressionist
+	will delete global presets if the user running GIMP has priviliges to
+	do so). This was done by creating a function to check if a preset is
+	global, and by making sure the delete button is in-sensitive when
+	this is the case.
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpcolorbutton.c
+	* libgimpwidgets/gimpcolornotebook.c
+	* libgimpwidgets/gimpcolorscale.c
+	* libgimpwidgets/gimpcolorscales.c
+	* libgimpwidgets/gimpcolorselect.c
+	* libgimpwidgets/gimpcolorselection.c
+	* libgimpwidgets/gimpframe.c
+	* libgimpwidgets/gimppickbutton.c
+	* libgimpwidgets/gimpunitmenu.c: some code review and cosmetics.
+
+2004-07-13  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/*.[ch]: normalized some of brush.c's
+	identifiers (= variable names and function name)
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimp-utils.c (gimp_g_value_get_memsize): handle NULL
+	string values.
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/jpeg.c: override the output_message error
+	handler in order to propagate warnings to the user interface
+	(related to bug #145212).
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimp-utils.[ch]: added new function
+	gimp_g_value_get_memsize() that attempts to calculate the memory
+	requirements for a GValue.
+
+	* app/text/gimptextundo.c (gimp_text_undo_get_memsize): use the
+	new function to obtain a better estimate for the size of the text
+	undo.
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimptexttool.c (gimp_text_tool_create_layer): plugged
+	a tiny memory leak.
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimage-undo.c: resurrected some bit-rotting debug
+	code. Might become useful one day.
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* autogen.sh: when automake 1.8 is being used, require at least
+	version 1.8.3. Earlier versions of the automake-1.8 series don't
+	handle gimp-console correctly.
+
+2004-07-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/config/gimpconfig-dump.c
+	* app/display/gimpdisplayshell-title.c
+	(gimp_display_shell_format_title): applied patch from Dave Neary
+	which adds %B which expands to (modified) if the image is
+	dirty. Also added %A which expands to (clean) because we also have
+	a short indicator for the clean image. Fixes bug #130943.
+
+2004-07-13  Sven Neumann  <sven@gimp.org>
+
+	* app/Makefile.am: removed hack for gimp-console compilation.
+	automake seems to handle it correctly all by itself.
+
+2004-07-12  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* app/app_procs.c: added
+	#ifdef G_OS_WIN32
+	#include <windows.h>
+	#endif
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpbufferview.[ch]: added a preview of the global
+	buffer.
+
+2004-07-12  Sven Neumann  <sven@gimp.org>
+
+	* app/Makefile.am: make sure that gimp-console is enabled for
+	'make dist'. Use it to dump the system gimprc and gimprc man-page.
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/text/gimptextundo.[ch]: removed member "guint time"...
+
+	* app/core/gimpundo.[ch]: ...and added it here.
+
+	* app/tools/gimptexttool.c (gimp_text_tool_apply): changed
+	accordingly. Reordered undo compression code to look like other
+	pieces of code which do undo compression.
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpundo.[ch]
+	* app/core/gimpitemundo.[ch]
+	* app/text/gimptextundo.[ch]: removed all _new() functions and
+	added properties and GObject::constructor() implementations
+	instead.
+
+	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added
+	"GType undo_gtype" parameter and allow to pass name-value pairs as
+	"...". Use the new GParameter utility functions to construct the
+	appropriate undo step with g_object_newv().
+
+	(gimp_image_undo_push_item): removed.
+
+	(gimp_image_undo_push_undo): removed. Merged its code back into
+	gimp_image_undo_push(), where it originally came from.
+
+	* app/core/gimpimage-undo-push.c
+	* app/core/gimpundostack.c
+	* app/paint/gimppaintcore-undo.c
+	* app/tools/gimptransformtool-undo.c
+	* app/widgets/gimpundoeditor.c: changed accordingly.
+
+2004-07-12  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-preview.c
+	* plug-ins/gfig/gfig-style.c
+	* plug-ins/gfig/gfig.c: some include cleanups. Use
+	libgimpbase/gimpwin32-io.h instead of defining W_OK explicitely.
+	Don't undef GTK_DISABLE_DEPRECATED except for gfig-preview.c.
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/script-fu/scripts/round-corners.scm: applied patch from
+	Dave Neary that changes the behavior from undo disable/enable to
+	using an undo group if the script doesn't work on a copy of the
+	image. Fixes bug #146344.
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	* menus/toolbox-menu.xml.in: applied patch from Brion Vibber
+	which adds <Toolbox>/Acquire/Paste as new. Fixes bug #147358.
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp-modules.c: don't do anything if gimp->no_interface
+	is TRUE.
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	Made the gimp-console binary compile.
+	Finishes core/GUI separation and fixes bug #71514:
+
+	* configure.in: removed the crazy-hacker warning for
+	--enable-gimp-console.
+
+	* app/Makefile.am: for gimp-console, copy app_procs.c to
+	app_procs_console.c and compile it instead of app_procs.c with
+	-DGIMP_CONSOLE_COMPILATION
+
+	* app/app_procs.[ch]: added some #ifndef GIMP_CONSOLE_COMPILATION
+	to skip GUI stuff for the gimp-console case.
+	Renamed app_gui_libs_init() to app_libs_init(), renamed
+	app_gui_abort() to app_abort() and added app_exit() so everything
+	that needs #ifdefs lives here now.
+
+	* app/main.c: changed accordingly.
+
+	* app/gui/gui.c (gui_abort): really abort (call exit()).
+
+2004-07-12  Sven Neumann  <sven@gimp.org>
+
+	* INSTALL: made the suggestion to use binary packages more
+	prominent, mention --enable-gimp-console.
+
+2004-07-12  Sven Neumann  <sven@gimp.org>
+
+	* app/sanity.[ch]: removed the gtk+ sanity check here ...
+
+	* app/gui/gui.c: ... and do it here from gui_libs_init().
+
+	* app/main.c: changed accordingly.
+
+2004-07-12  Sven Neumann  <sven@gimp.org>
+
+	* app/app_procs.s: don't use gtk_main() / gtk_main_quit() but run
+	our own main-loop like we already used to do when being run
+	non-interactively.
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdialogfactory.c
+	(gimp_dialog_factories_set_busy_foreach)
+	(gimp_dialog_factories_unset_busy_foreach): set/unset the busy
+	cursor on all windows which have widget->window, not only for
+	those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when
+	dialogs are hidden while the busy cursor is active and later shown
+	again.
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplay.c: added an "id" CONSTRUCT_ONLY
+	property. Some minor cleanup.
+
+2004-07-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/Makefile.am
+	* app/core/gimp-gui.[ch]: new files defining a GimpGui vtable
+	struct and contianing all the vtable wrapper functions. Reordered
+	and renamed some functions for consistency.
+
+	* app/core/gimp.[ch]: removed all the vtable code.
+
+	* app/gui/gui-vtable.c: changed accordingly.
+
+2004-07-12  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplay-foreach.c
+	(gimp_displays_get_dirty_images): remove images from the
+	container when they become clean. Should move to the Gimp object.
+
+	* app/gui/quit-dialog.c: some cosmetic changes.
+
+2004-07-12  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/tiff.c: applied a patch from Brion Vibber that
+	sets the 'Save color values from transparent pixels' insensitive
+	when there's no alpha channel.
+
+2004-07-11  Hans Breuer  <hans@breuer.org>
+
+	* **/makefile.msc : updated
+	  app/actions/makefile.msc app/menus/makefile.msc : (new files)
+	  app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST
+
+	* libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c
+	  app/widgets/gimppropwidgets.c : bumped compiler version check,
+	msvc6 still can't cast from unsigned __int64 to double
+
+	* app/actions/debug-actions.c : only use debug_*_callback
+	and thus debug_action if ENABLE_DEBUG_MENU
+
+	* app/core/gimpalette-import.c : added gimpwin32-io.h
+
+	* plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/
+
+	* plug-ins/common/screenshot.c : make it compile with msvc,
+	but still no win32 specific implementation ...
+
+2004-07-11  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/gfig/gfig-dobject.h: fix commit error that
+	broke build.
+
+2004-07-11  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/gfig/gfig-dialog.c
+	* plug-ins/gfig/gfig-dobject.[ch]
+	* plug-ins/gfig/gfig.c: added buttons to select an object, and
+	raise or lower the selected object; also a few minor cleanups.
+
+2004-07-11  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/widgets/gimpdevices.c (gimp_devices_check_change): Applied a
+	patch from Robert Ögren, moved here from toolbox_check_device().
+	Only change devices if the event came from a widget that accepts
+	extension events. Fixes bug #115774.
+
+2004-07-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp-utils.[ch] (gimp_parameters_append)
+	(gimp_parameters_append_valist)
+	(gimp_parameters_free): new utility functions which create and
+	destroy GParameter arrays for g_object_newv().
+
+	* app/gui/gui-vtable.c (gui_pdb_dialog_new): use them.
+
+2004-07-10  Michael Natterer  <mitch@gimp.org>
+
+	Removed any remaining GUI dependency from the PDB wrappers:
+
+	* app/core/gimp.[ch]: added vtable entries for the display and
+	help stuff.
+
+	* app/widgets/gimphelp.[ch]: renamed gimp_help() to
+	gimp_help_show().
+
+	* app/gui/gui-vtable.c: implement the new display and help vtable
+	entries.
+
+	* tools/pdbgen/pdb.pl
+	* tools/pdbgen/pdb/display.pdb
+	* tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp
+	object instead of using stuff from display/ and widgets/.
+
+	* tools/pdbgen/app.pl: removed bad hacks which enabled including
+	stuff from gui/, display/ and widgets/.
+
+	* app/Makefile.am: link widgets-enums.o, display-enums.o and
+	gimpdisplayoptions.o into the gimp-console binary because they are
+	needed for the config system and don't depend on any GUI stuff.
+
+	* app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/
+
+	* app/pdb/display_cmds.c
+	* app/pdb/help_cmds.c: regenerated.
+
+2004-07-10  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/quit-dialog.c (quit_dialog_new): let the labels line-wrap.
+
+2004-07-10  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplay-foreach.[ch]: added new function
+	gimp_displays_get_dirty_images().
+
+	* app/gui/quit-dialog.c: show a container treeview of all dirty
+	images in the quit dialog. Still work in progress...
+
+2004-07-09  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* gimp/plug-ins/gfig/gfig-circle.c
+	* gimp/plug-ins/gfig/gfig-dialog.c
+	* gimp/plug-ins/gfig/gfig-dobject.c
+	* gimp/plug-ins/gfig/gfig-ellipse.c
+	* gimp/plug-ins/gfig/gfig-poly.c
+	* gimp/plug-ins/gfig/gfig-preview.c
+	* gimp/plug-ins/gfig/gfig-star.c
+	* gimp/plug-ins/gfig/gfig-style.c
+	* gimp/plug-ins/gfig/gfig-style.h
+	* gimp/plug-ins/gfig/gfig.c
+	* gimp/plug-ins/gfig/gfig.h: Made FG, BG, and pattern fill work for
+	fillable objects; other miscellaneous cleanups and minor fixes.
+
+2004-07-09  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/gui.c: removed the quit dialog code here.
+
+	* app/gui/Makefile.am
+	* app/gui/quit-dialog.[ch]: added new files that hold the old code
+	for now.
+
+2004-07-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/pdb/procedural_db.c: #include <glib-object.h> instead of
+	<gtk/gtk.h>.
+
+2004-07-09  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/Makefile.am
+	* app/gui/brush-select.[ch]
+	* app/gui/font-select.[ch]
+	* app/gui/gradient-select.[ch]
+	* app/gui/palette-select.[ch]
+	* app/gui/pattern-select.[ch]: removed...
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimppdbdialog.[ch]
+	* app/widgets/gimpdataselect.[ch]
+	* app/widgets/gimpbrushselect.[ch]
+	* app/widgets/gimpgradientselect.[ch]
+	* app/widgets/gimppaletteselect.[ch]
+	* app/widgets/gimppatternselect.[ch]
+	* app/widgets/gimpfontselect.[ch]: ...and added here as a
+	hierarchy of widgets.
+
+	* app/widgets/gimpdatafactoryview.h: removed typdef
+	GimpDataEditFunc, it's in widgets-types.h now.
+
+	* app/gui/convert-dialog.c: changed accordingly.
+
+	* app/core/gimp.[ch]: added vtable entries for creating, closing
+	and setting PDB dialogs.
+
+	* app/gui/gui-vtable.c: implement the vtable entries using the new
+	widgets.
+
+	* tools/pdbgen/pdb/brush_select.pdb
+	* tools/pdbgen/pdb/font_select.pdb
+	* tools/pdbgen/pdb/gradient_select.pdb
+	* tools/pdbgen/pdb/palette_select.pdb
+	* tools/pdbgen/pdb/pattern_select.pdb: use the new functions of
+	the Gimp object to create / manage the selection dialogs. The
+	generated files don't depend on GUI stuff any longer.
+
+	* app/pdb/brush_select_cmds.c
+	* app/pdb/font_select_cmds.c
+	* app/pdb/gradient_select_cmds.c
+	* app/pdb/palette_select_cmds.c
+	* app/pdb/pattern_select_cmds.c: regenerated.
+
+2004-07-09  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/file-save-dialog.c (file_save_overwrite): improved text
+	of the dialog.
+
+2004-07-09  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpdialog.c (gimp_dialog_class_init): document
+	that "help-func" and "help-id" properties have been added for 2.2.
+
+2004-07-09  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphistogrameditor.c
+	(gimp_histogram_editor_menu_update): reverted my last change.
+	(gimp_histogram_editor_item_visible): fix the problem here instead.
+
+2004-07-08  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpdialog.c: removed "role" property because
+	GtkWindow has an equivalent property now. Added "help-func" and
+	"help-id" construct properties.
+
+	* app/widgets/gimptexteditor.c
+	* app/widgets/gimptooldialog.c
+	* app/widgets/gimpviewabledialog.c: removed calls to
+	gimp_help_connect() and pass help_func and help_id to
+	g_object_new().
+
+2004-07-08  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimphelpui.c (gimp_context_help): fixed typo in
+	API docs.
+
+2004-07-08  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist/Presets: converted the newlines in the
+	descriptions to whitespaces, so they'll simply wrap (in accordance
+	with making the description label wrappable).
+
+2004-07-08  Shlomi Fish  <shlomif@iglu.org.il>
+
+	* plug-ins/gimpressionist: Various Gimpressionist Cleanups. Made most
+	remaining non-static global variables static, and created functions
+	that manipulate them. Created new headers. Renamed some variables and
+	functions to make their names more menanigful.
+
+2004-07-08  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphistogrameditor.c
+	(gimp_histogram_editor_menu_update): set the active item of the
+	combo-box after changing the visibility filter.
+
+2004-07-08  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify):
+	same fix as below.
+
+2004-07-08  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify):
+	block gimp_prop_enum_combo_box_callback() before changing the
+	combo-box.
+
+2004-07-08  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpsessioninfo.c: only write aux-info for properties
+	that have been changed from their default values.
+
+	* app/widgets/gimphistogrameditor.c: some code cleanup.
+
+2004-07-08  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpselectiondata.[ch]: added a "const gchar *format"
+	parameter to gimp_selection_data_set_pixbuf() which selects the
+	format in which to encode the pixbuf (was defaulting to "png"
+	before).
+
+	* app/widgets/gimpclipboard.c: when copying, offer all formats which
+	are savable with GdkPixbuf. Added a GimpClipboard struct which is
+	attached to the Gimp and which stores all the persistent data
+	needed by the clipboard. Renamed some private functions.
+
+	(unfortunately this change breaks pasting to AbiWord:
+	 http://bugzilla.abisource.com/show_bug.cgi?id=7068)
+
+2004-07-08  Sven Neumann  <sven@gimp.org>
+	* app/config/gimpconfig-deserialize.c
+	* app/config/gimpconfig-serialize.c: removed redundant casts.
+
+	* app/widgets/gimpsessioninfo.[ch]: added convenience functions to
+	get and set aux-info based on object properties.
+
+	* app/widgets/gimphistogrameditor.c: use the new functions to save
+	a histogram's channel and scale in the sessionrc.
+
+2004-07-07  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpclipboard.c: sort the list of pixbuf formats so
+	that PNG is the preferred format and GIF and JPEG come last.
+
+2004-07-07  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/gfig/*.[ch]: Use single centralized functions to
+	create, load, and save objects, instead of separate functions
+	for each type of object. A few other miscellaneous fixes.
+
+2004-07-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpclipboard.[ch]: changed to allow pasting any
+	GdkPixbuf supported format (makes pasting from OpenOffice
+	work). Cleaned up a bit to perpare pasting of SVG data.
+
+2004-07-07  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimplayer.c (gimp_layer_new_from_tiles): add an alpha
+	channel if the src tile-manager doesn't have one. Warn on
+	unsupported type conversions instead of silently doing the wrong
+	thing. Fixes bug #145482.
+
+	* app/core/gimpbuffer.c: cosmetics.
+
+2004-07-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/Makefile.am
+	* app/gui/clipboard.[ch]: removed...
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpclipboard.[ch]: ...and added here.
+
+	* app/actions/edit-commands.c
+	* app/gui/gui.c: changed accordingly.
+
+2004-07-07  Michael Natterer  <mitch@gimp.org>
+
+	Made the undo system robust against the currently pushed undo
+	being too large according to prefs settings. Fixes bug #145379.
+
+	* app/core/gimpimage-undo.[ch] (gimp_image_undo_push_undo)
+	(gimp_image_undo_group_end): emit "undo-event" *before* calling
+	gimp_image_undo_free_space() so the undo history doesn't try to
+	remove an item that has never been added.
+
+	(gimp_image_undo_push_undo): added boolean return value indicating
+	if the undo could be pushed (FALSE means the undo was to large
+	and was discarded right away).
+
+	(gimp_image_undo_push_item): return NULL if the above returned
+	FALSE.
+
+	* app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer):
+	changed accordingly.
+
+2004-07-07  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/jpeg.c: Don't try to load EXIF data if any warnings
+	happened, cause that likely means corruption and libexif doesn't
+	handle that very happily. Addresses bug #145212. Perhaps the error and
+	warning messages should be propagated to the user in the GUI somehow,
+	currently they are not.
+
+2004-07-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/edit-actions.c (edit_actions): added "..." to "Clear
+	undo history" because it has a confirmation dialog.
+
+	* app/actions/edit-commands.c: cleanup: moved static functions to
+	the end of the file and prototyped them.
+
+2004-07-07  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphistogramview.c (gimp_histogram_view_expose):
+	fixed a drawing bug I introduced earlier today.
+
+2004-07-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/view-actions.c
+	* app/actions/view-commands.[ch]: added actions and callbacks for
+	scrolling the view. Not used in menus but useful for controllers.
+
+2004-07-07  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpeditselectiontool.c
+	(gimp_edit_selection_tool_key_press): adapt the arrow key velocity
+	to the display scale factor. Please test and complain if you
+	dislike this behaviour.
+
+	* themes/Default/images/Makefile.am
+	* themes/Default/images/stock-color-pick-from-screen-16.png: new
+	icon drawn by Jimmac.
+
+	* libgimpwidgets/gimpstock.[ch]: register the new icon.
+
+	* libgimpwidgets/gimppickbutton.c: use it for the screen color
+	picker instead of reusing the color picker tool icon.
+
+2004-07-06  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/gfig/*.[ch]:  a bunch of code clean-up and
+	debugging.  Created "classes" for the objects, and
+	attached functions to classes rather than objects.
+
+2004-07-06  Sven Neumann  <sven@gimp.org>
+
+	Added an RGB histogram based on a patch by Tor Lillqvist. Fixes
+	bug #145401.
+
+	* app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export
+	it to the PDB.
+
+	* app/base/gimphistogram.c: implemented histogram functions for
+	the RGB mode.
+
+	* app/base/levels.c
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimplevelstool.c
+	* app/widgets/gimpcolorbar.c
+	* app/widgets/gimphistogrameditor.c: handle the new enum value.
+
+	* app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode,
+	draw a histogram that shows the RGB channels simultaneously
+
+2004-07-06  Sven Neumann  <sven@gimp.org>
+
+	* libgimpmodule/gimpmodule.c: comply with C99 aliasing rules.
+
+2004-07-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
+	(gimp_button_menu_position): call gtk_menu_set_monitor() only
+	for GTK+ < 2.4.4 and added a #warning about it.
+
+2004-07-06  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gimpressionist: applied patch from Shlomi Fish that
+	fixes confusion of filenames and user-visible object names (bug
+	#132621). Also removed function remove_trailing_whitespace() that
+	used to duplicate functionality from GLib and updated
+	preset_create_filename().
+
+2004-07-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimppreviewrenderer.c
+	(gimp_preview_renderer_set_viewable): queue an idle update when
+	setting the viewable to NULL so the view gets cleared correctly.
+
+	(gimp_preview_renderer_idle_update): call
+	gimp_preview_renderer_update() even if renderer->viewable is NULL
+	so clearing the viewable gets propagated to the GUI.
+
+	Moved clearing the viewable and removing the idle from
+	GObject::finalize() to GObject::dispose() because calling
+	set_viewable() with a NULL viewable triggers typechecking casts
+	and queuing idle functions, which is not nice in finalize().
+
+2004-07-06  Sven Neumann  <sven@gimp.org>
+
+	* modules/Makefile.am (libcdisplay_proof_la_LIBADD): added back
+	$(LCMS_LIBS) that I had accidentally removed.
+
+2004-07-06  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg):
+	return the proper type.
+
+2004-07-06  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainertreeview.c: connect to
+	"editing-canceled" of the name cell renderer and restore the
+	original text in the callback. Doesn't work reliably until GTK+
+	bug #145463 is fixed.
+
+2004-07-05  Sven Neumann  <sven@gimp.org>
+
+	* app/plug-in/plug-in-rc.c (plug_in_icon_deserialize): fixed a
+	compiler warning.
+
+	* plug-ins/common/dog.c: removed some redundant casts and other
+	trivial cleanups.
+
+2004-07-06  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcontroller.h: removed #define
+	GIMP_CONTROLLER_PARAM_SERIALIZE.
+
+	* libgimpmodule/gimpmoduletypes.h: added
+	GIMP_MODULE_PARAM_SERIALIZE instead.
+
+	* modules/controller_linux_input.c
+	* modules/controller_midi.c: changed accordingly.
+
+	* modules/cdisplay_colorblind.c
+	* modules/cdisplay_gamma.c
+	* modules/cdisplay_highcontrast.c
+	* modules/cdisplay_proof.c: made the new properties serializable.
+
+2004-07-05  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/Makefile.am (enum_headers): don't scan
+	app/paint-funcs/paint-funcs-types.h for enums.
+
+	* app/paint-funcs/paint-funcs-types.h: removed /*< pdb-skip >*/
+
+	* app/core/core-types.h: reordered opaque typedefs to somehow
+	match the categories in the comments.
+
+2004-07-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-types.h: removed enum SizeType.
+
+	* app/text/text-enums.h: added it as enum GimpSizeType and added
+	comment that it's for backward compatibility only.
+
+	* tools/pdbgen/Makefile.am
+	* tools/pdbgen/pdb/text_tool.pdb: changed accordingly.
+
+	* libgimp/gimpenums.h
+	* plug-ins/pygimp/gimpenums.py
+	* plug-ins/script-fu/script-fu-constants.c
+	* tools/pdbgen/enums.pl: regenerated (pdbgen insisted on
+	reordering the enums).
+
+2004-07-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-types.h: #define MIN and MAX values for
+	GimpCoords.pressure, .tilt and .wheel.
+
+	* app/display/gimpdisplayshell-callbacks.c
+	(gimp_display_shell_get_event_coords)
+	(gimp_display_shell_get_device_coords): use the #defines instead
+	of hardcoded magic values when CLAMP()ing event or device values.
+
+2004-07-05  Sven Neumann  <sven@gimp.org>
+
+	* modules/Makefile.am: link all modules with libgimpmodule.
+
+2004-07-05  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/dog.c: improved defaults.  use gimp_invert()
+	instead of rolling own.  Use nasty hack to get previews to
+	work with grayscale images.  Accept grayscale images.
+
+2004-07-05  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdata.[ch] (gimp_data_create_filename): Removed the
+	basename parameter and use the object name instead. Convert it to
+	the filesystem encoding.
+
+	* app/core/gimpdatafactory.c: changed accordingly.
+
+2004-07-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gimpressionist: applied patch from Shlomi Fish that
+	fixes a number of bugs in the gimpressionst plug-in (bug #145309).
+
+	Also added some const qualifiers, cleaned up includes and removed
+	degtorad() and radtodeg() functions that used to duplicate
+	functionality from libgimpmath.
+
+2004-07-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimptemplateview.c
+	(gimp_template_view_tree_name_edited): removed unused local variables.
+
+2004-07-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig-dialog.c: don't g_free() a GdkPixbuf, it's an
+	object. Removed trailing whitespace.
+
+	* plug-ins/gfig/gfig-preview.c (draw_background): fixed declaration.
+
+2004-07-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpcolorizetool.c (gimp_colorize_tool_initialize):
+	return TRUE if initialization was successful. Makes the
+	tool->drawable pointer being set correctly by the calling code and
+	fixes bugs where colorize was leaving the drawable in a modified
+	but non-undoable state when cancelling or changing images.
+
+2004-07-05  Sven Neumann  <sven@gimp.org>
+
+	* modules/cdisplay_proof.c: use object properties for the
+	configurable values.
+
+2004-07-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpchannel.[ch]: added signal "color-changed" and emit
+	it in gimp_channel_set_color() and gimp_channel_set_opacity().
+
+	* app/core/gimpimage-qmask.[ch]: added new functions
+	gimp_image_set,get_qmask_color().
+
+	* app/core/gimpimage.[ch]: install a "color-changed" handler on
+	gimage->channels and update gimage->qmask_color when the qmask's
+	color changes. Fixes bug #145361.
+
+	* app/actions/qmask-commands.c: use the new qmask color API.
+
+2004-07-04  Simon Budig  <simon@gimp.org>
+
+	* app/actions/dialogs-commands.c
+	* app/display/gimpdisplayshell-dnd.c
+	* app/gui/preferences-dialog.c
+	* app/tools/gimppainttool.c
+	* app/widgets/gimpdeviceinfo.c
+	* app/widgets/gimpitemtreeview.c
+	* plug-ins/imagemap/imap_selection.c
+	* tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP
+	CVS compile with gcc 2.95 again. Mostly double semicolons and
+	variable declarations after other stuff. Spotted by Martin
+	Renold.
+
+	* app/pdb/gradients_cmds.c: regenerated.
+
+	(there is one issue left, see his patch at
+	http://old.homeip.net/martin/gcc-2.95.diff, I did not
+	copy the #define va_copy __va_copy, since I don't know
+	what happens here.)
+
+2004-07-04  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/gfig/gfig-dialog.[ch]:
+	* plug-ins/gfig/gfig-style.[ch]:
+	* plug-ins/gfig/notes.txt:       New files.
+	* plug-ins/gfig/*.[ch]:  Complete reworking of the gfig plug-in.
+	See 'notes.txt' for a summary of what has changed, and how to use
+	it now.  Plenty of bugs have been  introduced, which will take a
+	while to straighten out.
+
+2004-07-04  Tor Lillqvist  <tml@iki.fi>
+
+	* app/core/gimpdrawable-equalize.c (gimp_drawable_equalize): Drop
+	a couple of unused variables.
+
+	* libgimpmodule/gimpmodule.def: Add gimp_module_register_enum.
+
+2004-07-04  Sven Neumann  <sven@gimp.org>
+
+	* libgimpmodule/gimpmodule.[ch]: added gimp_module_register_enum(),
+	a function to register an enum type for a GTypeModule.
+
+	* modules/cdisplay_colorblind.c: use an object property for the
+	color deficiency enum.
+
+2004-07-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/channel_mixer.c: don't attempt to store a
+	pointer to the last used filename in the plug-in parameter
+	struct. Fixes bug #145380.
+
+2004-07-04  Sven Neumann  <sven@gimp.org>
+
+	* modules/cdisplay_gamma.c
+	* modules/cdisplay_highcontrast.c: added object properties for
+	configurable values.
+
+	* app/widgets/gimpcolordisplayeditor.c
+	* libgimpwidgets/gimpcolordisplaystack.c
+	* modules/cdisplay_colorblind.c
+	* modules/cdisplay_proof.c: cosmetic changes.
+
+2004-07-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpcontext.[ch]: added context->serialize_props mask
+	which enables specifying exactly which properties will be
+	serialized. Also fixes a bug that prevented undefined properties
+	from being serialized, breaking tool_options and device status
+	serialization.
+
+	* app/core/gimptoolinfo.c (gimp_tool_info_new): make only the
+	properties in the tool_info->context_props mask serializable, also
+	configure/initialize tool_info->tool_options.
+
+	* app/tools/gimp-tools.c (gimp_tools_register): removed
+	tool_options initialization that is now done in
+	gimp_tool_info_new().
+
+	* app/widgets/gimpdeviceinfo.c: make only the properties in
+	GIMP_DEVICE_INFO_CONTEXT_MASK serializable.
+
+	* app/widgets/gimpdevicestatus.c: add the device table to its
+	parent container again. Fixes "missing" devices.
+
+	* app/core/gimptooloptions.c
+	* app/widgets/gimpdevices.c: cleanup / code review.
+
+2004-07-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): if
+	the color tool is enabled, skip cursor hiding entirely.
+
+2004-07-03  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/dog.c (dog): removed #ifdef'ed code that isn't
+	any longer needed.
+
+2004-07-02  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/tools/gimptransformoptions.[ch]:
+	* app/tools/gimptransformtool.c:
+	* app/tools/tools-enums.[ch]: Replaced "Preview" checkbutton with
+	a combobox with options "Outline", "Grid", "Image", and
+	"Image + Grid". Addresses bug #108172.
+
+2004-07-02  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/edit-actions.c: don't let the Paste menu items
+	sensitivity depend on the availability of clipboard data because
+	we aren't notified when the GDK clipboard changes.
+
+2004-07-02  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/Makefile.am
+	* app/gui/clipboard.[ch]: new files implementing a clipboard for
+	image data based on GDK_SELECTION_CLIPBOARD (bug #133247).
+
+	* app/actions/edit-actions.c
+	* app/actions/edit-commands.c: use the new clipboard API.
+
+	* app/gui/gui.c: initialize and shutdown the clipboard.
+
+	* app/core/gimpbuffer.c: cosmetics.
+
+	* app/actions/actions.c
+	* app/menus/menus.c: added sanity checks to exit functions.
+
+	* app/display/gimpdisplayshell-dnd.[ch]: let
+	gimp_display_shell_drop_svg() take a guchar * buffer.
+
+	* app/widgets/gimpselectiondata.c (gimp_selection_data_get_pixbuf):
+	fixed the implementation.
+
+2004-07-02  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/gimpressionist/Makefile.am
+	* plug-ins/gimpressionist/*.[ch]: applied patch from Shlomi Fish
+	that massively cleans up gimppressionist (touching all files and
+	addding some new ones) and adds a simple PDB interface for
+	selecting one of the previously created presets.
+	Fixes bugs #145191, #144913 and #144922.
+
+2004-07-01  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: bumped version number to 2.1.2.
+
+2004-07-01  Michael Schumacher  <schumaml@cvs.gnome.org>
+
+	* plug-ins/common/align_layers.c: there seems to be no reason why
+	this plug-in should not work on INDEXED* images, added it to the
+	registered image types
+
+2004-07-01  Roman Joost <roman@bromeco.de>
+
+	* plug-ins/script-fu/scripts/blend-anim.scm
+	* plug-ins/script-fu/scripts/glossy.scm
+	* plug-ins/script-fu/scripts/test-sphere.scm: fixed typos
+
+2004-07-01  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpselectiondata.[ch]: added (yet unused) functions
+	gimp_selection_data_[get|set]_pixbuf().
+
+2004-07-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpfgbgarea.[ch]: implement GtkWidget::drag_motion()
+	and set the FG/BG depending on where the color was dropped. Also
+	set the drag status accordingly so the cursor indicates whether
+	dropping will have an effect or not. Fixes bug #145219.
+
+2004-07-01  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimptemplate.c: do like Liam taught us and use the
+	golden ratio as default for new images.
+
+2004-06-30  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/tools/gimppainttool.c (gimp_paint_tool_cursor_update):
+	Chain up if the color tool is enabled. This fixes the problem of
+	the color picker cursor not appearing when using a paint tool
+	in color picking mode while "Show Paint Tool Cursor" is off.
+
+2004-06-30  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* libgimp/gimpdrawable.c: moved call to
+	_gimp_tile_cache_flush_drawable() from gimp_drawable_detach() to
+	gimp_drawable_flush(), to resolve problem described in bug
+	#145051.
+
+2004-06-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-ins.[ch] (plug_ins_init): added a GimpContext
+	parameter and use it to start plug-ins.
+
+	* app/core/gimp.c (gimp_real_restore): pass the user context.
+	Restores script-fu's access to the global FG, FG, brush, ...
+
+2004-06-30  Sven Neumann  <sven@gimp.org>
+
+	* app/core/core-enums.c
+	* app/display/display-enums.c
+	* app/paint/paint-enums.c
+	* app/text/text-enums.c
+	* app/widgets/widgets-enums.c: regenerated.
+
+2004-06-30  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/actions/file-commands.c: revert previous change that was
+	intended to fix bug #141971.
+
+2004-06-30  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/*/*-enums.h: did HIG-compliant capitalization in the right
+	place, instead of the auto-generated *-enums.c files.
+
+2004-06-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdnd.[ch]
+	* app/widgets/gimpselectiondata.[ch]
+	* app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris"
+	to "uri_list" in all function names, parameters and typedefs.
+
+	* app/widgets/gimpcontainertreeview-dnd.c
+	* app/widgets/gimpdocumentview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimptoolbox-dnd.c
+	* app/display/gimpdisplayshell-dnd.[ch]
+	* app/display/gimpdisplayshell.c: changed accordingly.
+
+2004-06-30  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/maze/maze_face.c: made the dialog look a little less
+	clumsy.
+
+2004-06-30  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/drawable.pdb
+	* libgimp/gimppixbuf.c: raised the maximum size for thumbnails
+	from 256 to 512 pixels.
+
+	* app/pdb/drawable_cmds.c
+	* libgimp/gimpdrawable_pdb.c: regenerated.
+
+	* plug-ins/gfig/gfig-preview.c
+	* plug-ins/gfig/gfig.c: redone Bill's fix using
+	gimp_image_get_thumbnail(). A lot simpler, renders the alpha
+	checkerboard and also works for grayscale images.
+
+2004-06-30  Michael Natterer  <mitch@gimp.org>
+
+	Fixed a 1.2 -> 2.0 regression that was forgotten:
+
+	* app/widgets/widgets-enums.[ch]: added enum GimpColorPickState
+	which can be one of { NEW, UPDATE }.
+
+	* app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function
+	gimp_palette_editor_update_color() to
+	gimp_palette_editor_pick_color() and restored the functionality of
+	creating/updating colors via this API
+
+	Changed button_press handler to only edit the color on double
+	click if it's really a double click on the same color.
+	Fixes bug #141381.
+
+	* app/tools/gimpcolorpickeroptions.[ch]: added boolean property
+	"add-to-palette" and a GUI for it.
+
+	* app/core/gimpmarshal.list
+	* app/tools/gimpcolortool.[ch]: added a GimpColorPickState
+	parameter to the "color_picked" signal. Pass NEW on button_press
+	and UPDATE on motion.
+
+	* app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked)
+	* app/tools/gimplevelstool.c (gimp_levels_tool_color_picked)
+	* app/tools/gimppainttool.c (gimp_paint_tool_color_picked):
+	changed accordingly
+
+	* app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked):
+	If "add-to-palette" is TRUE, get the palette editor and call
+	gimp_palette_editor_pick_color().
+
+2004-06-30  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpselectiondata.[ch]: renamed the SVG related
+	functions so that they deal with an anonymous data stream that
+	could as well be a PNG image.
+
+	* app/widgets/gimpdnd.[ch]
+	* app/widgets/gimpcontainertreeview-dnd.c: changed accordingly.
+
+	* app/display/gimpdisplayshell-dnd.[ch]
+	* app/vectors/gimpvectors-import.[ch]
+	* app/widgets/gimpcontainertreeview-dnd.c
+	* app/widgets/gimpvectorstreeview.c: use gsize for the length of
+	the buffer.
+
+	* app/widgets/gimpdnd.[ch]
+	* app/widgets/widgets-enums.[ch]: added GIMP_DND_TYPE_PNG which isn't
+	used yet.
+
+2004-06-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimppalette.[ch] (gimp_palette_add_entry): take
+	const GimpRGB* instead of just GimpRGB*.
+	Converted tabs to spaces.
+
+2004-06-30  Michael Natterer  <mitch@gimp.org>
+
+	* widgets/gimpselectiondata.[ch] (gimp_selection_data_get_svg):
+	changed return value from gchar* to const gchar*. Renamed
+	parameters to be consistent with other SVG functions.
+
+	* widgets/gimpcontainertreeview-dnd.c
+	* widgets/gimpdnd.c: changed accordingly.
+
+2004-06-30  Simon Budig  <simon@gimp.org>
+
+	* app/vectors/gimpstroke.[ch]
+	* tools/pdbgen/pdb/paths.pdb: Applied a modified patch from
+	Geert Jordaens that implements the gimp-path-get-point-at-dist
+	PDB function (fixes bug #138754).
+
+	* app/pdb/paths_cmds.c: regenerated.
+
+2004-06-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed):
+	do like GtkAccelLabel does and turn underscores in accels into
+	spaces so e.g. "Page_Up" becomes "Page Up".
+
+2004-06-29  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell.c: reordered drop destinations
+	so vectors are preferred over SVG.
+
+	* app/vectors/gimpvectors-import.[ch]: added "gint position"
+	parameter to all import functions so the imported vectors can be
+	added at any position in the vectors stack.
+
+	* app/actions/vectors-commands.c
+	* app/display/gimpdisplayshell-dnd.c
+	* tools/pdbgen/pdb/paths.pdb: changed accordingly (pass -1 as
+	position).
+
+	* app/pdb/paths_cmds.c: regenerated.
+
+	* app/widgets/gimpvectorstreeview.c: implemented SVG DND from and
+	to the paths dialog.
+
+2004-06-29  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainertreeview-dnd.c: don't free the SVG data
+	after dropping, it's owned by GtkSelectionData.
+
+2004-06-29  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdnd.c: use gtk_target_list_add() instead of
+	gtk_target_list_add_table() because the latter prepends the
+	targets to the internal list which screws the order (== priority)
+	of DND targets.
+
+	* app/widgets/gimpselectiondata.c: added some more checks for
+	failed drops (selection_data->length < 0).
+
+2004-06-29  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/unsharp.c: The preview's row buffer was
+	accidentally made way too large.
+
+2004-06-29  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpwidgets-utils.[ch]: added new function
+	gimp_get_mod_string() which takes a GdkModifierType and returns
+	correctly formated strings for all shift,control,alt combinations.
+
+	* app/tools/gimpbucketfilloptions.c
+	* app/tools/gimpcolorpickeroptions.c
+	* app/tools/gimpconvolvetool.c
+	* app/tools/gimpcropoptions.c
+	* app/tools/gimpdodgeburntool.c
+	* app/tools/gimperasertool.c
+	* app/tools/gimpflipoptions.c
+	* app/tools/gimpmagnifyoptions.c
+	* app/tools/gimpmoveoptions.c
+	* app/tools/gimptransformoptions.c
+	* app/tools/gimpvectoroptions.c
+	* app/widgets/gimpchanneltreeview.c
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimpdocumentview.c
+	* app/widgets/gimperrorconsole.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimppaletteeditor.c
+	* app/widgets/gimpselectioneditor.c
+	* app/widgets/gimpthumbbox.c
+	* app/widgets/gimptooloptionseditor.c
+	* app/widgets/gimpvectorstreeview.c: use the new function instead
+	of gimp_get_mod_name_shift(),control(),alt(),separator(). This
+	kindof addresses the issue of configurable modifier keys but is
+	actually indended to ease translation of format strings ("%s" is
+	easier to get right than "%s%s%s").
+
+2004-06-28  Michael Natterer  <mitch@gimp.org>
+
+	Allow all sorts of things to be dropped on or in between the
+	items of a GimpContainerTreeView:
+
+	* app/widgets/gimpcontainertreeview.[ch]: added more parameters to
+	GimpContainerTreeView::drop_possible() to specify where ecactly
+	the drop should take place (between or into items) and to support
+	dropping all sorts of things.
+
+	Renamed ::drop() to ::drop_viewable() and added ::drop_color(),
+	::drop_files() and ::drop_svg(), which cover all possible drop
+	types.
+
+	* app/widgets/gimpcontainertreeview-dnd.[ch]: changed accordingly.
+	Dispatch all kinds of drops to the resp. virtual functions.
+
+	* app/widgets/gimpitemtreeview.c: changed accordingly.
+
+	* app/widgets/gimplayertreeview.c: allow to drop URIs, colors
+	and patterns to the layers dialog. Fixes bugs #119506 and #139246.
+
+2004-06-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/file/file-open.[ch] (file_open_layer): new utility function
+	which opens an image, flattens it if needed and returns the only
+	layer, converted for a passed destination image.
+
+	* app/display/gimpdisplayshell-dnd.c
+	(gimp_display_shell_drop_files): use the new function.
+
+2004-06-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpselectiondata.[ch]: new files containing the
+	code which encodes/decodes all sorts of stuff to/from its
+	GtkSelectionData representation. Used to live in gimpdnd.c
+
+	* app/widgets/gimpdnd.c: use the new functions (unclutters the
+	file quite a bit), converted tabs to spaces.
+
+2004-06-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainergridview.c:
+	#include "libgimpwidgets/gimpwidgets.h"
+
+2004-06-28  Michael Natterer  <mitch@gimp.org>
+
+	Fixed bug #141930 while keeping bug #132322 fixed:
+
+	* app/base/curves.c (curves_lut_func)
+	* app/base/levels.c (levels_lut_func): changed meaning of channel
+	slots for GRAYA images: just as for GRAY images, expect the value
+	channel in slot 0 and the alpha channel in slot 1, so it matches
+	the meaning of slots of GimpHistogram (before this change, only
+	GRAY images had their value in slot 0 and GRAYA images had it in
+	slot 1, whereas the histogram had the value channel in slot 0,
+	which was breaking auto levels for GRAYA images).
+
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimplevelstool.c
+	* tools/pdbgen/pdb/color.pdb: adjusted channel fiddling for GRAY
+	and GRAYA images accordingly.
+
+	* app/tools/gimpcurvestool.c (curves_update)
+	* app/tools/gimplevelstool.c (levels_update): call
+	gimp_color_bar_set_buffers() with the right buffers.
+
+	* app/pdb/color_cmds.c: regenerated.
+
+2004-06-28  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/gui.c (gui_initialize_after_callback): select the
+	standard tool.
+
+	* app/tools/tool_manager.c: cosmetics.
+
+2004-06-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimplevelstool.c: reverted fix for bug #141930. These
+	hacks are there because the enum used in levels doesn't match
+	the enum used by the combo box and the histogram widget.
+
+2004-06-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpclonetool.c (gimp_clone_tool_button_release):
+	removed again (tools must not draw outside GimpDrawTool::draw()).
+
+	(gimp_clone_tool_draw): removed check for gimp_draw_tool_is_active()
+	because the draw function would not be called if the draw tool was
+	inactive. Simplified check for whether or not to draw the src
+	location.
+
+	* app/tools/gimppainttool.c (gimp_paint_tool_button_release):
+	pause/resume the draw tool across all button_release actions so
+	tools (clone) have a chance to draw different things depending on
+	gimp_tool_control_is_active(tool->control). Fixes bug #145022.
+
+2004-06-28  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/actions.c (action_select_object): added missing
+	return value.
+
+2004-06-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/dog.c: applied HIG rules to the GUI and slightly
+	rearranged it to get a more compact layout. Applied GIMP coding
+	style.
+
+2004-06-28  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawable.c: removed wrong note about using
+	_gimp_tile_cache_flush_drawable() from the API docs.
+
+2004-06-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/dog.c (dog): ifdef'ed out calls to
+	_gimp_tile_cache_flush_drawable() since it can't be used from a
+	plug-in. Removed trailing whitespace and redundant includes.
+
+	* libgimp/gimp.def: removed _gimp_tile_cache_flush_drawable again.
+
+2004-06-28  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimpvectortool.c: fixed drawing code to properly
+	update after deleting nodes via BackSpace/Delete.
+
+2004-06-27  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimplevelstool.c: removed two small chunks of code.
+	Fixes bug #141930.  Possibly unfixes bug #132322.
+
+2004-06-27  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* libgimp/gimp.def: added _gimp_tile_cache_flush_drawable because
+	it is used in a plug-in. See bug #145051.
+
+2004-06-26  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/unsharp.c: Preview now works correctly with
+	RGBA and grayscale-alpha images. Fixes bug #144971.
+
+2004-06-26  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimpclonetool.c: added button_release callback
+	to fix bug #145022.
+
+2004-06-26  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/unsharp.c: Use GTK_PREVIEW_GRAYSCALE if source
+	is grayscale or grayscale-alpha. Partial fix for bug #144971.
+
+2004-06-25  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/unsharp.c: speed up preview by allocating tile
+	cache before creating dialog.  Should fix bug #144972.
+
+2004-06-25  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* plug-ins/common/zealouscrop.c: Moved Zealous Crop from
+	<Image>/Layer/Crop to <Image>/Image/Crop because it affects the
+	entire image.
+
+2004-06-25  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/dog.c: added Difference of Gaussians edge
+	detect plug-in.
+
+	* plug-ins/common/plugin-defs.pl:
+	* plug-ins/common/Makefile.am: added dog and regenerated
+	Makefile.
+
+2004-06-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/context-actions.c: added GIMP_ACTION_SELECT_SET
+	actions which set a generated brush's properties directly.
+
+	* app/actions/context-commands.c: adjust the range of possible
+	brush radius and aspect_ratio values to be actually usable.
+
+2004-06-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpbrushgenerated.[ch]: reordered parameters and
+	members to be consistent with other places where generated
+	brushes are used. Check for errors when loading a brush and
+	utf8-validate its name. Cleanup.
+
+	* app/core/gimpbrush.c
+	* app/core/gimpbrushpipe.c: cleanup.
+
+2004-06-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/preferences-dialog.c (prefs_dialog_new): work around
+	GTK+ bug #143270 (set the cursor on the selected model path
+	instead of selecting the iter in the selection). Fixes random
+	theme switching when selecting the "Theme" page.
+
+2004-06-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpbrushgenerated.c: added properties for all brush
+	parameters.
+
+	* app/widgets/gimpbrusheditor.c: listen to property changes of the
+	edited brush and update the scales accordingly.
+
+2004-06-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/preferences-dialog.c: more work on the controller page,
+	made integer controller properties editable.
+
+	* modules/controller_midi.c: allow to specify the MIDI channel to
+	generate events from. Default to -1 (all channels).
+
+2004-06-24  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/gfig/gfig.[ch]:
+	* plug-ins/gfig/gfig-preview.c: Let gfig use a thumbnail of the
+	image as background for its preview, if the image is RGB and "Show
+	image" is checked in the Options tab.  (Next best thing to
+	previewing in the image.)
+
+2004-06-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontrollerinfo.[ch]: added a boolean property
+	"debug-events" and honor it when printing debugging output.
+	Should add an event console window so the user doesn't need to
+	have a terminal to inspect input module output.
+
+	* app/gui/prefereces-dialog.c: HIGified some forgotten labels.
+	Renamed the "Pointer Movement Feedback" frame to "Mouse Cursors".
+	Replaced some forgotten "Dir" with "Folder".
+	Made more GimpControllerInfo and GimpController properties
+	editable and cleaned up the controller page.
+
+2004-06-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimppropwidgets.[ch]: added gimp_prop_label_new().
+
+	* app/widgets/gimpgrideditor.c: HIGified capitalization.
+
+2004-06-25  Michael Natterer  <mitch@gimp.org>
+
+	* modules/controller_linux_input.c
+	* modules/controller_midi.c: remember the source ID returned by
+	g_io_add_watch() and remove it when changing the device, so the
+	file descritor gets actually closed. Minor cleanups.
+
+2004-06-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontrollerwheel.[ch]: renamed function
+	gimp_controller_wheel_scrolled() to
+	gimp_controller_wheel_scroll().
+
+	* app/display/gimpdisplayshell-callbacks.c
+	(gimp_display_shell_canvas_tool_events): changed accordingly.
+
+2004-06-24  Michael Natterer  <mitch@gimp.org>
+
+	* etc/controllerrc: fix typo in wheel controller mapping.
+
+2004-06-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimptool.[ch]
+	* app/tools/tool_manager.[ch]: added boolean return value to
+	GimpTool::key_press() which indicates if the event was handled.
+
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpeditselectiontool.[ch]
+	* app/tools/gimptransformtool.c
+	* app/tools/gimpvectortool.c: return TRUE if the key event was handled.
+
+	* app/tools/gimppainttool.c: removed key_press() implementation.
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcontrollerkeyboard.[ch]: new controller class
+	which takes GdkEventKey and emits controller events for all
+	combinations of modifiers and cursor keys.
+
+	* app/widgets/gimpcontrollers.[ch]: added new function
+	gimp_controllers_get_keyboard().
+
+	* app/display/gimpdisplayshell-callbacks.c: if a key event was not
+	handled by the active tool, dispatch it to the keyboard controller.
+
+	* etc/controllerrc: add a keyboard controller which is configured
+	to do the same as the removed gimp_paint_tool_key_press().
+
+2004-06-23  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* libgimp/gimpdrawable.c:  added some documentation for
+	a few important functions with no API docs.
+
+2004-06-24  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.1.1 release.
+
+2004-06-23  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/actions/file-commands.c: make "Revert" only ask for
+	confirmation if image is dirty.  Fixes bug #141971.
+
+2004-06-23  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/gui/*.c:
+	* app/widgets/*.c:
+	* etc/templaterc: HIGify capitalization.  Should finish bug #123699
+	except for everything I missed or got wrong.
+
+2004-06-24  Sven Neumann  <sven@gimp.org>
+
+	* etc/controllerrc: commented out the linux_input controller
+	configuration.
+
+2004-06-23  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/*.c: HIGify capitalization for dialogs.  More
+	progress on bug #123699.
+
+2004-06-23  Michael Natterer  <mitch@gimp.org>
+
+	* modules/controller_midi.c: added utility function midi_event()
+	which assembles a GimpControllerEventValue and emits it.
+
+2004-06-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpenumaction.[ch]
+	* app/widgets/gimppluginaction.[ch]
+	* app/widgets/gimpstringaction.[ch]: added parameters to the
+	gimp_*_action_selected() function so the "selected" signal can be
+	emitted with value != action->value. Changed GtkAction::activate()
+	implementations accordingly (pass action->value).
+
+	* app/widgets/gimpcontrollers.c: call gimp_enum_action_selected()
+	and pass the value of the GimpControllerEventValue instead of
+	temporarily replacing action->value and calling
+	gtk_action_activate().
+
+	* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
+
+2004-06-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimpbrushcore.[ch]: added signal "set-brush" which is
+	G_SIGNAL_RUN_LAST so we can connect before and after the default
+	implementation. Moved the brush setting and outline invalidation
+	stuff to its default implementation. Also remember the outline's
+	width and height. Call gimp_brush_core_set_brush() from
+	gimp_brush_core_invalidate_cache() so "set-brush" is emitted
+	whenever a generated brush becomes dirty.
+
+	* app/tools/gimppainttool.c (gimp_paint_tool_button_press): don't
+	pause/resume but rather stop/start the draw_tool. Fixes straight
+	line preview aretefacts.
+
+	(gimp_paint_tool_oper_update): set the brush_core's brush before
+	starting the draw_tool.
+
+	(gimp_paint_tool_draw): never free the brush_core's cached brush
+	outline because the brush_core does that by itself now.
+
+	(gimp_paint_tool_set_brush)
+	(gimp_paint_tool_set_brush_after): new callbacks which pause and
+	resume the draw_tool. Fixes brush outline artefacts when modifying
+	the current brush e.g. by using the mouse wheel.
+
+2004-06-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/context-commands.h: removed enum GimpContextSelectType.
+
+	* app/actions/actions-types.h: added enum GimpActionSelectType.
+
+	* app/actions/actions.[ch]: added utility functions
+	action_select_value() and action_select_object().
+
+	* app/actions/context-actions.c
+	* app/actions/context-commands.c: changed accordingly.
+
+	* app/actions/layers-actions.c
+	* app/actions/layers-commands.[ch]: merged the layer select
+	callbacks into one using the GimpActionSelectType functions. Added
+	actions and callbacks for modifying the active layer's opacity.
+
+	* app/menus/menus-types.h: #incude "actions/action-types.h".
+
+	* app/gui/gui-types.h: #incude "menus/menus-types.h".
+
+	* app/gui/preferences-dialog.c: allow to enable/disable input
+	controllers.
+
+2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimpcurvestool.c: try again to revert.
+
+2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimpcurvestool.c: reverted.
+
+2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/script-fu/scripts: HIG-ified capitalization on
+	all.  Finishes this for everything in plug-ins.  Bug #123699 is
+	now mostly fixed.
+
+2004-06-22  Sven Neumann  <sven@gimp.org>
+
+	* app/composite/gimp-composite-regression.c: define timersub()
+	macro in case it's undefined. Patch by Tim Mooney, fixes 'make
+	check' on Tru64 (bug #144780).
+
+2004-06-22  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimpcurvestool.c: added Store/Recall buttons for
+	one-click saving and loading of curves.  Should create stock
+	labels for them.  Hopefully resolves bug #75558.
+
+2004-06-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/view-actions.c
+	* app/actions/view-commands.[ch]: added actions & callbacks to
+	configure the canvas padding color.
+
+	* app/widgets/gimphelp-ids.h
+	* menus/image-menu.xml.in: added the actions' help IDs and menu entries.
+
+	* app/display/display-enums.h: added /*< skip >*/'ed enum value
+	GIMP_CANVAS_PADDING_MODE_RESET.
+
+	* app/display/gimpdisplayshell-appearance.c
+	* app/display/gimpdisplayshell-callbacks.[ch]
+	* app/display/gimpdisplayshell-handlers.c
+	* app/display/gimpdisplayshell.[ch]: removed the canvas padding
+	button and its popup menu (fixes bug #142996). Instead, added a
+	toggle button which allows to zoom the image when the window is
+	resized (as known from sodipodi, except it doesn't work as nice
+	yet :-) improvements to the algorithm are welcome).
+	Cleaned up the GimpDisplayShell struct a bit and renamed some
+	of its members.
+
+	* libgimpwidgets/gimpstock.[ch]
+	* themes/Default/images/Makefile.am
+	* themes/Default/images/stock-zoom-follow-window-12.png: added new
+	icon for the new display toggle button.
+
+2004-06-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpclonetool.c (gimp_clone_tool_draw): chain up
+	unconditionally now that we draw the brush outline while
+	painting. Fixes brush outline artefacts on button_press and
+	button_release. Spotted by sjburges.
+
+2004-06-22  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset
+	the filename if the image is unnamed.
+
+	* configure.in
+	* app/sanity.c: depend on gtk+ >= 2.4.1.
+
+	* app/widgets/gimpthumbbox.[ch]: changed gimp_thumb_box_set_uris()
+	to gimp_thumb_box_take_uris() since the function takes ownership
+	of the list,
+
+	* app/widgets/gimpfiledialog.c: changed accordingly. Removed code
+	that worked around a problem in gtk+ < 2.4.1.
+
+2004-06-22  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpcolorarea.c (gimp_color_area_set_color): use
+	gimp_rgb_distance() for flat color areas. Fixes bug #144786.
+
+2004-06-22  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/fileops.pdb: app/pdb/fileops_cmds.c is a
+	generated file, need to do the documentation change here.
+
+	* app/pdb/fileops_cmds.c
+	* libgimp/gimpfileops_pdb.c: regenerated.
+
+2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimptransformoptions.c: use radio buttons
+	for constraint options.  Makes all options visible,
+	should resolve bug #68106.
+
+2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/gui/file-save-dialog.c: to reduce clutter, hide overwrite
+	query dialog after user has responded.
+
+2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/noisify.c: changed handling of alpha
+	channel in an attempt to deal with bug #72853.
+	Changed menu entry from "Noisify" to "Scatter RGB".
+
+2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/pdb/fileops_cmds.c: fixed incorrect documentation for
+	gimp_file_load, which was the root cause of bug #118811.
+
+2004-06-21  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins: finish implementing HIG capitalization in dialogs.
+	Scripts remain to be done.  More progress on bug #123699.
+
+2004-06-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/widgets-enums.[ch] (enum GimpCursorFormat): removed
+	value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job
+	of GDK to do that (it was GDK that was broken, not some of the X
+	servers).
+
+	* app/widgets/gimpcursor.c (gimp_cursor_new): premultiply the
+	cursor's pixels for GTK+ < 2.4.4.
+
+2004-06-21  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/gui.c (gui_exit_callback): improved message in quit
+	dialog just in case that we don't manage to redo this dialog
+	before 2.2.
+
+2004-06-21  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.[ch]
+	* libgimpwidgets/gimpwidgets.def: added new utility function
+	gimp_label_set_attributes().
+
+	* app/display/gimpdisplayshell.c
+	* app/gui/preferences-dialog.c
+	* app/gui/resolution-calibrate-dialog.c
+	* app/widgets/gimpviewabledialog.c
+	* app/widgets/gimpwidgets-utils.c: use the new function.
+
+	* app/widgets/gimpcontainergridview.c
+	* app/widgets/gimphistogrameditor.c: display the name in italic.
+
+	* plug-ins/common/jpeg.c: display the file size in italic.
+
+2004-06-20  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/url.c: if url does not end in a recognized
+	extension, open it as an unnamed image.  Fixes bug #118811.
+
+2004-06-20  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphistogrambox.[ch]: removed the label between the
+	spinbuttons, it looks silly. Converted tabs to spaces, removed
+	trailing whitespace.
+
+	* app/widgets/gimphistogrameditor.c
+	* app/tools/gimpthresholdtool.c: changed accordingly.
+
+2004-06-19  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins:  changed dialogs to follow HIG capitalization style
+	wherever they didn't.  Scripts remain to be done.  Partially
+	fixes bug #123699.
+
+2004-06-19  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/widgets/gimphistogrambox.[ch]:
+	* app/tools/gimpthresholdtool.c: Changed the threshold tool dialog
+	so that it uses a two-triangle-slider scale of the sort used in the
+	levels tool.  Almost all of the changes are actually in the
+	histogram-box widget code, which is only used by the threshold
+	tool.  Fixes bug #137521.
+
+2004-06-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/jpeg.c: removed redundant hboxes and other
+	layout cleanups.
+
+2004-06-20  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/display/gimpdisplayshell-scale.[ch]:
+	* app/display/gimpnavigationview.[ch]:
+	* app/actions/view-actions.c:
+	* app/actions/view-commands.[ch]:
+	* app/widgets/gimphelp-ids.h:
+	* menus/image-menu.xml.in: Changed "Zoom to Fit Window" command
+	to "Fit Image in Window" and added another command, "Fit Image
+	to Window", that zooms according to the opposite dimension. Fixes
+	bug #144597.
+
+2004-06-19  Michael Schumacher  <schumaml@cvs.gnome.org>
+
+	* libgimpwidgets/gimpwidgets.def: added missing
+	gimp_controller_* entries
+
+2004-06-19  Michael Schumacher  <schumaml@cvs.gnome.org>
+
+	* modules/controller_midi.c: #ifdef G_OS_WIN32 for an O_NONBLOCK
+
+2004-06-19  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/jpeg.c: more changes to save dialog.  Moved
+	comment field to Advanced area.  Don't set restart marker
+	frequency stuff insensitive.  Changed range for quality
+	scale from 0-1 to 0-100 to follow the jpeg spec (but left
+	allowable range for pdb at 0-1 to avoid breaking anything).
+
+2004-06-19  Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimpscaletool.c: fixed my fix for bug # 68106, which
+	worked incorrectly for two of the control points.
+
+2004-06-19  Michael Natterer  <mitch@gimp.org>
+
+	* modules/controller_midi.c (midi_read_event): simplified
+	swallowing of SysEx messages and unwanted data bytes. Reordered
+	and commented stuff to be more readable.
+
+2004-06-19  Michael Natterer  <mitch@gimp.org>
+
+	* modules/Makefile.am
+	* modules/controller_midi.c: new controller for MIDI input. Maps
+	all note on and note off events and all MIDI controllers to
+	GimpContollerEvents. Should parse any MIDI stream. Code based on
+	blinkenmedia stuff from Daniel Mack.
+
+2004-06-19  Sven Neumann  <sven@gimp.org>
+
+	Applied a patch from Geert Jordaens that implements the
+	GtkStatusbar functionality in GimpStatusbar so that we can redo it
+	in order to fix bug #120175:
+
+	* app/core/gimpmarshal.list: added VOID: UINT, STRING.
+
+	* app/display/gimpstatusbar.[ch]: copied GtkStatusbar code.
+
+	* app/display/gimpdisplayshell.c: changed accordingly.
+
+2004-06-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/ifscompose/ifscompose_utils.c (create_brush): use
+	G_SQRT2; some coding style cleanups.
+
+2004-06-19  Sven Neumann  <sven@gimp.org>
+
+	* app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): moved
+	array initialization out of variable declaration (bug #144632).
+
+2004-06-19  Sven Neumann  <sven@gimp.org>
+
+	* app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): use
+	G_SQRT2 to make circlemagic a constant value so we can initialize
+	the array on declaration. Fixes bug #144632.
+
+2004-06-19  Sven Neumann  <sven@gimp.org>
+
+	* devel-docs/parasites.txt: document "exif-data" parasite.
+
+2004-06-18  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/film.c: Don't use deprecated gimp_text functions,
+	clean up font name string handling a bit, default is now "Monospace"
+	instead of "Courier".
+
+2004-06-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped):
+	start supporting GIMP_CONTROLLER_EVENT_VALUE of type gdouble.
+	Assume the double value is in a [0.0..1.0] range and temporarily
+	change the value of the called GimpEnumAction to a range of
+	[0..1000] when invoking it. All still very hackish...
+
+2004-06-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontrollerinfo.c (gimp_controller_info_event):
+	more debugging output.
+
+2004-06-18 Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* app/tools/gimpscaletool.c: changed algorithm for scaling when
+	aspect ratio is constrained, to fix strange behavior described
+	in bug # 68106.
+
+2004-06-18 Bill Skaggs  <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/jpeg.c:  redid save dialog along lines suggested
+	in bug # 138929
+
+	Only create an exif data parasite on loading file if the file actually
+	contains exif data.
+
+	Call exif data parasite "exif-data" instead of "jpeg-exif-data",
+	because it should be interchangeable with TIFF exif data.
+
+2004-06-18  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/context-actions.c
+	* app/actions/context-commands.[ch]: added tons of new actions to
+	modify the current FG/BG color's RGB components.
+
+	Added new enum value GIMP_CONTEXT_SELECT_SET which allows to set
+	values, not only increase/decrease them.
+
+	Changed context_select_value() utility function to interpret
+	GimpEnumAction::value being >= GIMP_CONTEXT_SELECT_SET as settings
+	in a range from 0 to 1000. Yes, that's a hack...
+
+2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/tools/gimptransformtool.c: reverted my fix to bug #144570.
+
+2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/tools/gimpfuzzyselecttool.c: Fix fuzzy select menu label.
+
+2004-06-18  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/tools/gimptransformtool.c (gimp_transform_tool_bounds):
+	If transforming a path, use the path bounds rather than the mask
+	bounds. Fixes bug #144570.
+
+2004-06-17  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp-utils.[ch]: added gimp_boolean_handled_accum().
+
+	* app/core/gimp.c
+	* app/widgets/gimpcontrollerinfo.c: use it.
+
+2004-06-17  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpcontainer.c (gimp_container_deserialize): add newly
+	created children to the container *after* deserializing them so
+	GimpContainer::add() callbacks get the already deserialized
+	object.
+
+	* app/widgets/gimpcontrollers.c: connect to "add" and "remove" of
+	the controller list and remember / clear the wheel controller when
+	it appears / disappears.
+
+2004-06-17  Sven Neumann  <sven@gimp.org>
+
+	* autogen.sh: check for xsltproc and mention that the intltool
+	version mismatch is harmless.
+
+2004-06-17  Pedro Gimeno  <pggimeno@wanadoo.es>
+
+	* tools/pdbgen/pdb/paths.pdb: Fix typos and improve documentation.
+	Addresses bug #144267.
+
+	* app/pdb/paths_cmds.c
+	* libgimp/gimppaths_pdb.c: regenerated.
+
+2004-06-17  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcontroller.[ch]: removed "enabled"
+	property. Removed GIMP_CONTROLLER_PARAM_SERIALIZE from the "name"
+	property because it's the hardware-determined name of this
+	controller instance.
+
+	* app/widgets/gimpcontrollerwheel.c
+	* modules/controller_linux_input.c: set the name.
+
+	* libgimpwidgets/gimpwidgets.h: #include gimpcontroller.h.
+
+	* app/widgets/gimpcontrollerinfo.[ch]: added "enabled" here
+	instead.  Don't dispatch events if the controller is
+	disabled. Made everything work (not crash) with info->mapping
+	being NULL.
+
+	* etc/controllerrc: updated again with the changed format.
+
+	* app/widgets/gimpcontrollers.[ch]: added
+	gimp_controllers_get_list() which returns the container of
+	controllers.
+
+	* app/widgets/gimphelp-ids.h
+	* app/gui/preferences-dialog.c: added controller configuration
+	(can't change anything yet, just view the current settings).
+	Resurrected the "Input Devices" page and removed the "Session"
+	page by moving its widgets to other pages. Pack the various
+	"Save now"/"Clear now" buttons vertically, not horizontally.
+	Fixes bug #139069.
+
+	* themes/Default/images/preferences/Makefile.am
+	* themes/Default/images/preferences/controllers.png
+	* themes/Default/images/preferences/theme.png: new icons for new
+	prefs pages. Someone needs to make them nice...
+
+2004-06-17  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell.c: GtkUIManager makes the menu bar
+	visible by default, hide it if options->show_menubar is FALSE.
+	Fixes bug #143243.
+
+2004-06-17  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: bumped version to 2.1.1. Allow to disable the
+	build of the linux_input controller module.
+
+2004-06-17  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/core/gimpdrawable-transform.c
+	(gimp_drawable_transform_tiles_affine): Make transforms (most
+	notably perspective transforms) conform exactly to specified
+	edges. Includes a patch by David Gowers. Fixes bug #144352.
+
+2004-06-16  Manish Singh  <yosh@gimp.org>
+
+	* modules/controller_linux_input.c: put BTN_{WHEEL,GEAR_DOWN,GEAR_UP}
+	usage in #ifdefs, since pre-2.6 kernels do not have them.
+
+	* modules/controller_linux_input.c (linux_input_read_event): n_bytes
+	should be a gsize.
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/context-actions.c
+	* app/actions/context-commands.[ch]: added actions & callback
+	to select the first/last/prev/next tool.
+
+2004-06-16  Simon Budig  <simon@gimp.org>
+
+	* modules/controller_linux_input.c: removed BTN_MISC,
+	since it is the same as BTN_0 in the input.h header file.
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcontroller.c (gimp_controller_get_event_name)
+	(gimp_controller_get_event_blurb): always return a non-NULL
+	string (return "<invalid event id>" as fallback).
+
+	* modules/controller_linux_input.c: reenabled button event
+	dispatching.
+
+	* app/widgets/gimpcontrollerinfo.c: fixed debugging output.
+
+2004-06-16  Simon Budig  <simon@gimp.org>
+
+	* modules/controller_linux_input.c: break out of the
+	loop after we handled the first matching rel_event.
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcontroller.[ch]: added #define
+	GIMP_CONTROLLER_PARAM_SERIALIZE. Made all properties serializable.
+
+	* modules/controller_linux_input.c: made "device-name"
+	serializable.
+
+	* app/config/gimpconfig-params.h: added macro
+	GIMP_CONFIG_INSTALL_PROP_POINTER() which needs to be handled
+	by custom (de)serialize_property() implementations.
+
+	* app/config/gimpconfig-deserialize.c
+	* app/config/gimpconfig-serialize.c: made object (de)serialization
+	work for object properties which are *not* GIMP_PARAM_AGGREGATE.
+	Write/parse the exact type of the object to create to enable this.
+
+	* app/core/gimpmarshal.list: new marshaller for GimpControllerInfo.
+
+	* app/widgets/gimpcontrollerinfo.[ch]: implement GimpConfigInterface
+	and add "controller" and "mapping" properties. Add "event-mapped"
+	signal which carries the action_name.
+
+	* app/widgets/gimpcontrollers.c: removed all deserialization code
+	and simply (de)serialize the controller container. Install a
+	container handler for "event-mapped" and do the action_name ->
+	action mapping in the callback.
+
+	* etc/controllerrc: regenerated with new syntax. Delete your old one!
+
+2004-06-16  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcontrollerwheel.c
+	(gimp_controller_wheel_get_event_name): don't use gettext() here.
+
+	* modules/controller_linux_input.c: added more button events, set
+	the device name, some cleanup.
+
+2004-06-16  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/plugin-defs.pl: changed dependencies for blur.
+
+	* plug-ins/common/Makefile.am: regenerated.
+
+	* plug-ins/common/blur.c: no need to include libgimpui.h any longer.
+
+2004-06-16  Bill Skaggs <weskaggs@primate.ucdavis.edu>
+
+	* plug-ins/common/blur.c: removed randomize and repeat options;
+	made to run without popping a dialog.  (bug #142318)
+
+2004-06-16  Simon Budig  <simon@gimp.org>
+
+	* modules/controller_linux_input.c: enable dial-events for
+	e.g. the powermate. Fixed typo.
+
+2004-06-16  Sven Neumann  <sven@gimp.org>
+
+	* menus/image-menu.xml.in: added missing menu entries (bug #144449).
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcontroller.[ch]: added
+	GimpController::get_event_blurb() which returns the strings that
+	were returned by get_event_name(). The latter returns
+	untranslatable event identifiers now.
+
+	* app/widgets/gimpcontrollerwheel.c
+	* modules/controller_linux_input.c: changed accordingly.
+
+	* app/widgets/gimpcontrollerinfo.c
+	* app/widgets/gimpcontrollers.c: changed the event mapping from
+	event-id -> action-name to event-name -> action-name.
+
+	* etc/controllerrc: changed accordingly (finally readable now).
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcontrollerinfo.[ch]: made an object out of
+	the GimpControllerInfo struct.
+
+	* app/widgets/gimpcontrollers.c: changed accordingly.
+
+2004-06-16  Jakub Steiner <jimmac@ximian.com>
+
+	* etc/controllerrc: fix typo
+
+2004-06-16  Sven Neumann  <sven@gimp.org>
+
+	* modules/controller_linux_input.c
+	* etc/controllerrc: preliminary wheel event support.
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontrollers.c: better debugging output.
+
+2004-06-16  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcontrollers.c: bug fix.
+
+	* configure.in: check for linux/input.h.
+
+	* modules/Makefile.am
+	* modules/controller_linux_input.c: added a prototype controller
+	module using the linux input event interface.
+
+	* etc/controllerrc: added example config for linux input device.
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontrollers.c: load the controller's
+	properties from the controllerrc file.
+
+	* etc/controllerrc: set the wheel's properties.
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* etc/controllerrc: use the 10% actions for opacity.
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontrollers.c: ref the actions when putting
+	them in the mapping table.
+
+	* app/actions/context-actions.c: added actions to change the
+	opacity in 10% steps.
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcontroller.[ch]: added a "name" property.
+	Dispatch events only if the controller is enabled.
+
+	* app/widgets/gimpcontrollerwheel.c: added controller events for
+	all possible modifier combinations.
+
+	* etc/Makefile.am
+	* etc/controllerrc: default controllerrc which maps all unused
+	wheel+modifier combinations to more-or-less usefull stuff.
+
+2004-06-16  Michael Natterer  <mitch@gimp.org>
+
+	Started to fix bug #106920 in a more genreral way:
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgetstypes.h
+	* libgimpwidgets/gimpwidgetsmarshal.list
+	* libgimpwidgets/gimpcontroller.[ch]: new abstract base class
+	which provides an API for pluggable input controller modules
+	(mouse wheel, usb/midi stuff etc.).
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcontrollerwheel.[ch]: subclass of the above
+	which maps wheel mouse scroll events to controller events.
+
+	* app/widgets/gimpcontrollers.[ch]: manager for controllers.
+	reads $(gimpdir)/controllerrc and keeps a mapping of controller
+	events to GtkActions.
+
+	* app/gui/gui.c: initialize and shut down the controller stuff.
+
+	* app/display/gimpdisplayshell-callbacks.c
+	(gimp_display_shell_canvas_tool_events): if a wheel controller
+	exists, dispatch GdkEventScroll to it first and return if it was
+	handled.
+
+2004-06-15  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/text_tool.pdb: deprecate the XLFD-based API
+	gimp_text() and gimp_text_get_extents().
+
+	* app/pdb/text_tool_cmds.c
+	* libgimp/gimptexttool_pdb.[ch]: regenerated.
+
+2004-06-15  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/pdbgen.pl
+	* tools/pdbgen/lib.pl: some simplistic code to add a $deprecated
+	flag to pdb definitions, which translates into GIMP_DISABLE_DEPRECATED
+	guards in lib headers.
+
+2004-06-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/Makefile.am
+	* app/actions/context-actions.[ch]
+	* app/actions/context-commands.[ch]: added new action group to
+	modify all GimpContext properties. So far there are actions to
+	cycle through the lists of brushes, patterns etc., to change the
+	opacity, to swap and default colors and to edit generated brushes.
+
+	* app/actions/actions.c: register the new "context" action group.
+
+	* app/actions/tools-actions.c
+	* app/actions/tools-commands.[ch]: removed "tools-default-colors"
+	and "tools-swap-colors" actions and callbacks because they are
+	in the "context" action group now.
+
+	* app/menus/menus.c: add the "context" group to the <Image> and
+	<Dock> UI managers.
+
+	* menus/image-menu.xml.in: changed accordingly. Added a temporary
+	"Context" menu to test and debug the new actions.
+
+2004-06-15  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/tools/gimpcroptool.c (crop_selection_callback): Force
+	aspect ratio to match selection when 'From Selection' is clicked.
+	Fixes bug #144361. Also converted tabs to spaces.
+
+2004-06-15  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/mng.c (respin_cmap): applied the fix for empty
+	colormaps (bug #143009) here as well.
+
+2004-06-15  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/core/gimpdrawable-transform.c
+	(gimp_drawable_transform_tiles_affine): Don't round texture
+	coordinates when not using interpolation. Fixes bug #144352 for
+	the nearest neighbor case only.
+
+2004-06-14  Sven Neumann  <sven@gimp.org>
+
+	* app/paint/gimpinkoptions.c: replaced some arbitrary values with
+	larger but still arbitrary values (default and limit for ink size).
+
+2004-06-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintcore.[ch]: removed PRETRACE_PAINT and
+	POSTTRACE_PAINT from the GimpPaintCoreState enum. Removed
+	"gboolean traces_on_window" from GimpPaintCoreClass.
+
+	* app/paint/gimpclone.[ch]
+	* app/paint/gimpink.c
+	* app/tools/gimpclonetool.c: changed accordingly.
+
+	* app/tools/gimppainttool.c: ditto. Show the brush outline
+	while painting. Fixes bug #118348.
+
+2004-06-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimptransformtool.c: use gimp_draw_tool_is_active()
+	instead of GIMP_IS_DISPLAY(draw_tool->gdisp).
+
+2004-06-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
+	do the workaround for "" accelerators only if the GTK+ version
+	is smaller than 2.4.3. Fixes bug #144342 for GTK+ >= 2.4.3.
+
+2004-06-14  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdrawable-transform.c: declared
+	gimp_drawable_transform_cubic() as inline function. Makes
+	sample_cubic() run about 10% faster and causes a 7% speedup on
+	cubic transformations.
+
+	* app/paint-funcs/paint-funcs.c (border_region): avoid an
+	unnecessary memory allocation.
+
+2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/tools/gimptransformtool.c: Disable preview in corrective
+	mode, and notify preview when switching transform type and
+	direction.
+
+2004-06-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintcore.[ch]: added new virtual function
+	GimpPaintCore::post_paint() and call it after calling
+	GimpPaintCore::paint().
+
+	* app/paint/gimpbrushcore.[ch]: renamed brush_core->grr_brush
+	to brush_core->main_brush and reset brush_core->brush
+	to brush_core->main_brush in GimpPaintCore::post_paint().
+
+	* app/paint/gimpbrushcore.c
+	* app/paint/gimppaintcore-stroke.c
+	* app/tools/gimppainttool.c: removed all code which restores
+	the brush_core's old brush after painting since post_paint()
+	does this automatically now.
+
+	* app/paint/gimpclone.[ch]: moved static variables to the
+	GimpClone struct.
+
+2004-06-14  Sven Neumann  <sven@gimp.org>
+
+	* app/paint-funcs/paint-funcs-generic.h (color_pixels): some code
+	cleanup I did while attempting to optimize this code further.
+
+2004-06-14  Henrik Brix Andersen  <brix@gimp.org>
+
+	* app/plug-in/plug-in-run.c: let extensions run synchronously when
+	called via PDB. Fixes bug #140112.
+
+2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/tools/gimptransformtool.c: Preview is now only used for
+	layer transformations.
+
+2004-06-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpperspectivetool.c
+	* app/tools/gimprotatetool.c
+	* app/tools/gimpscaletool.c
+	* app/tools/gimpsheartool.c: removed calls to
+	gimp_transform_tool_expose_preview() from all
+	GimpTransformTool::motion() implementations...
+
+	* app/tools/gimptransformtool.c: ...and call it after calling
+	tr_tool_class->preview().
+
+2004-06-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell.[ch]: remember the last used
+	GimpCursorFormat so changing the format in prefs applies
+	instantly, and not after the next tool change.
+
+	* app/display/gimpdisplayshell-cursor.[ch]
+	* app/tools/gimptool.[ch]
+	* app/tools/gimptoolcontrol.[ch]
+	* app/tools/gimpclonetool.c
+	* app/tools/gimpcolortool.c
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimpiscissorstool.c
+	* app/tools/gimpmeasuretool.c
+	* app/tools/gimpmovetool.c
+	* app/tools/gimptransformtool.c: s/GdkCursorType/GimpCursorType/g
+
+2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/tools/gimptransformtool.c (gimp_transform_tool_doit): Preview
+	wasn't being turned off before performing a transformation. Also
+	converted tabs to spaces.
+
+2004-06-14  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/display/gimpdisplayshell-preview.c: Transformation previews now
+	use the selection mask if it is present.
+
+2004-06-13  Manish Singh  <yosh@gimp.org>
+
+	* configure.in: Make sure PangoFT2 is using a recent enough fontconfig
+	since many people have broken and confused setups.
+
+2004-06-13  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/pdb/gradient_edit.pdb: cleans ups so generated
+	output doesn't warn about uninitialize variable use, and whitespace
+	cosmetic cleanups.
+
+	* app/pdb/gradient_edit_cmds.c: regenerated.
+
+2004-06-13  Manish Singh  <yosh@gimp.org>
+
+	* app/base/cpu-accel.c: Reorged, to address bug #142907 and
+	bug #143069. Accel implementations #define HAVE_ACCEL, and cpu_accel()
+	keys on that. Both PPC and X86 implementations check for __GNUC__.
+	X86 stuff is only used with USE_MMX is defined. The SSE OS check
+	is now checked in arch_accel(), not cpu_accel(). Finally, the
+	arch x86_64 checks now are EM64T aware (which didn't matter in
+	practice).
+
+2004-06-13  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/display/gimpdisplayshell-preview.c: use drawable_mask_bounds()
+	for texture coordinates instead of the drawable's width and height.
+
+2004-06-13  Sven Neumann  <sven@gimp.org>
+
+	* app/paint-funcs/paint-funcs.c (shapeburst_region): don't call
+	tile_ewidth() three times from the inner loop.
+
+	* app/base/tile-manager.c (tile_manager_get): don't call
+	tile_size() twice on the same tile.
+
+	* app/base/tile-private.h: added tile_size_inline(), an inline
+	version of the tile_size() function.
+
+	* app/base/tile-cache.c
+	* app/base/tile-manager.c
+	* app/base/tile-swap.c
+	* app/base/tile.c: use tile_size_inline() from inside the tile
+	subsystem.
+
+2004-06-13  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimpiscissorstool.c: Minor tweaks to two macros.
+	Shouldn't change anything.
+
+2004-06-13  Jakub Steiner <jimmac@ximian.com>
+
+	* cursors/tool-zoom.png:
+	* cursors/cursor-zoom.png: minor fsckup
+
+2004-06-13  Jakub Steiner <jimmac@ximian.com>
+
+	* cursors/gimp-tool-cursors.xcf
+	* cursors/tool-burn.png: the burn tool doesn't really have an
+	  inverted handle
+
+2004-06-13  Sven Neumann  <sven@gimp.org>
+
+	* app/paint-funcs/paint-funcs.[ch] (shapeburst_region): added
+	progress callback.
+
+	* app/core/gimpdrawable-blend.c: show a progress while calculating
+	the Shapeburst. Not perfect but better than not showing any
+	progress at all.
+
+2004-06-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat
+	which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to
+	work around broken X servers.
+
+	* app/config/gimpguiconfig.[ch]
+	* app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format.
+
+	* app/gui/preferences-dialog.c: added a GUI for the new option.
+
+	* app/widgets/gimpcursor.[ch]: added cursor_format parameter
+	to gimp_cursor_new() and _set().
+
+	* app/display/gimpdisplayshell-cursor.c
+	* app/tools/gimpcurvestool.c
+	* app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode.
+
+2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/core/gimpdrawable-blend.c: added missing semicolon.
+
+2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/display/gimpdisplayshell-callbacks.c: Fixed incorrect logic that
+	caused perfect-but-slow pointer tracking to be used in tools that
+	don't request exact mode.
+
+	* app/display/Makefile.am:
+	* app/display/gimpdisplayshell-appearance.[ch]:
+	* app/display/gimpdisplayshell-callbacks.c:
+	* app/display/gimpdisplayshell.[ch]:
+	* app/display/gimpdisplayshell-preview.[ch]: added
+	* app/tools/gimpperspectivetool.c:
+	* app/tools/gimprotatetool.c:
+	* app/tools/gimpscaletool.c:
+	* app/tools/gimpsheartool.c:
+	* app/tools/gimptransformoptions.[ch]:
+	* app/tools/gimptransformtool.[ch]: Implemented live transformation
+	previews, available through tool options. Fixes bug #108172.
+
+2004-06-13  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdrawable-blend.c (gradient_render_pixel): inline
+	the repeat functions.
+
+	* app/core/gimpgradient.c: inline the curve functions.
+
+2004-06-13  Jakub Steiner <jimmac@ximian.com>
+
+	* cursors/gimp-tool-cursors.xcf
+	* cursors/tool-zoom.png: make more transparent
+
+2004-06-13  Jakub Steiner <jimmac@ximian.com>
+
+	* cursors/gimp-tool-cursors.xcf
+	* cursors/tool-blur.png
+	* cursors/tool-bucket-fill.png
+	* cursors/tool-dodge.png
+	* cursors/tool-eraser.png
+	* cursors/tool-hand.png: fix a few problems hidden by low opacity
+
+2004-06-13  Jakub Steiner <jimmac@ximian.com>
+
+	* cursor/*png: updated the cursors
+
+2004-06-13  Michael Natterer  <mitch@gimp.org>
+
+	* cursors/gimp-tool-cursors.xcf: added nice new antialiased
+	cursor layers made by Jimmac.
+
+2004-06-13  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimppalette.c (gimp_palette_load): don't use the rather
+	inefficient gimp_palette_add_entry() when loading a palette.
+
+2004-06-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdata.[ch]: added "gint freeze_count" and
+	gimp_data_freeze()/thaw() functions. Emit "dirty" only if
+	freeze_count either is 0 or drops to 0.
+
+	* app/core/gimpbrushgenerated.[ch]
+	* app/core/gimpgradient.[ch]: removed freeze/thaw stuff that
+	was duplicated in these two subclasses and use the new
+	GimpData API instead.
+
+	* app/widgets/gimpbrusheditor.c
+	* app/widgets/gimpgradienteditor.c: changed accordingly.
+
+2004-06-12  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcolorbar.c (gimp_color_bar_expose): don't copy
+	the first row onto itself.
+
+2004-06-12  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimptransformtool.c: Make Enter/Return apply the
+	transformation, Backspace/Delete resets the transformation.
+
+	* app/tools/gimpcroptool.c: Simplify the key_press callback.
+
+2004-06-12  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimpcroptool.c: Make the Enter/Return key do
+	the crop action.
+
+	* app/tools/gimpeditselectiontool.c
+	* app/tools/gimpvectortool.c: Make the _key_press functions
+	safe for non-arrow keys.
+
+2004-06-12  Sven Neumann  <sven@gimp.org>
+
+	* app/composite/gimp-composite.[ch]: just some cleanup.
+
+2004-06-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-callbacks.c
+	(gimp_display_shell_events): ported some forgotten #if 0'ed
+	GtkItemFactory stuff to GtkUIManager.
+
+2004-06-12  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimptool.[ch]: renamed the "arrow_key" member
+	to "key_press", since it is now no longer about just the arrow
+	keys.
+
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpeditselectiontool.c
+	* app/tools/gimpeditselectiontool.h
+	* app/tools/gimpmovetool.c
+	* app/tools/gimppainttool.c
+	* app/tools/gimpselectiontool.c
+	* app/tools/gimptexttool.c
+	* app/tools/gimpvectortool.c
+	* app/tools/tool_manager.c: Changed accordingly.
+
+2004-06-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell.c (gimp_display_shell_init): add
+	the file DND destination before all others so the DND code will
+	implicitly use its destination properties. Works around Konqueror
+	offering only file MOVE, not COPY and fixes bug #144168.
+
+2004-06-12  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/sample_colorize.c: reindented, some minor cleanup.
+
+2004-06-12  Simon Budig  <simon@gimp.org>
+
+	* app/tools/tool_manager.[ch]: renamed
+	tool_manager_arrow_key_active to tool_manager_key_press_active.
+
+	* app/display/gimpdisplayshell-callbacks.c: Also dispatch
+	GDK_Return/KP_Enter/BackSpace/Delete to the tools, the
+	"arrow_key" member of GimpTool probably should be renamed.
+
+	* app/tools/gimpvectortool.c: Use Enter/Return to convert the
+	current path to a selection, use Backspace/Delete to delete the
+	currently active anchors in a path.
+
+	Implemented on Jimmacs request - thanks to him and Iva for being
+	a great host  :)
+
+2004-06-12  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimphistogrameditor.c (gimp_histogram_editor_init):
+	set the initially selected channel on the histogram combobox.
+	Fixes bug #144225.
+
+2004-06-12  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/paint/gimppaintoptions.[ch]: renamed all "pressure-pressure"
+	variables to "pressure-hardness".
+
+	* app/paint/gimpairbrush.c:
+	* app/tools/gimppaintoptions-gui.c: changed accordingly.
+
+2004-06-10  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpcolorarea.c: replaced destroy() by
+	finalize(), converted tabs to spaces, cleanup.
+
+2004-06-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpthumbbox.c (gimp_thumb_box_new): line-wrap the
+	filename label if it's too long instead of cutting it off.
+
+2004-06-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/widgets-enums.h (enum GimpCursorModifier):
+	s/GIMP_LAST_CURSOR_MODIFIER_ENTRY/GIMP_CURSOR_MODIFIER_LAST/.
+
+	* app/widgets/gimpcursor.c: changed accordingly. Renamed struct
+	GimpBitmapCursor to GimpCursor. More cleanup.
+
+2004-06-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/image-actions.c
+	* app/actions/image-commands.[ch]
+	* app/actions/layers-actions.c
+	* app/actions/layers-commands.[ch]: made the
+	"image-convert-rgb/grayscale/indexed" and the
+	"layers-mask-apply/delete" actions GimpEnumActions and merged
+	their callbacks.
+
+2004-06-10  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/gui/preferences-dialog.c: restored the 'Show Paint Tool
+	Cursor' option that was removed during clean-up.
+
+2004-06-10  Philip Lafleur  <plafleur@cvs.gnome.org>
+
+	* app/paint/gimpbrushcore.c (gimp_brush_core_pressurize_mask):
+	avoided some redundant calculations.
+
+2004-06-10  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/user-install-dialog.c: removed the monitor calibration
+	from the user installation process. It's not a vital setting and
+	can be done from the Preferences dialog later.
+
+	* app/gui/resolution-calibrate-dialog.[ch]: simplified the
+	resolution calibration dialog by removing the hacks that were
+	needed for drawing it in the user-installation style.
+
+	* app/gui/preferences-dialog.c: changed accordingly. Also removed
+	the separator from the Display page.
+
+2004-06-10  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimptemplateeditor.[ch]: added an API to
+	expand/collapse the "Advanced Options" frame.
+
+	* app/gui/preferences-dialog.c
+	* app/widgets/gimphelp-ids.h: applied a patch done by William
+	Skaggs that cleans up and reorganizes the Preferences dialog
+	(bug #144060).
+
+2004-06-09  Simon Budig  <simon@gimp.org>
+
+	* app/core/gimpcoords.[ch]: renamed gimp_coords_length2 to
+	gimp_coords_length_squared.
+
+	* app/vectors/gimpbezierstroke.c: Changed accordingly
+
+2004-06-09  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimppenciltool.c (gimp_pencil_tool_init): no need to
+	request GIMP_MOTION_MODE_EXACT here since the parent class does
+	that already.
+
+	* app/tools/gimpinktool.c (gimp_ink_tool_init): ditto. Enable the
+	color picker feature for the ink tool.
+
+2004-06-09  Sven Neumann  <sven@gimp.org>
+
+	* menus/image-menu.xml.in: added "Selection Editor" to the
+	Selection menu. Still hoping for the great menu reorganization
+	though...
+
+	* app/actions/select-actions.c (select_actions_update): "Save to
+	Channel" makes sense without a selection also, so don't set it
+	insensitive.
+
+2004-06-07  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/glob.c: the glob(3) function is not available on
+	Win32 and also isn't necessarily UTF-8 safe. Started to add an
+	alternative implementation. Right now there's just some code taken
+	from GTK+ (an UTF-8 save fnmatch() implementation) and the plug-in
+	does nothing useful. I will add some stripped-down glob code based
+	on the code in glibc later.
+
+2004-06-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimplayer.c (gimp_layer_set_tiles): don't set
+	layer->mask's offsets. It is wrong because GimpDrawable::set_tiles()
+	is a lowlevel function which is used by stuff like scale and
+	resize which keep the mask in sync explicitely and don't expect it
+	to be moved in the middle of chaining up. Fixes bug #143860.
+
+2004-06-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/view-actions.c
+	* app/actions/view-commands.[ch]: added separate callback for
+	"view-zoom-other" and connect GtkAction::activate manually so
+	"Other..." can be selected even if it's the active item in the
+	zoom radio group. Fixes bug #143850.
+
+2004-06-07  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/tileit.c (tileit_dialog): fixed a typo.
+
+2004-06-07  Sven Neumann  <sven@gimp.org>
+
+	* app/menus/plug-in-menus.c (plug_in_menus_setup): sort the menus
+	by the translated menu path stripped from underscores.
+
+2004-06-06  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/gauss.c (gauss): fixed a stupid cut'n'paste bug
+	I introduced yesterday.
+
+2004-06-06  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/gauss.c (query): register the menu entry the new
+	way and install a mnemonic for Gaussian Blur.
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/curve_bend.c: applied a patch from Henrik Brix
+	Andersen that tells the user that Curve Bend cannot operate on
+	layers with masks instead of silently applying the mask
+	(bug #134748).
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/plugin-defs.pl
+	* plug-ins/common/Makefile.am
+	* plug-ins/common/gauss_iir.c
+	* plug-ins/common/gauss_rle.c: removed the two gaussian blur
+	plug-ins...
+
+	* plug-ins/common/gauss.c: and added a merged version done by
+	William Skaggs. Fixes bug #134088.
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/sgi/sgi.c: applied a patch from Philip Lafleur that
+	makes the plug-in handle images with more than 4 channels. At the
+	moment the extra information is discarded (bug #143673).
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/unsharp.c: applied a modified patch from Geert
+	Jordaens that adds a preview to the Unsharp Mask plug-in. Fixes
+	bug #140974.
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* app/paint/gimppaintcore.c
+	* app/paint-funcs/paint-funcs-generic.h
+	* app/paint-funcs/paint-funcs.[ch]: applied a patch from Philip
+	Lafleur that changes the way that paint is applied during a paint
+	stroke. Fixes bug #124225.
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/Makefile.am
+	* plug-ins/common/plugin-defs.pl
+	* plug-ins/common/glob.c: added a simple glob plug-in based on
+	some old code by George Hartz. This plug-in is very useful when
+	you need to do batch processing, especially from Script-Fu.
+	Fixes bug #143661.
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpgradienteditor.c: applied a patch from David
+	Gowers that makes the gradient editor display the perceptual
+	intensity of the color under the cursor (bug #135037).
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/snoise.c: applied a modifed patch from Yeti that
+	adds a preview to the Solid Noise plug-in (bug #142587).
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/tiff.c: save the proper value for type of alpha
+	channel. Fixes bug #143522; patch by Philip Lafleur.
+
+2004-06-05  Manish Singh  <yosh@gimp.org>
+
+	* app/gui/preferences-dialog.c (prefs_dialog_new): update call
+	to prefs_spin_button_add for num-processors too.
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.c (script_fu_interface):
+	left align toggle buttons.
+
+2004-06-05  Sven Neumann  <sven@gimp.org>
+
+	* app/text/gimptextlayer-transform.[ch]: updated the (still unused)
+	text transformation code.
+
+	* app/text/gimptext-bitmap.c: removed a redundant transformation.
+
+2004-06-05  Michael Natterer  <mitch@gimp.org>
+
+	* cursors/Makefile.am
+	* cursors/cursor-none.png
+	* cursors/xbm/cursor-none.xbm: new empty cursor images.
+
+	* app/config/gimpdisplayconfig.[ch]
+	* app/config/gimprc-blurbs.h
+	* app/widgets/widgets-enums.h
+	* app/widgets/gimpcursor.c
+	* app/display/gimpdisplayshell-cursor.c
+	* app/tools/gimppainttool.[ch]
+	* app/tools/gimpinktool.c
+	* app/gui/preferences-dialog.c: applied patches from Philip
+	Lafleur which implement hiding the cursor completely for paint
+	tools. Changed the name of the config option from
+	"hide-paint-tool-cursor" to "show-paint-tool-cursor" and default
+	to TRUE because this needs the brush outline being visible while
+	painting to be really usable. Fixes bug #132163.
+
+	* app/widgets/widgets-enums.h: renamed all GimpCursorType and
+	GimpToolCursorType enum values to GIMP_CURSOR_* and
+	GIMP_TOOL_CURSOR_*.
+
+	* app/widgets/gimpcursor.c
+	* app/display/gimpdisplayshell-callbacks.c
+	* app/display/gimpdisplayshell-cursor.c
+	* app/tools/gimp*tool.c; changed accordingly.
+
+2004-06-04  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcursor.c: changed create_cursor_foo() utility
+	functions to get_cursor_foo() and use them as accessors instead of
+	using cursor->member. Use gdk_pixbuf_copy() instead of compositing
+	the initial image onto an empty pixbuf.
+
+2004-06-04  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimptexteditor.c (gimp_text_editor_new): set the
+	focus on the text area.
+
+2004-06-04  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimptexttool.c (gimp_text_tool_class_init): allow to
+	move a text layer using the cursor keys.
+
+2004-06-04  Michael Natterer  <mitch@gimp.org>
+
+	* cursors/*.xbm: removed...
+
+	* cursors/xbm/*.xbm: ...and added here instead. Renamed them
+	all to match the PNG file names.
+
+	* cursors/Makefile.am: changed accordingly.
+
+	* app/widget/gimpcursor.c: ditto. Merged the two cursor creating
+	functions again because they duplicated too much code.
+
+2004-06-04  Sven Neumann  <sven@gimp.org>
+
+	* app/menus/plug-in-menus.c (plug_in_menus_setup): populate the
+	tree with collation keys and use strcmp() instead of
+	g_utf8_collate() as the tree's sort function.
+
+2004-06-04  Sven Neumann  <sven@gimp.org>
+
+	* app/paint/gimppaintoptions.c (DEFAULT_PRESSURE_PRESSURE):
+	applied a patch by Philip Lafleur that changes the default to
+	FALSE. Fixes bug #143626.
+
+2004-06-03  Michael Natterer  <mitch@gimpmp.org>
+
+	* app/widgets/gimptoolbox.c (gimp_toolbox_size_allocate): use
+	gtk_widget_size_request() instead of _get_child_requisition()
+	because we need to know the size of the toolbox' areas
+	even if they are invisible. Fixes SIGFPE spotted by Jimmac.
+
+2004-06-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcursor.c: some cleanup. Make the tool_cursor
+	and cursor_modifier components slightly transparent.
+
+	* cursors/cursor-mouse.png: was the wrong image.
+
+2004-06-03  Michael Natterer  <mitch@gimp.org>
+
+	* cursors/Makefile.am
+	* cursors/*.png: added PNG version of all cursors.
+
+	* cursors/gimp-tool-cursors.xcf: reordered and renamed all layers
+	to match the new PNG filenames.
+
+	* app/widgets/gimpcursor.[ch]: create cursors with alpha and color
+	if the GdkDisplay supports it. Fall back to the old stuff
+	otherwise.
+
+2004-06-03  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimppattern.c (gimp_pattern_load_pixbuf): if a Title is
+	set, use that as the pattern name.
+
+2004-06-03  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdatafactory.c (gimp_data_factory_load_data):
+	removed commented-out message.
+
+	* app/core/gimppattern.[ch]: fixed handling of errors and PNG
+	comments in new pattern loader. Renamed functions for consistency
+	with other data loaders.
+
+	* app/core/gimp.c: changed accordingly.
+
+2004-06-03  Dave Neary  <bolsh@gimp.org>
+
+	* app/core/gimp.c:
+	* app/core/gimpdatafactory.c:
+	* app/core/gimppattern.[ch]: Add support for GdkPixbuf patterns,
+	so now all of png, jpex, pnm, xbm, bmp, gif, ico, pcx, ras, tga,
+	xpm and tiff can be used for patterns.
+
+2004-06-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/vectors-actions.c: added alternative actions
+	"vectors-selection-from-vectors" and
+	"vectors-selection-to-vectors-short" with different labels suited
+	for the "Select" menu.
+
+	* app/actions/select-actions.c: removed "select-from-vectors"
+	and "select-to-vectors" (to vectors was crashing anyway).
+
+	* app/actions/select-commands.[ch]: removed
+	select_from_vectors_cmd_callback(). Fixes code dupliction.
+
+	* menus/image-menu.xml.in
+	* menus/selection-editor-menu.xml: changed accordingly.
+
+2004-06-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpgradienteditor.c (control_motion): use the newly
+	added GimpGradient API to set the segment's handles instead of
+	setting the values directly. Dirties the gradient correctly and
+	makes the preview update instantly again. Fixes bug #143605.
+
+2004-06-03  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/file-open-location-dialog.c
+	(file_open_location_completion): check for NULL pointer before
+	passing it to g_utf8_normalize(). Just a workaround for a problem
+	in GimpContainerView.
+
+2004-06-02  Sven Neumann  <sven@gimp.org>
+
+	* INSTALL: more updates.
+
+2004-06-02  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.1.0 development release.
+
+2004-06-02  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-scale.c
+	* app/gui/info-window.c
+	* app/gui/preferences-dialog.c
+	* app/gui/resize-dialog.c
+	* app/tools/gimpcolorbalancetool.c
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimphuesaturationtool.c
+	* app/tools/gimplevelstool.c
+	* app/tools/gimpthresholdtool.c
+	* app/widgets/gimpdockable.c
+	* app/widgets/gimpfiledialog.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimphistogrambox.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpstrokeeditor.c: tweaked some spacings for
+	consistency and better HIG compliance.
+
+2004-06-02  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/gradient_edit.pdb: set_blending_function() and
+	set_coloring_type() work on segment ranges, renamed them
+	accordingly. Spotted by Shlomi Fish.
+
+	* app/pdb/gradient_edit_cmds.c
+	* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
+
+2004-06-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdnd.[ch]: removed utility funtion
+	gimp_dnd_open_files().
+
+	* app/widgets/gimptoolbox-dnd.c: added gimp_toolbox_drop_files()
+	instead.
+
+	* app/display/gimpdisplayshell-dnd.c (gimp_display_shell_drop_files):
+	show the error message if opening a dropped file fails.
+
+2004-06-02  Sven Neumann  <sven@gimp.org>
+
+	* libgimpthumb/gimpthumbnail.c: plugged a small memory leak.
+
+2004-06-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdnd.h: removed enum GimpDndType...
+
+	* app/widgets/widgets-enums.h: ...and added it here.
+
+	* app/widgets/gimpdnd.c: added more g_return_if_fail(). Allow
+	all gimp_dnd_foo_dest_add() functions to be called without
+	callback (just add the target if callback is NULL).
+
+	(gimp_dnd_open_files): removed the checks for validity of the
+	passed filenames/uris...
+
+	(gimp_dnd_set_file_data): ...and added it here so all callbacks
+	get an already sanitized list of strings.
+
+2004-06-02  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/Makefile.am (EXTRA_DIST)
+	* app/menus/Makefile.am (EXTRA_DIST): removed makefile.msc until
+	they have been added.
+
+2004-06-02  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcontainerview.c: create the hash table when
+	inserting items; removes redundant create/destroy cycles and plugs
+	a memory leak.
+
+2004-06-02  Sven Neumann  <sven@gimp.org>
+
+	* INSTALL: updated for gimp-2.1. Suggest to use gimp-print
+	version 4.2.7-pre1 in case of problems (see bug #138273).
+
+2004-06-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-dnd.c
+	(gimp_display_shell_drop_files): copy the merged layer, not the
+	first one. Preserve the type of the layer to make e.g. dropping an
+	XCF with a single text layer work.
+
+2004-06-02  Sven Neumann  <sven@gimp.org>
+
+	* NEWS
+	* README: updated.
+
+2004-06-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell.c (gimp_display_shell_init): accept
+	file/uri drops.
+
+	* app/display/gimpdisplayshell-dnd.[ch]
+	(gimp_display_shell_drop_files): open any kind of image and turn
+	it into a single layer which is added to the image (suggested by
+	Antenne Springborn).
+
+2004-06-02  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/gradient_edit.pdb
+	* tools/pdbgen/pdb/gradients.pdb: mark new API as new using $since.
+
+	* libgimp/gimpgradientedit_pdb.c
+	* libgimp/gimpgradients_pdb.c: regenerated.
+
+2004-06-02  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/gradient_edit.pdb: forgot two more s/int32/enum/.
+
+	* app/pdb/gradient_edit_cmds.c
+	* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
+
+2004-06-01  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/image.pdb
+	* app/pdb/image_cmds.c
+	* app/core/gimpimage.[ch]: reverted changes I did to the image
+	unit earlier. As in 2.0, it will continue to not accept pixels.
+	This makes the PDB API and the XCF format compatible again and
+	fixes bug #142961 (and to some extent bug #137704).
+
+	* app/core/Makefile.am
+	* app/core/gimpimage-unit.[ch]: removed these files. The
+	convenience accessors defined here aren't commonly used any
+	longer.
+
+	* app/display/gimpdisplay.[ch]
+	* app/display/gimpdisplayshell.[ch]: added a unit parameter to
+	gimp_display_new(). Made "unit" and "scale" properties of
+	GimpDisplayShell.
+
+	* app/actions/image-commands.c
+	* app/actions/images-commands.c
+	* app/actions/layers-commands.c
+	* app/actions/select-commands.c
+	* app/actions/view-commands.c
+	* app/core/gimp-edit.c
+	* app/core/gimp.[ch]
+	* app/core/gimptemplate.c
+	* app/display/gimpdisplayshell-handlers.c
+	* app/display/gimpdisplayshell-scale.c
+	* app/display/gimpdisplayshell-title.c
+	* app/display/gimpstatusbar.c
+	* app/file/file-open.c
+	* app/gui/gui-vtable.c
+	* app/gui/info-window.c
+	* app/gui/offset-dialog.c
+	* app/gui/resize-dialog.[ch]
+	* app/pdb/display_cmds.c
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpmeasuretool.c
+	* app/tools/gimppainttool.c
+	* app/tools/gimprectselecttool.c
+	* app/tools/gimprotatetool.c
+	* app/tools/gimpscaletool.c
+	* app/vectors/gimpvectors-export.c
+	* app/widgets/gimptoolbox-dnd.c
+	* tools/pdbgen/pdb/display.pdb: changed accordingly. Use the
+	display unit where the image unit was used before.
+
+2004-06-01  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/gradient_edit.pdb: use enums instead of
+	integers, cleanup.
+
+	* app/pdb/gradient_edit_cmds.c
+	* libgimp/gimpgradientedit_pdb.[ch]: regenerated.
+
+2004-06-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdatafactory.[ch]: added new function
+	gimp_data_factory_data_delete().
+
+	* app/actions/data-commands.c (data_delete_callback): use it.
+
+	* tools/pdbgen/pdb/gradients.pdb: applied (slightly modified)
+	patch from Shlomi Fish which adds PDB wrappers to create, delete,
+	duplicate and rename gradients. Fixes bug #143528.
+
+	* app/pdb/gradients_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpgradients_pdb.[ch]: regenerated.
+
+2004-06-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-enums.h: renamed the values of the
+	GimpGradientSegment* enums from GIMP_GRAD_* to
+	GIMP_GRADIENT_SEGMENT_* because they are exported now.
+
+	* app/core/gimp-gradients.c
+	* app/core/gimpgradient.c
+	* app/actions/gradient-editor-actions.c: changed accordingly.
+
+	* libgimp/gimpenums.h
+	* plug-ins/pygimp/gimpenums.py
+	* plug-ins/script-fu/script-fu-constants.c
+	* tools/pdbgen/enums.pl: regenerated.
+
+2004-06-01  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/tiff.c: don't call gtk_entry_set_text() with a
+	NULL text.
+
+2004-06-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainertreeview-dnd.c
+	* app/widgets/gimpitemtreeview.c: some cleanup in the tree view
+	DND code.
+
+2004-06-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpsessioninfo.c (gimp_session_info_restore): added
+	a horrible hack that sets the paned's position after the first
+	"size-allocate" after "map". Makes position remembering work for
+	the toolbox and fixes bug #142697.
+
+	* app/widgets/gimpdockable.[ch]: added new function
+	gimp_dockable_set_tab_style()
+
+	* app/actions/dockable-commands.c (dockable_tab_style_cmd_callback)
+	* app/widgets/gimpsessioninfo.c (gimp_session_info_restore):
+	use gimp_dockable_set_tab_style().
+
+2004-06-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimptoolbox.c (toolbox_area_notify): removed
+	unused variable.
+
+2004-06-01  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/autocrop.c (query): register as "Autocrop Image"
+	and "Autocrop Layer".
+
+2004-06-01  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/image-commands.c (image_new_cmd_callback):
+	initialize the dialog by calling file_new_dialog_set(). Fixes bug
+	#143477.
+
+2004-05-31  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcontainerentry.[ch]: export the column enum.
+
+	* app/gui/file-open-location-dialog.c: use a GimpContainerEntry
+	on the documents list. Use a custom match function that matches
+	without the leading protocol part.
+
+2004-05-31  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimptoolbox-image-area.[ch]: new toolbox area which
+	shows the active image.
+
+	* app/config/gimpguiconfig.[ch]
+	* app/config/gimprc-blurbs.h: added config options to control the
+	visibility of the toolbox' color, indicator and image areas.
+
+	* app/widgets/gimptoolbox.[ch]: added the image area and honor the
+	new config options. Put the various areas into their own wrap box.
+
+	* app/widgets/gimptoolbox-dnd.c: changed accordingly.
+
+	* app/widgets/gimphelp-ids.h: added a help ID for the image area.
+
+	* app/widgets/gimptoolbox-indicator-area.c: made the previews
+	a bit larger, cleanup.
+
+	* app/gui/preferences-dialog.c: added a "Toolbox" page as GUI for
+	the new config options.
+
+	* themes/Default/images/preferences/Makefile.am
+	* themes/Default/images/preferences/toolbox.png: a (wrong) icon
+	for the "Toolbox" prefs page. Needs to be replaced.
+
+2004-05-31  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcontainerentry.[ch]: added new widget
+	GimpContainerEntry, a GtkEntry with completion that implements the
+	GimpContainerView interface.
+
+	* app/tools/gimptextoptions.c (gimp_text_options_gui): added a
+	GimpContainerEntry to select the font.
+
+2004-05-31  Sven Neumann  <sven@gimp.org>
+
+	* app/Makefile.am
+	* app/actions/file-actions.c
+	* app/actions/file-commands.[ch]
+	* app/gui/Makefile.am
+	* app/gui/file-open-location-dialog.[ch]
+	* app/widgets/gimphelp-ids.h
+	* menus/image-menu.xml.in
+	* menus/toolbox-menu.xml.in: added a rudimentary "Open Location"
+	dialog.
+
+2004-05-31  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/mblur.c (mblur_zoom): push pixels outwards not
+	to the center as suggested by Chad Daelhousen (bug #142968).
+
+2004-05-31  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/mblur.c: applied patch from William Skaggs that
+	adds the possibility to choose the center of radial and zoom
+	motion blurs (bug #113711).
+
+2004-05-31  Sven Neumann  <sven@gimp.org>
+
+	* app/paint/gimpconvolve.c
+	* app/paint-funcs/paint-funcs.[ch]
+	* app/tools/gimpiscissorstool.c: reverted last change and applied
+	new patch instead (bug #72878).
+
+2004-05-31  Sven Neumann  <sven@gimp.org>
+
+	* app/paint/gimpconvolve.c
+	* app/paint-funcs/paint-funcs.[ch]
+	* app/tools/gimpiscissorstool.c: applied a patch from Philip
+	Lafleur that fixes RGBA resampling in Convolve tool (bug #72878).
+
+2004-05-31  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_cmd_gimp_guides.c
+	* plug-ins/imagemap/imap_edit_area_info.c
+	* plug-ins/imagemap/imap_preferences.c
+	* plug-ins/imagemap/imap_settings.c: need to include gimpwidgets.h.
+
+2004-05-31  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-enums.h
+	* app/core/gimpgradient.[ch]
+	* app/pdb/Makefile.am
+	* app/widgets/gimpgradienteditor.c
+	* tools/pdbgen/Makefile.am
+	* tools/pdbgen/groups.pl
+	* tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi
+	Fish that adds lots of gradient edit functions to
+	gimpgradient.[ch] and makes them available through the PDB.
+	Fixes bug #129675 and bug #129678.
+
+	Did some cleanups / enhancments to the patch:
+
+	* app/core/gimpgradient.[ch]: changed the naming scheme of the new
+	functions and changed old functions to match the new scheme.
+	Introduce a "freeze_count" and public freeze()/thaw() API which
+	enables subsequent gradient changes without "dirty" being emitted
+	all the time.  Added GimpGradient parameters to all functions
+	which modify the gradient.
+
+	* app/widgets/gimpgradienteditor.c: use the new freeze/thaw
+	stuff to keep the gradient from updating when not in
+	"Instant Update" mode.
+
+	* app/actions/gradient-editor-commands.c: removed all gradient
+	editing code and call the new core functions.
+
+	* libgimp/Makefile.am
+	* tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all
+	added functions. Generate libgimp wrappers for them..
+
+	* app/pdb/gradient_edit_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimp_pdb.h
+	* libgimp/gimpenums.h
+	* libgimp/gimpgradientedit_pdb.[ch]
+	* plug-ins/pygimp/gimpenums.py
+	* plug-ins/script-fu/script-fu-constants.c
+	* tools/pdbgen/enums.pl: (re)generated.
+
+2004-05-29  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/autocrop.c: applied patch from Philip Lafleur
+	that makes Autocrop register a new procedure that autocrops a
+	single layer as requested in bug #142618.
+
+	* tools/pdbgen/pdb/layer.pdb
+	* app/pdb/layer_cmds.c
+	* libgimp/gimplayer_pdb.c: fixed documentation for gimp_resize_layer.
+	Patch provided by Philip Lafleur (bug #142618).
+
+2004-05-29  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimptemplateeditor.c
+	(gimp_template_editor_constructor): add the spinbuttons to the
+	size entry in the correct order. Fixes bug #143347.
+
+2004-05-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdnd.c (gimp_dnd_open_files): if the dropped
+	stuff is a local filename (no file URI), convert it to an
+	URI instead of forwarding it unmodified.
+
+2004-05-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimppreview.c (gimp_preview_button_press_event):
+	don't invoke the popup preview if there is no viewable.
+
+2004-05-28  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimppropwidgets.c: same workaround for tooltips on
+	combo boxes.
+
+2004-05-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/Lighting/lighting_ui.c
+	* plug-ins/MapObject/mapobject_ui.c
+	* plug-ins/common/warp.c
+	* plug-ins/gfig/gfig.c: tooltips can't be set on a GtkComboBox so
+	we need to pack it into a GtkEventBox when a tooltip is needed.
+
+2004-05-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/text/gimpfont.c (gimp_font_get_popup_size)
+	(gimp_font_get_new_preview): take both logical and ink rectangle
+	into account to avoid clipping away parts of the font preview.
+	Fixes bug #142277.
+
+2004-05-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainerview.[ch]: added "preview-size" and
+	"preview-border-width" properties. Cleanup.
+
+	* app/widgets/gimpcontainerbox.c
+	* app/widgets/gimpcontainercombobox.c: implement them.
+
+2004-05-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainergridview.[ch]
+	* app/widgets/gimpcontainertreeview.[ch]: removed "reorderable"
+	from gimp_container_foo_view_new().
+
+	* app/widgets/gimpcontainereditor.[ch]: removed "reorderable" from
+	gimp_container_editor_construct(). Automatically set the view to
+	reorderable if the viewed container has no sort_func.
+
+	* app/widgets/gimpbufferview.c
+	* app/widgets/gimpdatafactoryview.c
+	* app/widgets/gimpdocumentview.c
+	* app/widgets/gimpimageview.c
+	* app/widgets/gimptemplateview.c
+	* app/widgets/gimptoolview.c
+	* app/widgets/gimpundoeditor.c: removed reoderable stuff because
+	GimpContainerEditor does this generically now.
+
+	* app/widgets/gimpcontainerpopup.c
+	* app/widgets/gimpfontview.c: set reorderable to FALSE because
+	they should not be reodered even if they don't have a sort_func.
+
+	* app/gui/font-select.c: removed reorderable stuff. Some cleanup.
+
+	* app/gui/brush-select.c
+	* app/gui/gradient-select.c
+	* app/gui/palette-select.c
+	* app/gui/pattern-select.c: same cleanups as in font-select.c
+
+2004-05-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimpbrushcore.c
+	* app/paint/gimpdodgeburn.c
+	* app/paint/gimppaintcore.[ch]
+	* app/tools/gimpairbrushtool.c
+	* app/tools/gimpclonetool.c
+	* app/tools/gimpconvolvetool.c
+	* app/tools/gimpdodgeburntool.c
+	* app/tools/gimpinktool.c
+	* app/tools/gimppaintbrushtool.c
+	* app/tools/gimppenciltool.c
+	* app/tools/gimpsmudgetool.c: code review / cleanup.
+
+2004-05-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/CML_explorer.c
+	* plug-ins/maze/maze_face.c: added size groups.
+
+	* plug-ins/common/sinus.c: HIG-ified.
+
+2004-05-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/Lighting/lighting_ui.c: tuned dialog layout for
+	consistency.
+
+	* plug-ins/common/warp.c: added size groups to nicely align the
+	widgets.
+
+2004-05-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimp-paint.c (gimp_paint_init): register ink between
+	airbrush and clone so the stroke dialog's menu of paint functions
+	has the same order as the default toolbox order.
+
+2004-05-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintcore.[ch]: removed enum GimpPaintCoreFlags
+	and member GimpPaintCore::flags. Added "gboolean traces_on_window"
+	to GimpPaintCoreClass (defaults to FALSE).
+
+	* app/paint/gimpclone.c: set traces_on_window = TRUE.
+
+	* app/paint/gimpbrushcore.[ch]: added
+	"gboolean handles_changing_brush" to GimpBrushCoreClass (defaults
+	to FALSE).
+
+	* app/paint/gimpclone.c
+	* app/paint/gimpdodgeburn.c
+	* app/paint/gimperaser.c
+	* app/paint/gimppaintbrush.c
+	* app/paint/gimppaintcore.c: set handles_changing_brush = TRUE.
+
+	* app/tools/gimppainttool.c: changed accordingly.
+
+2004-05-27  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/common/ccanalyze.c: code clean-up. Improved speed a lot
+	(500 percent for 1000 x 1000 RGB image) by replacing O(n^2) algorithm
+	with O(n) version.
+
+	* plug-ins/common/gif.c
+	* plug-ins/common/gih.c
+	* plug-ins/common/glasstile.c
+	* plug-ins/common/gqbist.c
+	* plug-ins/common/gradmap.c
+	* plug-ins/common/gtm.c
+	* plug-ins/common/guillotine.c: Use HIG capitalization style plus
+	minor code clean-up.
+
+2004-05-27  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/png.c (respin_cmap): handle an empty colormap.
+	Fixes bug #143009.
+
+2004-05-27  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimppickbutton.c: applied patch from Philip
+	Lafleur that fixes color picking for XInput devices (bug #143166).
+
+2004-05-27  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid):
+	fixed handling of grid offsets in the grid drawing routine.
+
+2004-05-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/widgets-enums.[ch]: added enum GimpActiveColor which
+	can be one of { FOREGROUND, BACKGROUND }.
+
+	* app/widgets/Makefile.am
+	* app/widgets/gimpfgbgeditor.[ch]: new widget implementing the
+	FG/BG/Swap/Default color area known from the toolbox.
+
+	* app/widgets/gimptoolbox-color-area.c: use the new widget.
+
+	* app/widgets/gimpcoloreditor.[ch]: replaced the FG/BG buttons and
+	the color area by a GimpFgBgEditor.
+
+2004-05-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdocumentview.c (gimp_document_view_new):
+	gimp_editor_add_action_button() takes a va_list, terminate
+	it with NULL. Fixes bug #143258.
+
+2004-05-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimpink.c: restored old time/speed sensitivity
+	behaviour by doing nothing except figuring if we draw a straight
+	line in INIT_PAINT. Instead, do all the Blob creating in
+	MOTION_PAINT and special case the initial (null) "motion"
+	accordingly.
+
+2004-05-26  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/common/video.c: code clean-up. Twice as fast now.
+
+	* plug-ins/common/flarefx.c: removed timing stuff.
+
+2004-05-26  Sven Neumann  <sven@gimp.org>
+
+	* app/core/core-enums.[ch]: shorter names for the gradient types
+	to reduce the width of the blend tool options.
+
+2004-05-26  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/common/decompose.c
+	* plug-ins/common/deinterlace.c
+	* plug-ins/common/depthmerge.c
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/destripe.c
+	* plug-ins/common/diffraction.c
+	* plug-ins/common/displace.c
+	* plug-ins/common/edge.c
+	* plug-ins/common/emboss.c
+	* plug-ins/common/engrave.c
+	* plug-ins/common/exchange.c
+	* plug-ins/common/film.c
+	* plug-ins/common/flarefx.c: Use HIG capitalization style.
+	Added GPL license in a few places. Minor code clean-up.
+
+2004-05-26  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcolordisplayeditor.c
+	* modules/cdisplay_colorblind.c
+	* modules/cdisplay_gamma.c
+	* modules/cdisplay_highcontrast.c
+	* modules/cdisplay_proof.c: HIG-ified color display filters.
+
+2004-05-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintcore.[ch]: added "guint32 time" parameters
+	to GimpPaintCore::paint() and ::interpolate().
+
+	* app/paint/gimpairbrush.c
+	* app/paint/gimpbrushcore.c
+	* app/paint/gimpclone.c
+	* app/paint/gimpconvolve.c
+	* app/paint/gimpdodgeburn.c
+	* app/paint/gimperaser.c
+	* app/paint/gimppaintbrush.c
+	* app/paint/gimpsmudge.c: changed accordingly.
+
+	* app/paint/gimpink.c: ditto and use the passed time instead of
+	hardcoded dummy values.
+
+	* app/paint/gimppaintcore-stroke.c: pass '0' as time.
+
+	* app/tools/gimppainttool.c: pass the GdkEvent time.
+
+2004-05-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/Makefile.am
+	* app/paint/gimpink-blob.[ch]
+	* app/paint/gimpink.[ch]
+	* app/paint/gimpinkoptions.[ch]: new files. Ported the ink tool
+	to be a direct GimpPaintCore subclass without any GUI.
+
+	* app/paint/gimp-paint.c: register GimpInk with the list of paint
+	cores.
+
+	* app/tools/Makefile.am
+	* app/tools/gimpinkoptions.[ch]
+	* app/tools/gimpinktool-blob.[ch]: removed these files.
+
+	* app/tools/gimpinkoptions-gui.[ch]: new files containing only
+	the GUI for GimpInkOptions.
+
+	* app/tools/gimpinktool.[ch]: reduced to some few lines which
+	implement a simple GimpPaintTool subclass.
+
+	* app/tools/gimp-tools.c: associate the GimpInk paint_core with
+	the GimpInkTool.
+
+2004-05-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintcore-stroke.c: check if we really have
+	a GimpBrushCore before casting and accessing its members.
+
+2004-05-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimpbrushcore.h
+	* app/paint/gimppaintcore.h: some cleanup.
+
+2004-05-26  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-layer-select.c
+	* app/display/gimpprogress.c
+	* app/gui/brush-select.c
+	* app/gui/color-notebook.c
+	* app/gui/convert-dialog.c
+	* app/gui/font-select.c
+	* app/gui/gradient-select.c
+	* app/gui/info-dialog.c
+	* app/gui/offset-dialog.c
+	* app/gui/palette-select.c
+	* app/gui/pattern-select.c
+	* app/gui/stroke-dialog.c
+	* app/gui/tips-dialog.c
+	* app/tools/gimpmeasuretool.c
+	* app/tools/gimptexttool.c
+	* app/widgets/gimpcolordisplayeditor.c
+	* app/widgets/gimpcolorframe.c
+	* app/widgets/gimpdevicestatus.c
+	* app/widgets/gimpviewabledialog.c: adjusted dialog spacings.
+
+2004-05-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintcore.c: don't do special stuff if a virtual
+	function doesn't exist. Instead, added default implementations
+	which do the special stuff and call the virtual functions
+	unconditionally.
+
+	* app/tools/gimppainttool.c: some stylistic cleanup.
+
+2004-05-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintcore.[ch] (gimp_paint_core_paste)
+	(gimp_paint_core_replace): replaced the "MaskBuf *paint_mask"
+	parameters by "PixelRegion *mask_bufPR", so subclasses can pass in
+	any kind of paint_mask buffer and are not restricted to MaskBufs.
+
+	Also removes implicit knowledge about the MaskBuf originating from
+	a brush in paint_mask_to_canvas_buf() and _to_canvas_tiles() which
+	don't need to offset the mask by width/2 height/2 any more.
+
+	Made gimp_paint_core_validate_undo_tiles() and
+	gimp_paint_core_validate_canvas_tiles() protected functions.
+
+	* app/paint/gimpbrushcore.c (gimp_brush_core_paste_canvas)
+	(gimp_brush_core_replace_canvas): create correctly positioned
+	PixelRegions from the MaskBufs before passing them to the
+	paint_core.
+
+2004-05-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/gimppaintcore.[ch]: removed "gdouble scale" parameter
+	and added "GimpPaintOptions" in GimpPaintCore::get_paint_area().
+	Check if virtual functions exist befoe calling them.
+
+	* app/paint/gimpbrushcore.[ch]: added "gdouble scale" to GimpBrushCore
+	and "gboolean use_scale" to GimpBrushCoreClass (defaults to TRUE).
+	Set scale from paint_options in GimpPaintCore::get_paint_area().
+	Removed "scale" parameter from gimp_brush_core_paste_canvas()
+	and _replace_canvas().
+
+	* app/paint/gimpsmudge.c (gimp_smudge_class_init): set use_scale
+	to FALSE.
+
+	* app/paint/gimpclone.c
+	* app/paint/gimpconvolve.c
+	* app/paint/gimpdodgeburn.c
+	* app/paint/gimperaser.c
+	* app/paint/gimppaintbrush.c: removed all scale calculations and
+	simply pass paint_options to GimpPaintCore::get_paint_area().
+
+2004-05-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimppainttool.c (gimp_paint_tool_button_press): check
+	if the GimpPaintCore really is a GimpBrushCore before casting and
+	fiddling with internaly.
+
+2004-05-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/paint/Makefile.am
+	* app/paint/gimpbrushcore-kernels.h
+	* app/paint/gimpbrushcore.[ch]: new GimpPaintCore subclass
+	containing all the brush painting specific stuff.
+
+	* app/paint/gimppaintcore-kernels.h: removed this file.
+
+	* app/paint/gimppaintcore.[ch]: removed all brush stuff.
+
+	* app/paint/gimpairbrush.c
+	* app/paint/gimpclone.[ch]
+	* app/paint/gimpconvolve.[ch]
+	* app/paint/gimpdodgeburn.[ch]
+	* app/paint/gimperaser.[ch]
+	* app/paint/gimppaintbrush.[ch]
+	* app/paint/gimppencil.c
+	* app/paint/gimpsmudge.[ch]: changed accordingly. Derive all
+	classes which used to derive directly from GimpPaintCore from
+	GimpBrushCore now. Lots of cleanup.
+
+	* app/paint/paint-types.h
+	* app/paint/gimp-paint.c
+	* app/paint/gimppaintcore-stroke.c
+	* app/tools/gimppainttool.c
+	* tools/kernelgen.c: changed accordingly.
+
+2004-05-25  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/common/align_layers.c
+	* plug-ins/common/animoptimize.c
+	* plug-ins/common/animationplay.c
+	* plug-ins/common/apply_lens.c
+	* plug-ins/common/autocrop.c
+	* plug-ins/common/autostretch_hsv.c
+	* plug-ins/common/blinds.c
+	* plug-ins/common/blur.c
+	* plug-ins/common/borderaverage.c
+	* plug-ins/common/bz2.c
+	* plug-ins/common/c_astretch.c
+	* plug-ins/common/ccanalyze.c
+	* plug-ins/common/channel_mixer.c
+	* plug-ins/common/color_enhance.c
+	* plug-ins/common/colorify.c
+	* plug-ins/common/colortoalpha.c
+	* plug-ins/common/csource.c
+	* plug-ins/common/cubism.c
+	* plug-ins/common/curve_bend.c: Use HIG capitalization style.
+	Added GPL license in a few places. Minor code clean-up.
+
+2004-05-25  Sven Neumann  <sven@gimp.org>
+
+	Sorry, couldn't resist to finish this task...
+
+	* plug-ins/script-fu/script-fu-console.c
+	* plug-ins/script-fu/script-fu-scripts.c
+	* plug-ins/script-fu/script-fu-server.c: HIG-ified.
+
+2004-05-25  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gimpressionist/brush.c
+	* plug-ins/gimpressionist/color.c
+	* plug-ins/gimpressionist/general.c
+	* plug-ins/gimpressionist/gimpressionist.[ch]
+	* plug-ins/gimpressionist/orientation.c
+	* plug-ins/gimpressionist/orientmap.c
+	* plug-ins/gimpressionist/paper.c
+	* plug-ins/gimpressionist/placement.c
+	* plug-ins/gimpressionist/presets.c
+	* plug-ins/gimpressionist/preview.c
+	* plug-ins/gimpressionist/size.c
+	* plug-ins/gimpressionist/sizemap.c: HIG-ified.
+
+2004-05-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpitemtreeview.h: added GimpContext parameters
+	to GimpActivateItemFunc, GimpNewItemFunc and GimpEditItemFunc.
+
+	* app/widgets/gimpdrawabletreeview.c
+	* app/widgets/gimpitemtreeview.c: pass the view's context to
+	the functions.
+
+	* app/actions/actions.c (action_data_get_context): return
+	gimp_get_user_context() if "data" is a Gimp.
+
+	* app/actions/channels-commands.[ch]
+	* app/actions/layers-commands.[ch]
+	* app/actions/vectors-commands.[ch]: added GimpContext parameters
+	to the resp. activate, new and edit functions and use the passed
+	context instead of gimp_get_user_context().
+
+	* app/actions/layers-commands.[ch]: removed the merge and flatten
+	callbacks.
+
+	* app/actions/image-commands.[ch]: made public layer merge utility
+	function private and cleaned the whole file up a lot.
+
+	* app/actions/layers-actions.c: use the callbacks from
+	image-commands.c for merge and flatten.
+
+	* app/actions/edit-commands.c
+	* app/actions/file-commands.c
+	* app/actions/select-commands.c: use action_data_get_context()
+	instead of gimp_get_user_context().
+
+	* app/actions/edit-actions.c: some cleanup.
+
+2004-05-25  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/plugindetails.c
+	* plug-ins/dbbrowser/dbbrowser_utils.c
+	* plug-ins/pagecurl/pagecurl.c: HIG-ified.
+
+2004-05-25  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/print/gimp_color_window.c
+	* plug-ins/print/gimp_main_window.c: HIG-ified and ported to
+	GtkFileChooser.
+
+	* plug-ins/ifscompose/ifscompose.c (ifsfile_load_response): ported
+	forgotten callback to GtkFileChooser.
+
+	* plug-ins/imagemap/imap_browse.c
+	* plug-ins/imagemap/imap_file.c: finished port to GtkFileChooser.
+
+2004-05-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/file-actions.c
+	* app/actions/file-commands.[ch]: removed action "file-new", added
+	action "file-open-from-image".
+
+	* app/actions/image-actions.c
+	* app/actions/image-commands.[ch]: added actions "image-new" and
+	"image-new-from-image".
+
+	* menus/image-menu.xml.in: use the "-from-image" variants of
+	the "new" and "open" actions so the dialogs are preconfigured
+	from the image they were invoked from (regression fix).
+
+	* menus/toolbox-menu.xml.in: s/file-new/image-new/.
+
+2004-05-24  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/rcm/rcm.h
+	* plug-ins/rcm/rcm_dialog.[ch]: rearranged and HIG-ified dialog.
+
+2004-05-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimptoolbox.c (toolbox_create_tools): added an evil
+	hack as workaround for the missing gtk_action_get_accel_closure().
+	Re-enables accelerator display in the tool button tooltips.
+
+2004-05-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/vectors/Makefile.am
+	* app/vectors/gimpcoordmath.[ch]: removed...
+
+	* app/core/Makefile.am
+	* app/core/gimpcoords.[ch]: ...and added without the "bezier"
+	namespace.
+
+	* app/vectors/gimpbezierstroke.c: changed accordingly.
+
+	* app/Makefile.am: force it to link gimpcoords.o
+
+2004-05-24  Michael Natterer  <mitch@gimp.org>
+
+	* app/config/gimpconfigwriter.c
+	* app/core/gimpstrokeoptions.c
+	* app/widgets/gimpactiongroup.c
+	* app/widgets/gimpcolorframe.h
+	* app/widgets/gimpcolorpanel.h
+	* app/widgets/gimpcontainerview.[ch]
+	* app/widgets/gimptooldialog.h
+	* app/widgets/gimpuimanager.c
+	* app/widgets/widgets-types.h: fixed various small issues I
+	stumbled across when updating the API reference for app/.
+
+2004-05-24  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpscalecombobox.c
+	(gimp_scale_combo_box_mru_remove_last): removed debugging output.
+
+2004-05-24  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimptoolinfo.[ch]: derive GimpToolInfo from
+	GimpViewable, it doesn't make sense for it to be a GimpData.
+
+	* app/widgets/gimptooloptionseditor.c
+	(gimp_tool_options_editor_get_title): do not append " Options" to
+	the tool name. Fixes bug #142280.
+
+2004-05-24  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/mblur.c: fixed range check of blur type
+	parameter (bug #142965).
+
+2004-05-24  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/maze/maze_face.c: fixed a compiler warning.
+
+2004-05-24  Sven Neumann  <sven@gimp.org>
+
+	Applied a patch from Philip Lafleur (bug #142808):
+
+	* app/paint/gimppaintcore.h: define PRESSURE_SCALE to 1.5
+
+	* app/paint/gimpairbrush.c
+	* app/paint/gimpclone.c
+	* app/paint/gimpconvolve.c
+	* app/paint/gimpdodgeburn.c
+	* app/paint/gimperaser.c
+	* app/paint/gimppaintbrush.c
+	* app/paint/gimpsmudge.c: use the PRESSURE_SCALE constant.
+
+2004-05-24  Michael Natterer  <mitch@gimp.org>
+
+	Long overdue core container cleanup:
+
+	* app/core/gimplist.[ch]: added "unique-names" and "sort-func"
+	properties and merged the resp. code from GimpDataList into
+	GimpList. Removed "policy" parameters from gimp_list_new() and
+	added "unique_names". Added new constructor gimp_list_new_weak().
+	Made public function gimp_list_uniquefy_name() private.
+
+	* app/core/Makefile.am
+	* app/core/core-types.h
+	* app/core/gimpdatalist.[ch]: removed. Its functionality is
+	entirely in GimpList now.
+
+	* app/core/gimpdata.[ch]: added gimp_data_name_compare() which
+	used to live in GimpDataList.
+
+	* app/core/gimp.c
+	* app/core/gimpdatafactory.c
+	* app/core/gimpimage.c
+	* app/core/gimptoolinfo.c
+	* app/core/gimpundostack.c
+	* app/paint/gimp-paint.c
+	* app/tools/gimp-tools.c
+	* app/widgets/gimpdevices.c
+	* app/widgets/gimptemplateeditor.c
+	* app/widgets/gimpundoeditor.c: changed list creation accordingly.
+
+	Made gimp->templates, gimp->named_buffers, tool_info->presets and
+	the image's lists of layers, channels and vectors automatically
+	ensure unique names.
+
+	* app/widgets/gimptemplateview.c
+	* app/actions/file-commands.c
+	* app/actions/templates-commands.c
+	* app/actions/tool-options-commands.c: removed calls to
+	gimp_list_uniquefy_name().
+
+	* app/core/gimpitem.c: removed major insanity where the items
+	themselves where ensuring their unique names. Bah!
+
+	* app/core/gimplayer.c (gimp_layer_name_changed): chain up
+	conditionally.
+
+	* app/core/gimplayermask.c (gimp_layer_mask_name_changed): removed
+	because there is no need any more to keep the parent
+	implementation from being invoked.
+
+2004-05-23  Sven Neumann  <sven@gimp.org>
+
+	More fixes for bug #142996:
+
+	* plug-ins/common/postscript.c
+	* plug-ins/common/sparkle.c
+	* plug-ins/common/sunras.c
+	* plug-ins/common/uniteditor.c
+	* plug-ins/fits/fits.c: fixed typos.
+
+2004-05-23  Sven Neumann  <sven@gimp.org>
+
+	Fixes for bug #142996:
+
+	* app/gui/preferences-dialog.c: added missing gettext call.
+
+	* app/config/gimprc-blurbs.h
+	* app/core/gimptemplate.c
+	* app/gui/gradient-editor-menu.c: fixed typos.
+
+2004-05-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdatalist.c: code cleanup, no logic changed.
+
+2004-05-23  Henrik Brix Andersen  <brix@gimp.org>
+
+	* app/config/gimprc-blurbs.h
+	* plug-ins/gfig/gfig-spiral.c (spiral_button_press)
+	* plug-ins/gimpressionist/orientation.c (create_orientationpage)
+	* plug-ins/common/diffraction.c (diffraction_dialog)
+	* plug-ins/common/bumpmap.c (bumpmap_dialog)
+	* plug-ins/maze/maze.h
+	* plug-ins/MapObject/mapobject_apply.c (compute_image)
+	* app/tools/gimpmeasuretool.c (gimp_measure_tool_dialog_update)
+	* plug-ins/print/gimp_main_window.c (create_scaling_frame): marked
+	strings for translation, corrected small typos. Fixes part of bug
+	#142996
+
+2004-05-23  Žygimantas Beručka  <uid0@akl.lt>
+
+	* configure.in: Added "lt" to ALL_LINGUAS.
+
+2004-05-23  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* libgimp/gimp.def: gimp_register_file_handler_mime added
+
+2004-05-23  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/widgets-types.h: reoedered to somehow reflect the
+	class hierarchy.
+
+	Some dockable context handling cleanup:
+
+	* app/widgets/gimpdocked.[ch]: removed "prev_context" parameter
+	from GimpDocked::set_context(). Widgets which need the old context
+	to disconnect from should remember it themselves.
+
+	* app/widgets/gimpdockable.c (gimp_dockable_set_context): don't
+	pass the old context to gimp_docked_set_context().
+	Some cleanup.
+
+	* app/widgets/gimpcontainerbox.c
+	* app/widgets/gimpcontainereditor.c: changed accordingly.
+
+	* app/display/gimpnavigationview.[ch]
+	* app/widgets/gimpimageeditor.[ch]
+	* app/widgets/gimpitemtreeview.[ch]: added a "context" member
+	which holds the context set by GimpDocked::set_context().
+
+	* app/widgets/gimpdrawabletreeview.c: use the view's context
+	instead of gimp_get_user_context().
+
+	* app/widgets/gimpcoloreditor.[ch]: removed separate API to
+	set the context because it implements the GimpDockedInterface.
+
+	* app/widgets/gimpcomponenteditor.c
+	* app/widgets/gimperrorconsole.c: pass "menu-factory",
+	"menu-identifier" and "ui-path" to g_object_new() instead of
+	calling gimp_editor_create_menu() later.
+
+	Action cleanup partly related to the context stuff above:
+
+	* app/actions/actions.c (action_data_get_gimp): get the Gimp from
+	context->gimp, not gimage->gimp because gimage may be NULL.
+
+	(action_data_get_context): changed to use the new context members
+	added above.
+
+	* app/actions/channels-actions.c (channels_actions_update): cleanup.
+
+	* app/actions/edit-actions.c (edit_actions_update): fixed
+	sensitivity of "edit-undo-clear".
+
+	* app/actions/vectors-actions.c (vectors_actions_update): make
+	"vectors-merge-visible" sensitive only if there is more than one
+	GimpVectors in the image.
+
+	* app/actions/colormap-editor-actions.c
+	* app/actions/gradient-editor-actions.c
+	* app/actions/palette-editor-actions.c: added FG/BG color previews
+	to actions which take colors from them. Changed code to be safe
+	against "context" being NULL.
+
+	* app/actions/drawable-commands.c:
+	s/active_drawable/drawable/g. Makes the code more readable.
+
+	* app/actions/select-commands.[ch]
+	* app/actions/vectors-commands.[ch]: removed public stroke utility
+	functions and other stuff which is not needed any more because
+	dialog buttons invoke the correct actions now. Moved the
+	functions' code to the resp. action callbacks.
+
+2004-05-21  Nathan Summers  <rock@gimp.org>
+
+	Somehow some of the changes from my commit on 2004-05-18 seem to have
+	gotten lost, including the addition to the ChangeLog.  Sorry about that.
+	Recommitted.
+
+	* NEWS: Clarified end-user visible features.
+	Made sundry small grammar and consistancy fixes.
+	Reorganized list of changes slightly.
+
+2004-05-21  Sven Neumann  <sven@gimp.org>
+
+	* app/paint/gimppaintcore.c (gimp_paint_core_interpolate): better
+	fix for bug #123811; patch provided by Philip Lafleur.
+
+2004-05-21  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/preferences-dialog.c: added some GtkSizeGroups and
+	changed spacings to improve the dialog layout.
+
+	* app/gui/file-new-dialog.c
+	* app/widgets/gimpgrideditor.c
+	* app/widgets/gimptemplateeditor.c: minor changes for consistency.
+
+2004-05-21  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gflare/gflare.c
+	* plug-ins/gfli/gfli.c
+	* plug-ins/ifscompose/ifscompose.c
+	* plug-ins/sel2path/sel2path.c
+	* plug-ins/sel2path/sel2path_adv_dialog.c
+	* plug-ins/sgi/sgi.c
+	* plug-ins/winicon/icodialog.c: HIG-ification.
+
+2004-05-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/data-commands.c (data_delete_callback): eek, delete
+	the data only if "OK" was pressed.
+
+2004-05-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimperrorconsole.c
+	(gimp_error_console_save_ext_clicked): use
+	gtk_widget_get_screen(), not window_get_screen() on a button.
+
+2004-05-20  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/imagemap/imap_*.[ch]: (partly) HIG-ified, replaced
+	deprecated widget GtkCList by GtkTreeModel/View (also fixes #136893),
+	use file choosers instead of file selectors, minor clean-up.
+
+2004-05-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/Lighting/lighting_ui.c
+	* plug-ins/MapObject/mapobject_ui.c
+	* plug-ins/bmp/bmpwrite.c
+	* plug-ins/fits/fits.c
+	* plug-ins/flame/flame.c
+	* plug-ins/fp/fp.c
+	* plug-ins/gfig/gfig-preview.c
+	* plug-ins/gfig/gfig.c: HIG-ified.
+
+2004-05-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/FractalExplorer/Dialogs.c
+	* plug-ins/FractalExplorer/FractalExplorer.c: HIG-ification and
+	some code cleanup.
+
+2004-05-19  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/gimpfu.py: Actually return values from the run
+        function. Fixes #141338.
+
+2004-05-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/maze/maze_face.c
+	* plug-ins/xjt/xjt.c: HIG-ified. Say goodbye to "Parameter Settings".
+
+2004-05-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/warp.c
+	* plug-ins/common/whirlpinch.c
+	* plug-ins/common/wmf.c
+	* plug-ins/common/xbm.c
+	* plug-ins/common/xpm.c: HIG-ified.
+
+2004-05-19  Manish Singh  <yosh@gimp.org>
+
+	* app/actions/file-actions.c: remove unnecessary G_OBJECT() casts.
+
+	* tools/pdbgen/pdb/help.pdb
+	* tools/pdbgen/pdb/image.pdb
+	* tools/pdbgen/pdb/paths.pdb
+	* tools/pdbgen/pdb/plug_in.pdb: a bit of quoting clean up.
+
+	* tools/pdbgen/pdb/plug_in.pdb: handle icon_data_length properly.
+
+	* app/pdb/plug_in_cmds.c: regenerated.
+
+2004-05-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/tga.c
+	* plug-ins/common/threshold_alpha.c
+	* plug-ins/common/tiff.c
+	* plug-ins/common/tile.c
+	* plug-ins/common/tileit.c
+	* plug-ins/common/uniteditor.c
+	* plug-ins/common/unsharp.c
+	* plug-ins/common/video.c
+	* plug-ins/common/vpropagate.c: HIG-ified.
+
+2004-05-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/randomize.c
+	* plug-ins/common/ripple.c
+	* plug-ins/common/sample_colorize.c
+	* plug-ins/common/scatter_hsv.c
+	* plug-ins/common/sel_gauss.c
+	* plug-ins/common/sharpen.c
+	* plug-ins/common/shift.c
+	* plug-ins/common/smooth_palette.c
+	* plug-ins/common/snoise.c
+	* plug-ins/common/sobel.c
+	* plug-ins/common/sparkle.c
+	* plug-ins/common/spread.c
+	* plug-ins/common/struc.c
+	* plug-ins/common/sunras.c
+	* plug-ins/common/svg.c: HIG-ified.
+
+2004-05-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpaction.[ch]: new GtkAction subclass which can
+	show either a color or viewable preview in GtkImageMenuItem
+	proxies.
+
+	* app/widgets/gimpenumaction.[ch]
+	* app/widgets/gimppluginaction.[ch]
+	* app/widgets/gimpstringaction.[ch]: derive them from GimpAction.
+
+	* app/widgets/gimpactiongroup.c (gimp_action_group_add_actions):
+	add GimpActions, not GtkActions.
+
+	(gimp_action_group_set_action_color)
+	(gimp_action_group_set_action_viewable): removed all hacks and
+	simply set the "color" or "viewable" properties of the GimpAction
+	to change. Fixes color/viewable previews in menus.
+
+	* app/actions/file-actions.c: show previews in the "Open Recent"
+	menu items.
+
+	Unrelated:
+
+	* app/widgets/widgets-types.h: removed GimpDockedInterface typedef...
+
+	* app/widgets/gimpdocked.h: ...and added it here. We don't have
+	class struct typedefs in the types header either.
+
+	* app/actions/edit-actions.c: added <Ctrl>+semicolon as shortcut
+	for "edit-fill-pattern".
+
+	* app/actions/gradient-editor-actions.c: added some stock IDs.
+	Please comment.
+
+2004-05-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/papertile.c
+	* plug-ins/common/pat.c
+	* plug-ins/common/pixelize.c
+	* plug-ins/common/png.c
+	* plug-ins/common/postscript.c
+	* plug-ins/common/psp.c: HIG-ified.
+
+2004-05-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/mapcolor.c
+	* plug-ins/common/mblur.c
+	* plug-ins/common/mng.c
+	* plug-ins/common/mosaic.c
+	* plug-ins/common/newsprint.c
+	* plug-ins/common/oilify.c: HIG-ified.
+
+2004-05-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/hot.c
+	* plug-ins/common/iwarp.c
+	* plug-ins/common/jpeg.c
+	* plug-ins/common/lic.c
+	* plug-ins/common/mail.c: HIG-ified.
+
+2004-05-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/gauss_iir.c
+	* plug-ins/common/gauss_rle.c
+	* plug-ins/common/gbr.c
+	* plug-ins/common/gee.c
+	* plug-ins/common/gee_zoom.c
+	* plug-ins/common/gif.c
+	* plug-ins/common/gih.c
+	* plug-ins/common/glasstile.c
+	* plug-ins/common/gtm.c: HIG-ified.
+
+2004-05-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/exchange.c: fixed minor dialog layout issues.
+
+	* plug-ins/common/screenshot.c: added the camera icon to the dialog.
+
+	* plug-ins/common/film.c
+	* plug-ins/common/fractaltrace.c: HIG-ified.
+
+2004-05-19  Sven Neumann  <sven@gimp.org>
+
+	* app/paint/gimppaintcore.c (gimp_paint_core_interpolate): make
+	sure that pressure never becomes negative. Fixes bug #123811;
+	thanks to Philip Lafleur for investigating this problem.
+
+2004-05-19  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/channel_mixer.c: added some stock icons.
+
+	* plug-ins/common/edge.c
+	* plug-ins/common/emboss.c
+	* plug-ins/common/engrave.c
+	* plug-ins/common/exchange.c: HIG-ified.
+
+	* plug-ins/common/sel_gauss.c: tiny changes for a more consistent
+	HIG-ification.
+
+2004-05-19  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/plug_in.pdb: made plugin_icon_register() an
+	underscore-prefixed function which needs to be wrapped.
+
+	* libgimp/gimpplugin_pdb.[ch]: regenerated.
+
+	* libgimp/Makefile.am
+	* libgimp/gimp.h
+	* libgimp/gimpplugin.[ch]: new files containing
+	gimp_plugin_icon_register() which has no "icon_data_length"
+	parameter and determines it from the passed icon data.
+
+	* libgimp/gimp.def: added gimp_plugin_icon_register.
+
+	* plug-ins/common/plugindetails.c
+	* plug-ins/common/screenshot.c
+	* plug-ins/common/uniteditor.c
+	* plug-ins/print/print.c: don't pass the icon_data_length.
+
+2004-05-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/checkerboard.c
+	* plug-ins/common/colorify.c
+	* plug-ins/common/colortoalpha.c
+	* plug-ins/common/compose.c
+	* plug-ins/common/convmatrix.c
+	* plug-ins/common/csource.c
+	* plug-ins/common/cubism.c
+	* plug-ins/common/decompose.c
+	* plug-ins/common/deinterlace.c
+	* plug-ins/common/depthmerge.c
+	* plug-ins/common/despeckle.c
+	* plug-ins/common/destripe.c
+	* plug-ins/common/diffraction.c
+	* plug-ins/common/displace.c: HIG-ified.
+
+2004-05-18  Michael Natterer  <mitch@gimp.org>
+
+	Allow plug-ins to register menu icons. Fixes bug #120500.
+
+	* app/core/core-enums.[ch]: added enum GimpIconType which can
+	be one of { STOCK_ID, IMAGE_FILE, INLINE_PIXBUF }.
+
+	* app/config/gimpconfigwriter.[ch] (gimp_config_writer_data)
+	* app/config/gimpscanner.[ch] (gimp_scanner_parse_data): new
+	functions which write/parse raw binary data. Needed for storing
+	inline pixbufs in pluginrc.
+
+	* app/config/gimpconfigwriter.[ch] (gimp_config_writer_identifier):
+	new function which writes out an unquoted and unescaped string.
+
+	* app/plug-in/plug-in-proc.[ch] (struct PlugInProcDef): added
+	new members "icon_type", "icon_data_length" and "icon_data".
+	Reordered members so file_proc specific stuff is at the end.
+
+	(plug_in_proc_def_get_stock_id)
+	(plug_in_proc_def_get_pixbuf): new functions to access the
+	procedure's icon.
+
+	* app/plug-in/plug-in-rc.c: save/restore the registered icons.
+
+	* app/actions/file-dialog-actions.c
+	* app/actions/plug-in-actions.c: set the action's stock ID from
+	the procedure's stock ID.
+
+	* app/widgets/gimppluginaction.c
+	(gimp_plug_in_action_connect_proxy): if the procedure provides a
+	pixbuf, set it as icon for the menu item.
+
+	* app/menus/file-dialog-menu.[ch]
+	* app/menus/file-open-menu.c
+	* app/menus/file-save-menu.c
+	* app/xcf/xcf.c: changed accordingly.
+
+	* tools/pdbgen/pdb/plug_in.pdb (plugin_icon_register): new PDB
+	function which can be called during query().
+
+	* tools/pdbgen/enums.pl
+	* app/pdb/internal_procs.c
+	* app/pdb/plug_in_cmds.c
+	* libgimp/gimpenums.h
+	* libgimp/gimpplugin_pdb.c
+	* libgimp/gimpplugin_pdb.h
+	* plug-ins/pygimp/gimpenums.py
+	* plug-ins/script-fu/script-fu-constants.c: regenerated.
+
+	* plug-ins/common/plugindetails.c
+	* plug-ins/common/uniteditor.c
+	* plug-ins/print/print.c: register stock_id icons.
+
+	* plug-ins/common/screenshot.c: register an inline_pixbuf icon for
+	testing purposes (used emblem-camera.png from gnome-icon-theme).
+
+	* app/actions/dialogs-actions.c
+	* app/actions/file-actions.c: unrelated: added some more icons
+	to menu items.
+
+2004-05-18  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/common/sel_gauss.c: HIGified, fixed indendation, speed
+	improvement (around 70 %).
+
+2004-05-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/blur.c
+	* plug-ins/common/borderaverage.c
+	* plug-ins/common/bumpmap.c
+	* plug-ins/common/ccanalyze.c: HIG-ified.
+
+2004-05-18  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpsizeentry.[ch] (gimp_size_entry_attach_label):
+	return the created label widget so that it can for example be put
+	into a GtkSizeGroup.
+
+	* plug-ins/libgimpoldpreview/gimpoldpreview.[ch]: removed the
+	optional "Preview" frame. Always put the preview into a sunken
+	frame.
+
+	* plug-ins/common/AlienMap2.c
+	* plug-ins/common/blinds.c
+	* plug-ins/common/flarefx.c
+	* plug-ins/common/glasstile.c
+	* plug-ins/common/grid.c
+	* plug-ins/common/illusion.c
+	* plug-ins/common/jigsaw.c
+	* plug-ins/common/max_rgb.c
+	* plug-ins/common/nlfilt.c
+	* plug-ins/common/noisify.c
+	* plug-ins/common/nova.c
+	* plug-ins/common/plasma.c
+	* plug-ins/common/polar.c
+	* plug-ins/common/waves.c
+	* plug-ins/common/wind.c: changed accordingly, HIG-ified.
+
+2004-05-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/aa.c
+	* plug-ins/common/align_layers.c
+	* plug-ins/common/animationplay.c
+	* plug-ins/common/apply_lens.c: HIG-ified.
+
+2004-05-18  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimptoolinfo.c: made the "visible" property serializable.
+
+	* app/tools/gimp-tools.c: store the tools' order and visibility
+	in a new config file called "toolrc".
+
+2004-05-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gimpressionist/brush.c: ported to GtkFileChooser.
+
+	* plug-ins/gimpressionist/gimpressionist.h
+	* plug-ins/gimpressionist/ppmtool.[ch]: sprinkled some const
+	qualifiers.
+
+2004-05-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/curve_bend.c
+	* plug-ins/ifscompose/ifscompose.c: ported to GtkFileChooser and
+	HIG-ified.
+
+2004-05-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/channel_mixer.c
+	* plug-ins/common/gqbist.c: ported to GtkFileChooser and
+	HIG-ified.
+
+	* plug-ins/common/spheredesigner.c: ditto, but needs more love.
+
+2004-05-18  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_label): new
+	function which returns a newly allocated string which is the menu
+	item's name stripped of mnemonics an ellipses.
+
+	* app/actions/plug-in-actions.c (plug_in_actions_update)
+	* app/plug-in/plug-in.c (plug_in_get_undo_desc): use the function
+	instead of implementing the same twice slightly different.
+
+2004-05-17  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/CEL.c
+	* plug-ins/common/CML_explorer.c: ported to GtkFileChooser and
+	HIG-ified.
+
+2004-05-17  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/AlienMap2.c: HIG-ified (more or less).
+
+2004-05-17  Michael Natterer  <mitch@gimp.org>
+
+	* menus/menus.xsl: put the image popup menu into a dummy menubar
+	to work around the silly GtkUIManager restriction that popup menus
+	can't have tearoff items.
+
+	* app/menus/menus.c
+	* app/menus/image-menu.c
+	* app/display/gimpdisplayshell-callbacks.c
+	* app/gui/gui-vtable.c
+	* app/menus/plug-in-menus.c: changed accordingly.
+
+	* app/gui/gui.c (gui_restore_after_callback): connect to
+	"notify::tearoff-menus" of GimpGuiConfig and reconfigure the
+	global image UI manager accordingly.
+
+	* app/config/gimpguiconfig.c: removed GIMP_PARAM_RESTART from the
+	"tearoff-menus" property because GtkUIManager can change this on
+	the fly.
+
+	* app/display/gimpdisplayshell.[ch]: added the menubar to the
+	GimpDisplayShell struct. Some cleanup in gimp_display_shell_new().
+
+	* app/display/gimpdisplayshell-appearance.c
+	(gimp_display_shell_set_show_menubar): use shell->menubar instead
+	of asking the UI manager.
+
+	* app/widgets/gimpuimanager.[ch]: changed gimp_ui_manager_ui_get()
+	to transparently load the XML files even if a sub-widget was
+	requested. Reordered parameters of gimp_ui_manager_ui_popup().
+	Lots of internal cleanups.
+
+	* app/widgets/gimpdockable.c
+	* app/widgets/gimptooloptionseditor.c: simplified accordingly.
+
+	* app/widgets/gimpeditor.[ch]: added new function
+	gimp_editor_popup_menu() which takes a GimpMenuPositionFunc and
+	updates/shows the editor's menu.
+
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimpcomponenteditor.c
+	* app/widgets/gimpcontainereditor.c
+	* app/widgets/gimpcontainergridview.c
+	* app/widgets/gimpcontainertreeview.c
+	* app/widgets/gimperrorconsole.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimppaletteeditor.c: use gimp_editor_popup_menu().
+
+	* app/widgets/gimptoolbox.c: moved all code from
+	gimp_toolbox_new() to GObject::constructor().
+
+2004-05-17  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/tool-options-actions.c: added icons to the Save,
+	Load, Rename and Delete submenus.
+
+2004-05-17  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/edit-actions.c (edit_actions_update): don't forget
+	to set the sensitivity of "edit-named-copy".
+
+2004-05-17  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimage.c (gimp_image_init): initialize the image
+	unit to GIMP_UNIT_PIXEL.
+
+	* app/pdb/image_cmds.c
+	* tools/pdbgen/pdb/image.pdb: allow GIMP_UNIT_PIXEL to be used
+	in the gimp_image_set_unit() PDB call.
+
+2004-05-16  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/old-photo.scm: fixed wrong use of
+	layer ID; bug #142326.
+
+2004-05-15  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpcurvestool.c: fixed position of vertical line
+	indicating the picked color. Patch from William Skaggs and
+	Søren Wedel Nielsen; fixes bug #142506.
+
+2004-05-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-params.c (plug_in_proc_args_check): changed
+	warnings to include the invalid menu path. Added check that makes
+	sure menu paths are either "<Prefix>" or "<Prefix>/foo" but *not*
+	"<Prefix>foo".
+
+	* app/actions/plug-in-actions.c: added function
+	plug_in_actions_check_translation() which validates both the
+	original and translated menu paths and spits detailed error
+	messages if any of them is broken. Made action creation simpler
+	(?) and more robust.
+
+	* app/menus/plug-in-menus.c: argh, the translated menu path must
+	be a sorting criteria *only*. Fixed the whole stuff to always use
+	the original menu path because translation is done entirely by
+	plug-in-actions.c. Fixes bad crashes for all locales. Added
+	boolean return value to plug_in_menus_build_path() and don't try
+	to create the menu item in an invalid location if creating the
+	submenus failed.
+
+2004-05-14  Sven Neumann  <sven@gimp.org>
+
+	* app/menus/file-dialog-menu.c: check if the file procedure
+	registered a menu path at all. The menu should probably be created
+	from the registered menu path, not from gimp->[load|save]_procs.
+
+	* app/plug-in/plug-in-proc.[ch]
+	* app/plug-in/plug-ins.c: removed broken code that used to sort
+	the file procedures.
+
+	* plug-ins/common/CEL.c
+	* plug-ins/common/bz2.c
+	* plug-ins/common/gz.c
+	* plug-ins/common/pcx.c
+	* plug-ins/common/pix.c
+	* plug-ins/common/sunras.c
+	* plug-ins/sgi/sgi.c
+	* plug-ins/xjt/xjt.c: register a mimetype, set a translatable
+	action name (mostly taken from shared-mime-info) and register to
+	the <Load> and <Save> menus using gimp_plugin_menu_register().
+
+2004-05-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/pdb/fileops_cmds.c
+	* libgimp/gimpfileops_pdb.c: regenerated.
+
+2004-05-14  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/select-actions.c (select_actions_update): don't
+	make "select-invert" insensitive if there is no selection.
+
+2004-05-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/aa.c
+	* plug-ins/common/gbr.c
+	* plug-ins/common/gih.c
+	* plug-ins/common/gtm.c
+	* plug-ins/common/header.c
+	* plug-ins/common/pat.c
+	* plug-ins/common/pnm.c
+	* plug-ins/common/psp.c
+	* plug-ins/fits/fits.c
+	* plug-ins/gfli/gfli.c: register a mimetype, set a translatable
+	action name (mostly taken from shared-mime-info) and register to
+	the <Load> and <Save> menus using gimp_plugin_menu_register().
+
+2004-05-14  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/fileops.pdb: added new PDB function
+	gimp_register_file_handler_mime() that allows to associate a MIME
+	type with a file procecdurre.
+
+	* app/pdb/fileops_cmds.c
+	* app/pdb/internal_procs.c
+	* libgimp/gimpfileops_pdb.[ch]: regenerated.
+
+	* app/plug-in/plug-in-proc.[ch]
+	* app/plug-in/plug-in-rc.c
+	* app/plug-in/plug-ins.[ch]: store a mimetype with file procedures.
+
+	* app/actions/file-commands.c
+	* app/core/gimpdocumentlist.[ch]
+	* app/core/gimpimagefile.[ch]
+	* app/file/file-open.[ch]
+	* app/file/file-save.c: set the thumbnail's mimetype from the file
+	procedure used to load/save the image.
+
+	* app/xcf/xcf.c
+	* plug-ins/bmp/bmp.c
+	* plug-ins/common/csource.c
+	* plug-ins/common/dicom.c
+	* plug-ins/common/gif.c
+	* plug-ins/common/gifload.c
+	* plug-ins/common/jpeg.c
+	* plug-ins/common/mng.c
+	* plug-ins/common/png.c
+	* plug-ins/common/postscript.c
+	* plug-ins/common/psd.c
+	* plug-ins/common/psd_save.c
+	* plug-ins/common/sunras.c
+	* plug-ins/common/svg.c
+	* plug-ins/common/tga.c
+	* plug-ins/common/tiff.c
+	* plug-ins/common/wmf.c
+	* plug-ins/common/xbm.c
+	* plug-ins/common/xpm.c
+	* plug-ins/common/xwd.c
+	* plug-ins/faxg3/faxg3.c
+	* plug-ins/winicon/main.c: register a mimetype, set a translatable
+	action name (taken from shared-mime-info) and register to the <Load>
+	and <Save> menus using gimp_plugin_menu_register().
+
+2004-05-13  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/lib.pl
+	* tools/pdbgen/pdbgen.pl: added new procedure variable 'since'
+	that allows to specify when a new function was added. Use that
+	info to generate an appropriate gtk-doc comment.
+
+	* tools/pdbgen/pdb/plug_in.pdb: set since = '2.2' for the new
+	function gimp_plugin_menu_register().
+
+	* libgimp/gimpplugin_pdb.c: regenerated.
+
+2004-05-13  Michael Natterer  <mitch@gimp.org>
+
+	* menus/tool-options-menu.xml: added "name" attributes to all
+	submenus.
+
+	* app/menus/tool-options-menu.c: use the menu names instead of the
+	overly long action names.
+
+	* app/actions/colormap-editor-commands.c
+	* app/actions/tool-options-commands.c: added some callback
+	implementations.
+
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimptooloptionseditor.c: removed the callbacks here
+	and use action buttons.
+
+	* app/actions/actions.c
+	* app/actions/colormap-editor-actions.c
+	* app/actions/edit-actions.c: code review / cleanup.
+
+2004-05-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpcontainer.c (gimp_container_add_handler): don't
+	try to lookup detailed "notify::foo" signal specs.
+
+2004-05-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimptoolview.[ch]: if in list mode, add an "eye"
+	column which toggles tool visibility.
+
+2004-05-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/tools-actions.c (tools_actions_update): don't use
+	action_data_get_context() to update the "tools" action group
+	because it may return NULL. Use gimp_get_user_context() instead
+	because the active tool is global regardless of the action group's
+	context. Fixes accidential tool hiding when closing the last
+	display.
+
+2004-05-13  Sven Neumann  <sven@gimp.org>
+
+	* libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save_thumb): oops.
+
+2004-05-13  Michael Natterer  <mitch@gimp.org>
+
+	Added GimpViewable infrastructure which enables migrating from
+	TempBuf to GdkPixbuf for both providing and getting previews:
+
+	* app/core/gimpviewable.[ch]: added new virtual functions
+	GimpViewable::get_pixbuf() and GimpViewable::get_new_pixbuf()
+	which are implemented exactly as get_preview() and
+	get_new_preview() except that get_new_pixbuf() has a default
+	implementation which creates the pixbuf from a TempBuf.
+
+	Renamed public functions _get_preview_pixbuf() and
+	_get_new_preview_pixbuf() to _get_pixbuf() and _get_new_pixbuf().
+
+	Added gimp_viewable_get_dummy_pixbuf() and use it from
+	gimp_viewable_get_dummy_preview().
+
+	* app/core/gimpimagefile.c (gimp_imagefile_save_thumb)
+	* app/display/gimpdisplayshell.c (gimp_display_shell_update_icon)
+	* app/gui/resize-dialog.c (resize_dialog_new): changed accordingly.
+
+2004-05-13  Sven Neumann  <sven@gimp.org>
+
+	* libgimpthumb/gimpthumbnail.[ch]: added mime-type support.
+
+2004-05-13  Michael Natterer  <mitch@gimp.org>
+
+	* app/menus/Makefile.am: added file-menu.[ch] and
+	file-dialog-menu.[ch]
+
+	* app/menus/menus.[ch]: removed menus_open_recent_add()...
+
+	* app/menus/file-menu.[ch]: ...and added it here as file_menu_setup().
+
+	* app/menus/image-menu.c
+	* app/menus/toolbox-menu.c: changed accordingly.
+
+	* app/menus/file-dialog-menu.[ch]: added factored out code from the
+	file-open and file-save menus as file_dialog_menu_setup().
+
+	* app/menus/file-open-menu.c
+	* app/menus/file-save-menu.c: call file_dialog_menu_setup().
+
+2004-05-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/documents-actions.c
+	* app/actions/documents-commands.c
+	* app/actions/edit-actions.c
+	* app/actions/edit-commands.[ch]
+	* app/actions/layers-actions.c
+	* app/actions/layers-commands.c
+	* app/actions/select-actions.c
+	* app/actions/select-commands.[ch]
+	* app/actions/vectors-actions.c
+	* app/actions/vectors-commands.[ch]: added tooltips for actions
+	which are now used for dialog buttons, added callback
+	implementations which formerly lived in various widgets, moved
+	some actions around and did some general cleanups.
+
+	* menus/image-menu.xml.in: s/edit-stroke/select-stroke/
+
+	* menus/Makefile.am
+	* menus/selection-editor-menu.xml: new popup menu.
+
+	* app/menus/menus.c: register <SelectionEditor> and <UndoEditor>
+	UI managers.
+
+	* app/widgets/gimpeditor.[ch]: added construct properties
+	"menu-factory", "menu-identifier", "ui-path" and "popup-data".
+	Implement GObject::constructor() and create the UI manager
+	if all needed properties were set. Enables creating action
+	buttons at widget construction time because they need a
+	UI manager.
+
+	(gimp_editor_add_action_button): extended to take a va_list of
+	"extended" actions which are invoked if the resp. button emits
+	"extended_clicked". Store the actions and their modifier masks in
+	a list attached to the button.
+
+	* app/widgets/gimpcontainerview.c
+	(gimp_container_view_item_selected): if the view has container
+	*and* context, simply change the context and return.
+
+	(gimp_container_view_context_changed): don't emit "select_item"
+	manually but simply call gimp_container_view_select_item().
+
+	(gimp_container_view_viewable_dropped): use
+	gimp_container_view_item_selected() instead of changing the
+	context directly.
+
+	* app/widgets/gimpcontainereditor.c
+	(gimp_container_editor_select_item): update the UI manager.
+
+	* app/widgets/gimpdockable.c: don't try to fiddle with the
+	dialog's menu if it doesn't have a ui_path (happens if the UI
+	manager is just a collection of actions for the dialog buttons and
+	has no menu registered).
+
+	* app/widgets/gimpimageeditor.c: connect to the image's "flush"
+	signal and update the UI manager in the callback.
+
+	* app/widgets/gimpitemtreeview.c: use GimpEditor's construct
+	properties to create the UI manager so GimpItemTreeView subclasses
+	can have action buttons. Update the UI manager in
+	gimp_item_tree_view_select_item().
+
+	* app/widgets/gimpbufferview.c
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimpcontainergridview.c
+	* app/widgets/gimpdatafactoryview.c
+	* app/widgets/gimpfontview.c
+	* app/widgets/gimpimageview.c
+	* app/widgets/gimptemplateview.c
+	* app/widgets/gimptoolview.c: changed calls to
+	gimp_editor_add_action_button() accordingly and removed some
+	unneeded select_item() implementations.
+
+	* app/widgets/gimpchanneltreeview.c
+	* app/widgets/gimpvectorstreeview.[ch]
+	* app/widgets/gimpdocumentview.[ch]
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpselectioneditor.[ch]
+	* app/widgets/gimpundoeditor.[ch]: use action buttons and removed
+	lots of callbacks which went to the resp. action callbacks.
+
+	* app/widgets/widgets-types.h: removed some now unneeded function
+	prototypes.
+
+	* app/gui/dialogs-constructors.c: changed (simplified) many dialog
+	constructors accordingly.
+
+2004-05-12  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal)
+	* app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock):
+	left-align the label.
+
+	* app/actions/channels-commands.c
+	* app/actions/layers-commands.c
+	* app/actions/qmask-commands.c
+	* app/actions/vectors-commands.c
+	* app/display/gimpdisplayshell-scale.c
+	* app/gui/brush-select.c
+	* app/gui/file-new-dialog.c
+	* app/gui/info-dialog.c
+	* app/gui/info-window.c
+	* app/gui/module-browser.c
+	* app/gui/offset-dialog.c
+	* app/gui/palette-import-dialog.c
+	* app/gui/preferences-dialog.c
+	* app/gui/resize-dialog.c
+	* app/tools/gimpblendoptions.c
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpmeasuretool.c
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimpscaletool.c
+	* app/tools/gimpselectionoptions.c
+	* app/tools/gimpsheartool.c
+	* app/tools/gimptextoptions.c
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimpgrideditor.c
+	* app/widgets/gimphistogrameditor.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpstrokeeditor.c
+	* app/widgets/gimpwidgets-utils.c: left-align labels as suggested
+	by the HIG.
+
+2004-05-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/config/gimpconfig-deserialize.c
+	* app/config/gimpscanner.c
+	* app/core/gimp-edit.c
+	* app/core/gimpchannel-combine.c
+	* app/core/gimpcontainer.c
+	* app/core/gimpdrawable-bucket-fill.c
+	* app/core/gimpdrawable-combine.c
+	* app/core/gimpdrawable.c
+	* app/core/gimpgradient.c
+	* app/core/gimpimage-flip.c
+	* app/core/gimpimage-merge.c
+	* app/core/gimpimage-projection.c
+	* app/core/gimpimage.c
+	* app/display/gimpdisplay-handlers.c
+	* app/display/gimpdisplayshell-callbacks.c
+	* app/display/gimpprogress.c
+	* app/gui/info-dialog.c
+	* app/gui/module-browser.c
+	* app/gui/offset-dialog.c
+	* app/plug-in/plug-in.c
+	* app/tools/gimpdrawtool.c
+	* app/tools/tool_manager.c
+	* app/widgets/gimpactiongroup.c
+	* app/widgets/gimpdialogfactory.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimpitemfactory.c
+	* app/widgets/gimppropwidgets.c
+	* app/widgets/gimpwidgets-utils.c
+	* app/xcf/xcf-save.c
+	* libgimp/gimpexport.c
+	* libgimpwidgets/gimphelpui.c
+	* libgimpwidgets/gimppixmap.c
+	* libgimpwidgets/gimpunitmenu.c: replaced G_GNUC_FUNCTION,
+	G_GNUC_PRETTY_FUNCTION, G_STRLOC and hardcoded function names in
+	g_warning()s by G_STRFUNC.
+
+2004-05-12  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/gradients-actions.c
+	* app/actions/palettes-actions.c
+	* app/actions/patterns-actions.c: added/fixed tooltips.
+
+2004-05-11  Michael Natterer  <mitch@gimp.org>
+
+	* configure.in: define G*_DISABLE_DEPRECATED for all G* modules
+	except GTK+. Don't do so if compiling against GLib, GTK+ >= 2.5.0
+	and Pango >= 1.5.0
+
+	* libgimpwidgets/gimpoffsetarea.c: s/gdk_gc_unref/g_object_unref/
+
+	* app/config/gimpconfig-deserialize.c
+	* app/widgets/gimpdeviceinfo.c:
+	s/g_value_set_foo_take_ownership/g_value_take_foo/
+
+	* app/text/gimptext-vectors.c
+	* app/text/gimptext-bitmap.c:
+	s/pango_ft2_font_get_face/pango_fc_font_lock,unlock_face/
+
+2004-05-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/images-commands.c: added missing #includes.
+
+2004-05-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcontainermenu.[ch]
+	* app/widgets/gimpcontainermenuimpl.[ch]
+	* app/widgets/gimpmenuitem.[ch]: removed. Obsoleted by
+	GimpContainerViewInterface implemented by GimpContainerComboBox.
+
+2004-05-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/actions.[ch]: added action_data_get_context() and
+	macro return_if_no_context().
+
+	* app/actions/brushes-actions.c
+	* app/actions/buffers-actions.c
+	* app/actions/buffers-commands.c
+	* app/actions/data-commands.c
+	* app/actions/fonts-actions.c
+	* app/actions/fonts-commands.c
+	* app/actions/gradients-actions.c
+	* app/actions/images-actions.c
+	* app/actions/images-commands.c
+	* app/actions/palettes-actions.c
+	* app/actions/patterns-actions.c
+	* app/actions/templates-actions.c
+	* app/actions/templates-commands.[ch]
+	* app/actions/tools-actions.c
+	* app/actions/tools-commands.c: moved lots of code from widgets/
+	to the resp. action callbacks.
+
+	* app/widgets/gimpeditor.[ch]: added gimp_editor_add_action_button()
+	which creates a GtkButton connected to the resp. action.
+
+	* app/widgets/gimpdatafactoryview.[ch]: added "action_group"
+	parameters so we can distinguish brushes, patterns etc. actions.
+
+	* app/widgets/gimpimageview.[ch]
+	* app/widgets/gimpbrushfactoryview.c
+	* app/widgets/gimpbufferview.c
+	* app/widgets/gimpfontview.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimppatternfactoryview.c
+	* app/widgets/gimptemplateview.[ch]
+	* app/widgets/gimptoolview.c: removed tons of GtkButton::clicked()
+	callbacks and use gimp_editor_add_action_button() instead
+	of simply _add_button().
+
+	* app/gui/dialogs-constructors.c
+	* app/gui/gradient-select.c
+	* app/gui/palette-select.c
+	* app/gui/pattern-select.c: changed accordingly.
+
+2004-05-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpcontainercombobox.c: correctly get the default
+	GimpContainerViewInterface implementation and chain up to it for
+	clear_items(). Update the preview renderers on "update", enable
+	deselecting everything.
+
+	* app/widgets/gimpimagedock.[ch]
+	* app/gui/file-new-dialog.c
+	* app/gui/palette-import-dialog.c
+	* app/gui/preferences-dialog.c
+	* app/gui/stroke-dialog.c: use GimpContainerComboBox instead of
+	GimpContainerMenuImpl.
+
+	* app/gui/palette-import-dialog.c: cleanup.
+
+2004-05-11  Sven Neumann  <sven@gimp.org>
+
+	* docs/gimptool.1.in: fixed spelling.
+
+2004-05-11  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpcontainertreeview.c: minor cleanup.
+
+2004-05-11  Michael Schumacher <schumaml@cvs.gnome.org>
+
+	* libgimp/gimp.def
+	* libgimpbase/gimpbase.def: updated
+
+2004-05-11  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/user-install-dialog.c: removed the "Aborting
+	Installation" page. We added it as a nice little gimmick but
+	obviously people don't understand it's purpose. Fixes bug #142281.
+
+2004-05-11  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcontainercombobox.[ch]: added new widget, almost
+	finished.
+
+	* app/widgets/gimpcontainerview.[ch]: added convenience functions
+	to get and set the GimpContainerView properties.
+
+	* app/widgets/gimpcontainerbox.c: use the convenience functions.
+
+	* app/gui/file-new-dialog.c: use the new GimpContainerComboBox.
+
+	* etc/templaterc: use "pixels" as the unit for pixel sized templates.
+
+2004-05-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpchanneltreeview.c
+	* app/widgets/gimpcontainerbox.[ch]
+	* app/widgets/gimpcontainereditor.c
+	* app/widgets/gimpcontainergridview.[ch]
+	* app/widgets/gimpcontainerpopup.c
+	* app/widgets/gimpcontainertreeview.[ch]
+	* app/widgets/gimpdatafactoryview.c
+	* app/widgets/gimpdocumentview.c
+	* app/widgets/gimpfontview.c
+	* app/widgets/gimpimageview.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimppatternfactoryview.c
+	* app/widgets/gimptemplateview.c
+	* app/widgets/gimpvectorstreeview.c: code review / cleanup.
+
+2004-05-11  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcontainerview.[ch]: made GimpContainerView an
+	interface. Added accessors for all members in the private struct
+	and made it really private.
+
+	* app/widgets/gimpcontainerbox.[ch]: derive it from GimpEditor and
+	implement GimpContainerViewInterface and its properties.
+
+	* app/widgets/gimpchanneltreeview.c
+	* app/widgets/gimpcontainergridview.c
+	* app/widgets/gimpcontainertreeview.c
+	* app/widgets/gimpcontainertreeview-dnd.c
+	* app/widgets/gimpdrawabletreeview.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpvectorstreeview.c: implement
+	GimpContainerViewInterface and use the new accessor functions.
+
+	* app/widgets/gimpcontainerpopup.c
+	* app/widgets/gimpdocumentview.c: changed accordingly.
+
+	* app/widgets/gimptemplateview.c
+	* app/widgets/gimpcontainereditor.c
+	* app/widgets/gimpundoeditor.c
+	* app/actions/palettes-commands.c: #include "gimpcontainerview.h"
+
+2004-05-11  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimp.def
+	* libgimp/gimpui.def
+	* libgimpbase/gimpbase.def
+	* libgimpwidgets/gimpwidgets.def: updated.
+
+2004-05-10  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpframe.c (gimp_frame_style_set): removed a
+	redundant call to gtk_widget_queue_resize().
+
+2004-05-10  Sven Neumann  <sven@gimp.org>
+
+	* app/xcf/xcf-save.c (xcf_save_prop): fixed size of colormap
+	property. Patch by Daniel Kobras, fixes bug #142149.
+
+2004-05-10  Henrik Brix Andersen  <brix@gimp.org>
+
+	* plug-ins/common/screenshot.c (shoot_dialog): fixed the spacing
+	of the dialog, thanks to Sven for pointing out my mistake.
+
+2004-05-10  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimptexteditor.c (gimp_text_editor_set_direction):
+	don't call gtk_widget_set_direction() on a non-existant widget.
+	Fixes bug #141792.
+
+2004-05-10  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/tips-dialog.c: added missing newline in error message.
+
+2004-05-10  Michael Natterer  <mitch@gimp.org>
+
+	More GimpContainerView chopping:
+
+	* app/widgets/gimpcontainerview.[ch]: added
+	GimpContainerViewPrivate struct (which is currently public :-) and
+	removed all members from the GimpContainerView struct. Added
+	accessors for "context", "container" and "preview_size /
+	preview_border_width". Added macro to get the private struct
+	(*not* via G_TYPE_INSTANCE_GET_PRIVATE because that's unavailable
+	for interfaces).
+
+	* app/widgets/gimpbrushfactoryview.c
+	* app/widgets/gimpbufferview.c
+	* app/widgets/gimpchanneltreeview.c
+	* app/widgets/gimpcontainerbox.c
+	* app/widgets/gimpcontainereditor.c
+	* app/widgets/gimpcontainergridview.c
+	* app/widgets/gimpcontainerpopup.c
+	* app/widgets/gimpcontainertreeview-dnd.c
+	* app/widgets/gimpcontainertreeview.c
+	* app/widgets/gimpdatafactoryview.c
+	* app/widgets/gimpdocumentview.c
+	* app/widgets/gimpfontview.c
+	* app/widgets/gimpimageview.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimpsessioninfo.c
+	* app/widgets/gimptemplateview.c
+	* app/widgets/gimptoolview.c
+	* app/actions/brushes-actions.c
+	* app/actions/buffers-actions.c
+	* app/actions/dockable-actions.c
+	* app/actions/dockable-commands.c
+	* app/actions/documents-actions.c
+	* app/actions/fonts-actions.c
+	* app/actions/gradients-actions.c
+	* app/actions/gradients-commands.c
+	* app/actions/images-actions.c
+	* app/actions/palettes-actions.c
+	* app/actions/palettes-commands.c
+	* app/actions/patterns-actions.c
+	* app/actions/templates-actions.c
+	* app/actions/tools-actions.c
+	* app/actions/tools-commands.c: changed accordingly.
+
+2004-05-10  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpmagnifyoptions.[ch]
+	* app/tools/gimpmagnifytool.c: applied a patch from William Skaggs
+	that changes a misleading option label. Fixes bug #137508.
+
+2004-05-10  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpdisplayconfig.c (DEFAULT_IMAGE_TITLE_FORMAT):
+	removed the display scale from the default image title because
+	it's now displayed in the statusbar. Show the image pixel size
+	instead.
+
+	* app/gui/preferences-dialog.c: include a preset for the title
+	format string that shows the image size (bug #141720).
+
+2004-05-10  Michael Natterer  <mitch@gimp.org>
+
+	Prepare for making an interface out of GimpContainerView:
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpcontainerbox.[ch]: new GimpContainerView
+	subclass which implements GimpDocked interface and contains the
+	vbox-with-scrolled-window stuff common to GimpContainerGridView
+	and GimpContainerTreeView.
+
+	* app/widgets/gimpcontainerview.[ch]: removed that functionality
+	here.
+
+	* app/widgets/gimpcontainergridview.[ch]
+	* app/widgets/gimpcontainertreeview.[ch]: derive them from
+	GimpContainerBox.
+
+	* app/gui/brush-select.c
+	* app/gui/font-select.c
+	* app/gui/gradient-select.c
+	* app/gui/palette-select.c
+	* app/gui/pattern-select.c
+	* app/widgets/gimpcontainerpopup.c: changed accordingly.
+
+2004-05-10  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/view-actions.c: added a stock icon for "view-zoom-1-1".
+
+	* app/widgets/gimpunitcombobox.[ch]: added functions to get and
+	set the active unit.
+
+	* app/widgets/gimpunitstore.c (gimp_unit_store_tree_model_get_value):
+	need to special case GIMP_UNIT_PIXEL.
+
+	* app/display/Makefile.am
+	* app/display/display-types.h
+	* app/display/gimpscalecombobox.[ch]: new widget to be used in the
+	display's statusbar.
+
+	* app/display/gimpdisplayshell-cursor.[ch]: always display the
+	cursor position, not only if the cursor is inside the image. Added
+	new function gimp_display_shell_clear_cursor() to clear the cursor
+	label.
+
+	* app/display/gimpdisplayshell-callbacks.c: changed accordingly.
+
+	* app/display/gimpstatusbar.[ch]
+	* app/display/gimpdisplayshell.c
+	* app/display/gimpdisplayshell-handlers.c
+	* app/display/gimpdisplayshell-scale.c: do not explicitely resize
+	the statusbar cursor label, connect to GimpDisplayShell::scaled
+	instead. Added a GimpScaleComboBox to the status bar.
+
+2004-05-10  Michael Natterer  <mitch@gimp.org>
+
+	Started making the toolbox configurable.
+	Addresses bug #105764. Not finished yet.
+
+	* app/core/gimptoolinfo.[ch]: renamed "in_toolbox" to "visible"
+	and made it a GObject property.
+
+	* app/tools/gimp-tools.[ch]: added new function
+	gimp_tools_get_default_order() which returns a GList of tool
+	identifiers.
+
+	* app/actions/tools-actions.c
+	* app/actions/tools-commands.[ch]: added actions & callbacks for
+	toggling the "visible" boolean and for resetting all tools.
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimptoolview.[ch]: new widget which allows to
+	toggle a tool's visibility and to reorder the tools.
+
+	* app/widgets/gimptoolbox.[ch]: removed member "GtkWidget *trash"
+	and pack all tool buttons into the same wrap box. Connect to
+	"reoder" of the tool container and to "notify::visible" of all
+	tool infos and update the toolbox accordingly.
+
+	* app/gui/dialogs-constructors.c: create a GimpToolView for the
+	tools list/grid.
+
+	* app/menus/menus.c: register a <Tools> menu for the dialog above.
+
+	* menus/Makefile.am
+	* menus/tools-menu.xml: added the menu.
+
+2004-05-10  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpuimanager.c: re-added help for menu items. Still
+	incomplete because there is no fallback help ID yet when pressing
+	F1 over a menu item which has a submenu. Added evil workaround and
+	version check for signal brokenness of GtkUIManager in GTK+ 2.4.1.
+
+2004-05-09  Hans Breuer  <hans@breuer.org>
+
+	Merge from stable branch :
+
+	* plug-ins/common/winclipboard.c : support gray images;
+	fixes bug #141382
+
+	* plug-ins/common/winprint.c : dito; fixes bug #141145
+
+2004-05-09  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/common/aa.c
+	* plug-ins/common/apply_lens.c
+	* plug-ins/common/autocrop.c
+	* plug-ins/common/autostretch_hsv.c: HIGified, GPL license added in
+	some plug-ins, minor code clean-up.
+
+2004-05-08  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/common/spread.c: HIGified, simplified and fixes #141733
+
+2004-05-08  Henrik Brix Andersen  <brix@gimp.org>
+
+	* plug-ins/common/screenshot.c (shoot_dialog): HIGify the
+	screenshot plug-in. Fixes part of bug #141772.
+
+2004-05-08  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpstatusbar.c (gimp_statusbar_resize_cursor):
+	added 1 pixel horizontal padding around the label.
+
+2004-05-08  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpstatusbar.[ch]: renamed struct member combo to
+	unit_combo. Place the combobox into the cursor frame.
+
+2004-05-08  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpunitcombobox.[ch]
+	* app/widgets/gimpunitstore.[ch]: added a prototype of a unit menu
+	based on GtkComboBox. Will move this to libgimpwidgets later...
+
+	* app/display/gimpstatusbar.[ch]: use the new GimpUnitComboBox and
+	GimpUnitStore.
+
+	* themes/Default/gtkrc
+	* themes/Small/gtkrc: hardcode the appearance of the
+	GimpUnitComboBox. It uses a hack that doesn't work in list mode.
+
+2004-05-07  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimage-colormap.[ch]: added a const qualifier.
+
+	Changed how the image unit and dot-for-dot mode is handled. Might
+	break things and certainly needs more changes (mainly in tools):
+
+	* app/core/gimptemplate.c: allow GIMP_UNIT_PIXEL as image unit.
+
+	* app/display/gimpdisplayshell-handlers.c
+	* app/display/gimpdisplayshell-scale.c
+	* app/display/gimpdisplayshell-title.c
+	* app/display/gimpstatusbar.c: always use the image unit for the
+	rulers and to display lengths.
+
+	* app/widgets/gimptemplateeditor.c: redone GimpTemplateEditor
+	based on a dialog mockup from Jimmac and Tigert.
+
+	* app/core/core-enums.[ch]: changed some descriptions used by the
+	template editor.
+
+2004-05-07  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/AlienMap2.c
+	* plug-ins/common/CML_explorer.c
+	* plug-ins/common/animationplay.c
+	* plug-ins/common/despeckle.c
+	* plug-ins/fp/fp.c
+	* plug-ins/gfig/gfig.c
+	* plug-ins/gflare/gflare.c
+	* plug-ins/script-fu/script-fu.c
+	* plug-ins/twain/twain.c: forgot some gimp_plugin_menu_register().
+
+2004-05-07  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/FractalExplorer/FractalExplorer.c
+	* plug-ins/Lighting/lighting_main.c
+	* plug-ins/MapObject/mapobject_main.c
+	* plug-ins/dbbrowser/dbbrowser.c
+	* plug-ins/flame/flame.c
+	* plug-ins/gimpressionist/gimp.c
+	* plug-ins/ifscompose/ifscompose.c
+	* plug-ins/imagemap/imap_main.c
+	* plug-ins/maze/maze.c
+	* plug-ins/pagecurl/pagecurl.c
+	* plug-ins/print/print.c
+	* plug-ins/rcm/rcm.c
+	* plug-ins/winsnap/winsnap.c
+	* plug-ins/common/[g-z]*.c: use gimp_plugin_menu_register(). Some
+	formatting cleanups in some query() functions.
+
+2004-05-07  Michael Natterer  <mitch@gimp.org>
+
+	* app/plug-in/plug-in-proc.[ch]: removed member "accelerator".
+	It was never set and this is the conceptually wrong place to store
+	it anyway.
+
+	* app/actions/file-dialog-actions.c
+	* app/actions/plug-in-actions.c
+	* app/plug-in/plug-in-message.c
+	* app/xcf/xcf.c: changed accordingly.
+
+	* tools/pdbgen/pdb/plug_in.pdb (plugins_query): always return NULL
+	as accelerator. Cleaned up the function a bit and made it aware of
+	proc_def->menu_label added below.
+
+	* app/pdb/plug_in_cmds.c: regenerated.
+
+2004-05-07  Michael Natterer  <mitch@gimp.org>
+
+	Changed plug-in menu registration again to allow passing just the
+	menu item's label (not the full path) in gimp_install_procedure()
+	and only the path (excluding the item's label) in
+	gimp_plugin_menu_register(). Matches the internal action system
+	better and makes translating the menu paths much easier.
+
+	(Of yourse it's still possible to use the old syntax for backward
+	compatibility).
+
+	* app/plug-in/plug-in-proc.[ch]: added "gchar *menu_label".
+
+	* app/plug-in/plug-in-params.[ch]: added new functions
+	plug_in_param_defs_check() and plug_in_proc_args_check() which
+	check if a procedure's parameters match its menu location
+	(e.g. <Image> needs RUN-MODE, IMAGE, DRAWABLE).
+
+	* app/plug-in/plug-in-message.c (plug_in_handle_proc_install): if
+	registering an old-style (full) menu_path, use
+	plug_in_param_defs_check(), set proc_def->menu_label otherwise.
+
+	* tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): use
+	plug_in_proc_args_check() on the passed menu_path and make sure
+	old and new style menu registration are not mixed.
+
+	* app/pdb/plug_in_cmds.c: regenerated.
+
+	* app/plug-in/plug-in-rc.c: save/restore "menu_label".
+
+	* app/actions/file-dialog-actions.c
+	* app/actions/plug-in-actions.c
+	* app/menus/plug-in-menus.c: changed action/menu creation
+	accordingly. Some hacks needed to allow both old and new style
+	menu_label/menu_paths.
+
+	* app/plug-in/plug-in.c
+	* app/widgets/gimpfiledialog.c
+	* app/xcf/xcf.c: changed accordingly.
+
+	* plug-ins/common/align_layers.c
+	* plug-ins/common/animationplay.c
+	* plug-ins/common/animoptimize.c
+	* plug-ins/common/apply_lens.c
+	* plug-ins/common/autocrop.c
+	* plug-ins/common/autostretch_hsv.c
+	* plug-ins/common/blinds.c
+	* plug-ins/common/blur.c
+	* plug-ins/common/borderaverage.c
+	* plug-ins/common/bumpmap.c
+	* plug-ins/common/c_astretch.c
+	* plug-ins/common/ccanalyze.c
+	* plug-ins/common/channel_mixer.c
+	* plug-ins/common/checkerboard.c
+	* plug-ins/common/color_enhance.c
+	* plug-ins/common/colorify.c
+	* plug-ins/common/colortoalpha.c
+	* plug-ins/common/compose.c
+	* plug-ins/common/convmatrix.c
+	* plug-ins/common/cubism.c
+	* plug-ins/common/curve_bend.c
+	* plug-ins/common/decompose.c
+	* plug-ins/common/deinterlace.c
+	* plug-ins/common/depthmerge.c
+	* plug-ins/common/destripe.c
+	* plug-ins/common/diffraction.c
+	* plug-ins/common/displace.c
+	* plug-ins/common/edge.c
+	* plug-ins/common/emboss.c
+	* plug-ins/common/engrave.c
+	* plug-ins/common/exchange.c
+	* plug-ins/common/film.c
+	* plug-ins/common/flarefx.c
+	* plug-ins/common/fractaltrace.c
+	* plug-ins/common/screenshot.c: ported the first few plug-ins
+	to the new registration scheme.
+
+2004-05-06  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/pdb/app.pl: make libgimp* headers always included
+	before any app headers.
+
+        * tools/pdbgen/pdb/paint_tools.pdb: Fix silly "Dodgebure" typo.
+
+	* app/pdb/*_cmds.c: regenerated.
+
+2004-05-06  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpdrawable-preview.c
+	* app/core/gimpimage-projection.c: added sanity so we don't just
+	plain crash when an indexed image doesn't have a colormap.
+
+	* plug-ins/common/png.c: keep at least one entry in the colormap.
+	Fixes bug #142029.
+
+2004-05-06  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/common/sobel.c: replaced RMS macro by smarter one,
+	resulting in a doubling in speed for this plug-in.
+
+	* plug-ins/fp/fp.c: include stdlib for free, malloc and abs.
+
+2004-05-06  Maurits Rijk  <m.rijk@chello.nl>
+
+	* plug-ins/fp/fp_gdk.c
+	* plug-ins/fp/fp_gtk.c
+	* plug-ins/fp/fp_misc.c
+	* plug-ins/fp/fp.h: removed
+
+	* plug-ins/fp/Makefile.am: changed accordingly
+
+	* plug-ins/fp/fp.c: merged into one single file to get rid of all
+	global variables and functions. Major clean-up. Still more to come.
+
+2004-05-06  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/about-dialog.c: center the about dialog on the monitor,
+	not on the screen. Fixes window position on xinerama setups.
+
+2004-05-06  Michael Natterer  <mitch@gimp.org>
+
+	* tools/pdbgen/pdb/plug_in.pdb: renamed gimp_plugin_menu_add() to
+	gimp_plugin_menu_register() for consistency with other
+	gimp_plugin_foo_register() functions which can be called during
+	query().
+
+	* app/pdb/plug_in_cmds.c
+	* libgimp/gimpplugin_pdb.[ch]: regenerated.
+
+	* plug-ins/common/ccanalyze.c
+	* plug-ins/common/colortoalpha.c
+	* plug-ins/common/screenshot.c
+	* plug-ins/winsnap/winsnap.c: changed accordingly.
+
+2004-05-06  Michael Natterer  <mitch@gimp.org>
+
+	Enabled multiple menu entries per plug-in procedure:
+
+	* app/plug-in/plug-in-proc.[ch]: changed "gchar *menu_path" to
+	"GList *menu_paths".
+
+	* app/plug-in/plug-in-message.c
+	* app/plug-in/plug-in-rc.c
+	* app/plug-in/plug-in.c
+	* app/plug-in/plug-ins.c
+	* app/menus/menus.c
+	* app/widgets/gimpfiledialog.c
+	* app/xcf/xcf.c: changed accordingly.
+
+	* app/actions/file-dialog-actions.c
+	* app/actions/plug-in-actions.c: create an action for the first
+	element of proc_def->menu_paths.
+
+	* app/gui/gui-vtable.c
+	* app/menus/plug-in-menus.[ch]: create proxy widgets for each
+	element of proc_def->menu_paths.
+
+	* tools/pdbgen/pdb/plug_in.pdb: added new function
+	gimp_plugin_menu_add() which can be called during query() and adds
+	a menu path to a procedure registered by the calling plugin.
+
+	* app/pdb/internal_procs.c
+	* app/pdb/plug_in_cmds.c
+	* libgimp/gimpplugin_pdb.[ch]: regenerated.
+
+	* menus/image-menu.xml.in
+	* menus/toolbox-menu.xml.in: added lots of <placeholder>s for
+	logical groups (like Image/Resize, Image/Scale, Image/Crop
+	etc.). Added empty placeholder File/Send for stuff like print and
+	mail. Added an "Acquire" menu under <Image>/File
+
+	* plug-ins/common/mail.c
+	* plug-ins/print/print.c
+	* plug-ins/common/winprint.c: register under File/Send.
+
+	* plug-ins/common/screenshot.c
+	* plug-ins/winsnap/winsnap.c: also register under
+	<Image>/File/Acquire.
+
+	* plug-ins/common/autocrop.c
+	* plug-ins/common/ccanalyze.c
+	* plug-ins/common/colortoalpha.c
+	* plug-ins/common/threshold_alpha.c
+	* plug-ins/common/zealouscrop.c: register additional menu entries
+	under placeholders in the "Image" and "Layer" menus. This is not
+	meant to be final but just a hint to keep in mind when
+	reorganizing the plug-in menus.
+
+2004-05-06  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/resize-dialog.[ch]: cleaned up variable names and
+	external API. Still quite a mess.
+
+	* app/Makefile.am
+	* app/actions/image-commands.c
+	* app/actions/layers-commands.c: changed accordingly.
+
+2004-05-06  Sven Neumann  <sven@gimp.org>
+
+	* app/menus/menus.c: no need for including gimp-intl.h.
+
+2004-05-06  Michael Natterer  <mitch@gimp.org>
+
+	* configure.in
+	* app/Makefile.am
+	* app/menus/.cvsignore
+	* app/menus/Makefile.am
+	* app/menus/menus-types.h
+	* app/menus/menus.[ch]
+	* app/menus/file-open-menu.[ch]
+	* app/menus/file-save-menu.[ch]
+	* app/menus/image-menu.[ch]
+	* app/menus/plug-in-menus.[ch]
+	* app/menus/tool-options-menu.[ch]
+	* app/menus/toolbox-menu.[ch]: moved all menus files to their
+	own directory.
+
+	* app/gui/Makefile.am
+	* app/gui/menus.[ch]
+	* app/gui/file-open-menu.[ch]
+	* app/gui/file-save-menu.[ch]
+	* app/gui/image-menu.[ch]
+	* app/gui/plug-in-menus.[ch]
+	* app/gui/tool-options-menu.[ch]
+	* app/gui/toolbox-menu.[ch]: removed them here.
+
+	* app/actions/debug-commands.c
+	* app/actions/file-commands.c
+	* app/gui/brush-select.c
+	* app/gui/dialogs.c
+	* app/gui/font-select.c
+	* app/gui/gradient-select.c
+	* app/gui/gui-vtable.c
+	* app/gui/gui.c
+	* app/gui/palette-select.c
+	* app/gui/pattern-select.c
+	* app/gui/preferences-dialog.c: changed #includes accordingly.
+
+2004-05-05  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/file-new-dialog.c: use a normal GimpDialog instead of a
+	GimpViewableDialog that never has a viewable set.
+
+2004-05-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/brush-select.[ch] (brush_select_new): reordered parameters
+	so the first four are the same for all foo_select_new() functions.
+
+	* tools/pdbgen/pdb/brush_select.pdb: changed accordingly.
+
+	* app/pdb/brush_select_cmds.c: regenerated.
+
+	* app/gui/font-select.c (font_select_new): set the vbox'
+	border width to 6 to match the other foo_select dialogs.
+
+2004-05-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/debug-actions.c
+	* app/actions/debug-commands.[ch]
+	* menus/toolbox-menu.xml.in: added action & callback which XML-dump
+	all UI managers.
+
+2004-05-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/plug-in-actions.c (plug_in_actions_add_proc): fixed
+	bug which would have leaked broken menu translations.
+
+	* app/gui/plug-in-menus.c: removed useless #includes.
+
+2004-05-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/file-actions.c
+	* app/actions/file-commands.[ch]: remove "file-close" action and
+	callback...
+
+	* app/actions/view-actions.c
+	* app/actions/view-commands.[ch]: ...and added it here as
+	"view-close" because that's what it does.
+
+	* app/actions/qmask-actions.c
+	* app/actions/qmask-commands.c: s/QMask/QuickMask/g
+
+	* app/gui/menus.c: add the "channels" action group to the <Image>
+	and <Dock> UI managers, renamed UI manager <Dialogs> to
+	<Dockable>.
+
+	* app/widgets/gimpdockbook.c: s/<Dialogs>/<Dockable>/.
+
+	* menus/image-menu.xml.in: s/file-close/view-close/, added
+	separators at the end of most menus, moved the bottom group of the
+	"View" menu after the zoom group.
+
+2004-05-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/select-actions.c: removed action "select-by-color".
+
+	* app/tools/gimpbycolorselecttool.c: add the shortcut here.
+
+	* app/actions/tools-actions.c: added alternative tool actions for
+	"by-color-select" and "rotate" which are identical to the ones
+	generated from the GimpToolInfo except for their label. Make sure
+	they have the same accelerators as the generated ones.
+
+	* menus/image-menu.xml.in: use the alternative actions for
+	"<Image>/Select/By Color" and
+	"<Layer>/Transform/Arbitrary Rotation...".
+
+2004-05-05  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimphelpui.c: documentation.
+
+2004-05-05  Michael Natterer  <mitch@gimp.org>
+
+	Finally enable global accelerators in all docks:
+
+	* app/widgets/gimpimagedock.c (gimp_image_dock_constructor):
+	iterate all of the UI manager's actions and enable their
+	accelerators manually. Fixes bug #119878.
+
+2004-05-05  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpviewabledialog.c: added construct properties to
+	make it possible to derive from GimpViewableDialog.
+
+	* app/widgets/gimptooldialog.[ch]: make GimpToolDialog a real
+	object, not just a convenience constructor.
+
+	* themes/Default/gtkrc
+	* themes/Small/gtkrc: set a smaller border_width of 6 pixels for
+	the action area of tool dialogs.
+
+	* app/tools/gimpcolorpickertool.c
+	* app/tools/gimpimagemaptool.c: set a smaller border_width of 6
+	pixels on tool dialogs to make them more compact.
+
+2004-05-05  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimpoffsetarea.[ch]: added new function
+	gimp_offset_area_set_pixbuf(). Started to clean up the
+	code a bit.
+
+	* app/gui/resize-dialog.c (resize_widget_new): use the new feature
+	and set a preview of the image. Fixes bug #78733.
+
+2004-05-05  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/info-dialog.c
+	* app/tools/gimpcolorbalancetool.c
+	* app/tools/gimpcolorizetool.c
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimphuesaturationtool.c
+	* app/tools/gimpimagemaptool.c
+	* app/tools/gimplevelstool.c: use GimpFrame widgets, changed spacings.
+
+	* app/widgets/gimptexteditor.c: tweaked.
+
+2004-05-05  Jakub Steiner <jimmac@ximian.com>
+
+	* data/images/gimp_splash.png: ustable splash
+
+2004-05-04  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/menus.c: register a <Dock> UI manager which has all
+	action groups <Image> has except "view".
+
+	* app/widgets/gimpimagedock.[ch]: re-enabled the global shortcuts,
+	using UI manager instead of item factory. Unfortunately actions
+	without proxy widgets can't be activated so this change is pretty
+	useless. Oh well, will find a hack to work around this later...
+
+2004-05-04  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpblendoptions.c
+	* app/tools/gimpbucketfilloptions.c
+	* app/tools/gimpcoloroptions.c
+	* app/tools/gimpinkoptions.c
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimpselectionoptions.c
+	* app/tools/gimptooloptions-gui.c
+	* app/tools/gimptransformoptions.c: use GimpFrames where GtkFrame
+	was used. Put "Pressure Sensitivity" frame into a GtkExpander.
+
+2004-05-04  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpframe.c: added a style property to control
+	boldening of the frame title.
+
+	* themes/Default/gtkrc
+	* themes/Small/gtkrc: suppress the bold title for GimpFrames in
+	GimpDockables,
+
+2004-05-04  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): allocate
+	the full width for the label widget, looks better and is more
+	convenient to use with activatable widgets such as toggle buttons.
+
+2004-05-04  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpfiledialog.c: removed debugging output, added
+	#warning about runtime version check that can be removed as soon
+	as we depend on GTK+ 2.4.1.
+
+2004-05-04  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/file-dialog-actions.c (file_dialog_actions_setup):
+	don't forget to set the action's accelerator.
+
+2004-05-04  Sven Neumann  <sven@gimp.org>
+
+	* app/actions/channels-commands.c
+	* app/actions/gradient-editor-commands.c
+	* app/actions/image-commands.c
+	* app/actions/layers-commands.c
+	* app/actions/qmask-commands.c
+	* app/actions/templates-commands.c
+	* app/actions/vectors-commands.c
+	* app/display/gimpdisplayshell-filter-dialog.c
+	* app/gui/convert-dialog.c
+	* app/gui/module-browser.c
+	* app/gui/offset-dialog.c
+	* app/gui/palette-import-dialog.c
+	* app/gui/resize-dialog.c
+	* app/gui/resolution-calibrate-dialog.c
+	* app/gui/tips-dialog.c
+	* app/gui/user-install-dialog.c
+	* app/widgets/gimpwidgets-utils.c
+	* libgimpwidgets/gimpquerybox.c: set dialog border spacing to 12.
+
+2004-05-04  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/preferences-dialog.c
+	* app/widgets/widgets-enums.[ch]
+	* app/widgets/gimpwidgets-utils.c (gimp_window_set_hint): added
+	new window hint "keep-above" to force toolbox and/or dock windows
+	to be kept above (if the WM supports this hint). Fixes bug #131672.
+
+2004-05-04  Michael Natterer  <mitch@gimp.org>
+
+	Fix bug #141719:
+
+	* app/tools/gimpmovetool.c (gimp_move_tool_motion): use RINT()
+	instead of ROUND() to round double coords to guide positions.
+
+	* app/display/gimpdisplayshell-callbacks.c
+	(gimp_display_shell_canvas_tool_events): pass RINT()-rounded
+	coords to gimp_display_shell_update_cursor() instead of implicitly
+	truncating by casting to int.
+
+2004-05-04  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpundoeditor.c: removed code duplication by adding
+	utility function gimp_undo_editor_update_buttons(), some general
+	cleanups.
+
+2004-05-04  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage.c (gimp_image_undo_freeze,thaw): emit the
+	"undo-freeze" and "undo-thaw" signals only on the first freeze and
+	last thaw, not on any of them.
+
+	* app/widgets/gimphelp-ids.h: added GIMP_HELP_EDIT_UNDO_CLEAR.
+
+	* app/widgets/gimpundoeditor.[ch]: added a "Clear Undo History"
+	button. Fixes bug #136300.
+
+	Also don't attach to the image's undo stack if the image's undo is
+	disabled and set the buttons' sensitivity accordingly. Should fix
+	all kinds of unpredictable undo history brokenness.
+
+2004-05-04  Michael Natterer  <mitch@gimp.org>
+
+	Treat FG/BG just like all other context properties:
+
+	* app/paint/gimppaintoptions.h: added GIMP_CONTEXT_FOREGROUND_MASK
+	and _BACKGROUND_MASK to GIMP_PAINT_OPTIONS_CONTEXT_MASK to specify
+	that they are used by GimpPaintOptions (automatically affects all
+	paint tools).
+
+	* app/tools/gimpblendtool.c
+	* app/tools/gimpbucketfilltool.c
+	* app/tools/gimpinktool.c: set FOREGROUND_MASK and BACKGROUND_MASK
+	manually here.
+
+	* app/tools/tool_manager.c (tool_manager_tool_changed): decide
+	about the globality of FG and BG at the same place where we decide
+	about the brush's, pattern's etc. globality, but hardcode them to
+	global = TRUE instead of looking at GimpConfig.
+
+	Fixes bug #141786.
+
+2004-05-04  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/sobel.c (sobel_dialog): removed frame, adjusted
+	spacing, fixes bug #141773.
+
+2004-05-04  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/stroke-dialog.c:
+	* app/widgets/gimpstrokeeditor.c: moved line style options into a
+	GtkExpander. Changed dialog spacings.
+
+2004-05-03  Manish Singh  <yosh@gimp.org>
+
+	* app/actions/qmask-actions.c: initialize is_active for qmask-toggle.
+
+	* app/actions/tools-actions.c: set entry help_id from tool_info,
+	since gimp_action_group_add_string_actions expects it to be there
+	now.
+
+2004-05-03  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpframe.c (gimp_frame_new): added a hack that
+	allows to get the label_spacing but no label. Useful when the frame
+	is packed into a GtkExpander.
+
+	* app/widgets/gimptemplateeditor.c: pack the "Image Comment" frame
+	into a GtkExpander to reduce clutter and dialog size.
+
+2004-05-03  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpwidgets/gimphelpui.[ch]: added gimp_help_id_quark()
+	which is G_GNUC_CONST and a new macro GIMP_HELP_ID as shortcut.
+
+	* app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions):
+	attach the help ID to the action using the new quark key. Call
+	gtk_action_group_add_action() instead of the _with_accel() variant
+	if the accel is the empty string (== if we explicitely want no
+	accel even if the stock item specifies one). Fixes warning flood
+	with GTK+ 2.4.1.
+
+2004-05-03  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpframe.c: if the label_widget is a button, set
+	the button label as bold. Cache the indentation instead of
+	calculating it over and over again.
+
+	* themes/Default/gtkrc: set HIG-compliant spacing for the
+	action_area.
+
+	* app/widgets/gimppropwidgets.[ch]: added
+	gimp_prop_enum_radio_box_new() for a radio group that is no
+	embedded in a frame.
+
+	* app/widgets/gimpstrokeeditor.c: use a frame-less radio box for
+	the Stroke style.
+
+	* app/gui/file-new-dialog.c
+	* app/gui/grid-dialog.c
+	* app/gui/stroke-dialog.c: HIG-compliant spacings.
+
+2004-05-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdock.c (gimp_dock_key_press_event): new function
+	which overrides GtkWindow's default handler in order to give the
+	focus widget precedence over accelerators for keys without any
+	modifier or with <Shift> modifier. Enables e.g. having a <Shift>+s
+	accelerator while still being able to enter 'S' in an entry.
+	Thanks to Tim Janik for the code.
+
+2004-05-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/actions.h. added the various return_if_no_foo()
+	macros here.
+
+	* app/actions/channels-commands.c
+	* app/actions/dialogs-commands.c
+	* app/actions/drawable-commands.c
+	* app/actions/edit-commands.c
+	* app/actions/file-commands.c
+	* app/actions/image-commands.c
+	* app/actions/layers-commands.c
+	* app/actions/qmask-commands.c
+	* app/actions/select-commands.c
+	* app/actions/vectors-commands.c
+	* app/actions/view-commands.c: removed them here. Some cleanup.
+
+2004-05-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/actions.[ch]: added some utility functions to get a
+	Gimp, GimpImage, GimpDisplay and GtkWidget from the "data" pointer
+	passed to action callbacks.
+
+	* app/actions/channels-actions.c
+	* app/actions/channels-commands.c
+	* app/actions/drawable-actions.c
+	* app/actions/drawable-commands.c
+	* app/actions/edit-actions.c
+	* app/actions/edit-commands.c
+	* app/actions/file-actions.c
+	* app/actions/file-commands.c
+	* app/actions/help-commands.c
+	* app/actions/image-actions.c
+	* app/actions/image-commands.c
+	* app/actions/layers-actions.c
+	* app/actions/layers-commands.c
+	* app/actions/plug-in-actions.c
+	* app/actions/plug-in-commands.c
+	* app/actions/qmask-actions.c
+	* app/actions/qmask-commands.c
+	* app/actions/select-actions.c
+	* app/actions/select-commands.c
+	* app/actions/tools-commands.c
+	* app/actions/vectors-actions.c
+	* app/actions/vectors-commands.c
+	* app/actions/view-commands.c: use the new functions instead of
+	duplicating insane macros and if() constructs over and over again.
+
+2004-05-03  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpwidgets.c: use a GimpFrame for
+	gimp_radio_group_new() and friends.
+
+	* themes/Default/gtkrc
+	* themes/Small/gtkrc: set a smaller label_spacing for GimpFrame
+	widgets in GimpDockables. Lame hack to keep the tool options
+	compact.
+
+	* app/actions/image-commands.c: changed spacing.
+
+	* app/gui/offset-dialog.c: merged check and radio buttons into a
+	single radio button group; changed spacing.
+
+2004-05-03  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): respect
+	the frame's border width.
+
+	* app/widgets/gimpcolorframe.[ch]: derive from GimpFrame.
+
+	* app/gui/convert-dialog.c
+	* app/gui/info-window.c
+	* app/gui/palette-import-dialog.c
+	* app/gui/resize-dialog.c: use GimpFrames, changed some spacings.
+
+2004-05-03  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/dockable-commands.c (dockable_add_tab_cmd_callback):
+	truncate the passed dialog identifier at the first '|'. Fixes
+	creating brushes, paterns etc. dialogs from the dockables'
+	"Add Tab" menu.
+
+2004-05-02  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpframe.c (gimp_frame_size_request): take the
+	left margin into account.
+
+	* app/widgets/gimpgrideditor.c
+	* app/widgets/gimptemplateeditor.c: removed container borders that
+	aren't needed any longer.
+
+2004-05-02  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpenumwidgets.c
+	* app/widgets/gimpgrideditor.c
+	* app/widgets/gimptemplateeditor.c: use the GimpFrame widget,
+	changed some spacings to better comply with the HIG.
+
+2004-05-02  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgets.h
+	* libgimpwidgets/gimpwidgetstypes.h
+	* libgimpwidgets/gimpframe.[ch]: added new widget GimpFrame, a HIG
+	compliant variant of GtkFrame.
+
+	* app/gui/preferences-dialog.c: enable the HIG compliant mode by
+	default and use the new GimpFrame widget for it.
+
+	* themes/Small/gtkrc: set a smaller spacing between the GimpFrame
+	title label and the frame content.
+
+2004-05-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/qmask-actions.c: renamed action "qmask-toggle" to
+	"qmask-active" and added new action "qmask-toggle" with a label
+	and shortcut suited for the "Select" menu.
+
+	* app/actions/select-actions.c: removed "select-toggle-qmask".
+
+	* app/actions/select-commands.[ch]: removed callback
+	select_toggle_quickmask_cmd_callback().
+
+	* app/actions/channels-actions.c (channels_actions_update)
+	* app/actions/vectors-actions.c (vectors_actions_update): handle
+	"data" being both GimpDisplay and GimpDisplayShell so the actions
+	can be used in the image menu.
+
+	* menus/image-menu.xml.in: s/select-toggle-qmask/qmask-toggle/.
+
+	* menus/qmask-menu.xml: s/qmask-toggle/qmask-active/.
+
+2004-05-02  Sven Neumann  <sven@gimp.org>
+
+	* menus/image-menu.xml.in
+	* menus/tool-options-menu.xml
+	* menus/toolbox-menu.xml.in: use empty elements for empty menus.
+	Makes the XML somewhat easier to read.
+
+2004-05-02  Sven Neumann  <sven@gimp.org>
+
+	* menus/Makefile.am
+	* menus/dialogs-menuitems.xml: new file that holds menuitems that
+	appear in several places.
+
+	* menus/dockable-menu.xml.in: new file used to generate
+	dockable-menu.xml.
+
+	* menus/toolbox-menu.xml.in: new file used to generate
+	toolbox-menu.xml.
+
+	* menus/image-menu.xml.in: include dialogs-menuitems.xml.
+
+	* menus/menus.xsl: allow inclusion of menuitems using XInclude.
+
+2004-05-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/Makefile.am
+	* app/actions/file-dialog-actions.[ch]: new files containing
+	factored out code to set up the <Load> and <Save> actions.
+	Use GimpPlugInActions instead of just GtkActions.
+
+	* app/actions/file-dialog-commands.[ch]: new files containing
+	file_dialog_type_cmd_callback() which is a
+	GimpPlugInAction::selected() callback now.
+
+	* app/actions/file-commands.[ch]: removed the callback here.
+
+	* app/actions/file-open-actions.c
+	* app/actions/file-save-actions.c: removed code duplication and
+	use file_dialog_actions_setup() instead.
+
+2004-05-02  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/*-actions.c: added help IDs to all actions
+	representing the toplevel popups and menus (as fallbacks for the
+	still-to-be-written help system intrgration of GimpUIManager).
+
+	* app/display/gimpdisplayshell.c (gimp_display_shell_new): removed
+	call to gtk_ui_manager_ensure_update() because that's done by
+	gimp_ui_manager_ui_get() now.
+
+	* app/widgets/gimpmenufactory.[ch]: removed API to register and
+	create item factories.
+
+	* app/gui/menus.c: changed accordingly.
+
+	* app/gui/dialogs.c
+	* app/actions/plug-in-commands.c
+	* app/gui/file-dialog-utils.c
+	* app/gui/file-save-dialog.c
+	* app/widgets/gimpdataeditor.c
+	* app/widgets/gimpdockable.c
+	* app/widgets/gimpdockbook.[ch]
+	* app/widgets/gimpimagedock.c
+	* app/widgets/gimpitemtreeview.c: removed leftover item factory
+	cruft.
+
+	* app/widgets/widgets-types.h: removed item factory typedefs...
+
+	* app/widgets/gimpitemfactory.h: ...and added them here.
+
+	* app/widgets/gimpactiongroup.[ch]: added new function
+	gimp_action_group_add_plug_in_actions().
+
+	* app/actions/plug-in-actions.c: use it here instead of adding
+	the actions manually.
+
+	* app/widgets/gimptoolbox.c: ported the code which dynamically
+	updates the tool button tooltips on accelerator changes to
+	GtkAction. Disabled the whole stuff because GTK+ lacks
+	gtk_action_get_accel_closure().
+
+2004-05-02  Sven Neumann  <sven@gimp.org>
+
+	* menus/Makefile.am: added a rule to generate gtkuimanager XML
+	files using an XSL transformation.
+
+	* menus/menus.xsl: a simple XSLT to generate a menubar and a popup
+	menu with identical content.
+
+	* menus/image-menu.xml: removed this file from CVS ...
+
+	* menus/image-menu.xml.in: ... and added this instead.
+
+	* HACKING: xsltproc is now needed to build from CVS.
+
+2004-05-01  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: check for xmllint and xsltproc but don't require
+	these tools.
+
+	* menus/Makefile.am
+	* tips/Makefile.am: simplified "validate" targets.
+
+2004-04-30  Pedro Gimeno  <pggimeno@wanadoo.es>
+
+	* app/tools/gimprectselecttool.c: Cleanups.
+	(gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for
+	bug #138103, which led to bug #140649.
+
+	* app/pdb/procedural_db.c (procedural_db_init_procs): Add missing
+	compat procs: gimp_channel_ops_duplicate, gimp_channel_ops_offset.
+
+2004-04-30  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/tool-options-menu.c: added casts to please the compiler.
+
+2004-04-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpuimanager.[ch]: added signal "update" which
+	is G_SIGNAL_RUN_LAST, so handlers can hook in before and after
+	the default implementation. Update the action groups
+	in the default implementations.
+
+	(gimp_ui_manager_ui_get): make sure we always return a widget
+	by calling gtk_ui_manager_ensure_update().
+
+	* app/widgets/gimpdockable.c (gimp_dockable_show_menu): make
+	sure the dockable menu is loaded before trying to access its
+	widgets/actions.
+
+	Resurrected the dynamic tool options menus:
+
+	* app/actions/tool-options-actions.c: dynamically destroy/create
+	actions for the tool options' presets.
+
+	* app/actions/tool-options-commands.[ch]: all callbacks are
+	GimpEnumAction::selected() callbacks now.
+
+	* app/gui/tool-options-menu.[ch]: connect and connect_after to
+	GimpUIManager::update(). Remove the old preset menu items
+	in the former callback, create the new ones in the latter.
+	Removed the last item factory entries.
+
+	* app/gui/menus.c
+	* app/widgets/gimptooloptionseditor.c: changed accordingly.
+
+2004-04-29  Simon Budig  <simon@gimp.org>
+
+	* app/main.c: when glibc is used, call mallopt, so that memory
+	chunks >= 4k (= 64*64 pixels, 1bpp - the smallest full tile)
+	get allocated via mmap. This ensures that after closing an image
+	the memory allocated for image data gets returned to the system.
+
+	Thanks to Phil Blundell <pb@nexus.co.uk> for bringing mallopt
+	to my attention.
+
+	Please watch closely for performance problems.
+
+2004-04-29  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/Makefile.am
+	* app/actions/file-open-actions.[ch]
+	* app/actions/file-save-actions.[ch]: actions for the <Load> and
+	<Save> menus...
+
+	* menus/Makefile.am
+	* menus/file-open-menu.xml
+	* menus/file-save-menu.xml: ...and the menus.
+
+	* app/gui/file-open-menu.[ch]
+	* app/gui/file-save-menu.[ch]: ported to UI Manager.
+
+	* app/widgets/gimpfiledialog.[ch]: ditto.
+
+	* app/actions/actions.c
+	* app/gui/menus.c
+	* app/gui/file-open-dialog.c
+	* app/gui/file-save-dialog.c: changed accordingly.
+
+	* app/widgets/gimpuimanager.c: removed debugging code which
+	automatically loaded all registered menus. They are now loaded on
+	demand only.
+
+2004-04-29  Michael Natterer  <mitch@gimp.org>
+
+	* libgimpbase/gimputils.[ch] (gimp_escape_uline): new function
+	which does the opposite of gimp_strip_uline().
+
+	* app/actions/file-actions.c (file_actions_last_opened_update):
+	escape ulines in filenames so they don't end up as mnemonics.
+	Spotted by Pedro Gimeno.
+
+2004-04-29  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/plug-ins/py-slice.py: Quick fix to make uppercase
+	tags work properly.
+
+2004-04-29  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimp*tool.c (gimp_*_tool_register): stripped the menu
+	paths from the "menu_path". Will be renamed to "action_name" or
+	something soon...
+
+	* plug-ins/dbbrowser/dbbrowser.c
+	* plug-ins/common/plugindetails.c
+	* plug-ins/common/uniteditor.c: register under the new
+	"Extensions" placeholder.
+
+2004-04-29  Michael Natterer  <mitch@gimp.org>
+
+	Switch from GtkItemFactory to GtkUIManager. The migration is
+	almost complete, still stuff missing/incomplete, definitely added
+	a bunch of new bugs...
+
+	* app/actions/*-commands.[ch]: converted all callback from
+	GtkItemFactory callbacks to GtkAction callbacks.
+
+	* app/actions/debug-actions.c
+	* app/actions/gradient-editor-actions.c
+	* app/actions/help-actions.c
+	* app/actions/plug-in-actions.c
+	* app/actions/qmask-actions.c
+	* app/actions/tool-options-actions.c: various fixes.
+
+	* app/display/gimpdisplay.[ch]
+	* app/display/gimpdisplayshell-appearance.[ch]
+	* app/display/gimpdisplayshell-callbacks.c
+	* app/display/gimpdisplayshell.[ch]: move everything from
+	GtkItemFactory to GtkUIManager.
+
+	* app/gui/dialogs.[ch]: added new function dialogs_get_toolbox().
+	Needed because the action callbacks don't have a widget parameter
+	and sometimes we need a parent window for showing dialogs.
+
+	* app/gui/Makefile.am
+	* app/gui/brushes-menu.[ch]
+	* app/gui/buffers-menu.[ch]
+	* app/gui/channels-menu.[ch]
+	* app/gui/colormap-editor-menu.[ch]
+	* app/gui/dialogs-menu.[ch]
+	* app/gui/documents-menu.[ch]
+	* app/gui/error-console-menu.[ch]
+	* app/gui/fonts-menu.[ch]
+	* app/gui/gradient-editor-menu.[ch]
+	* app/gui/gradients-menu.[ch]
+	* app/gui/images-menu.[ch]
+	* app/gui/layers-menu.[ch]
+	* app/gui/palette-editor-menu.[ch]
+	* app/gui/palettes-menu.[ch]
+	* app/gui/patterns-menu.[ch]
+	* app/gui/qmask-menu.[ch]
+	* app/gui/templates-menu.[ch]
+	* app/gui/vectors-menu.[ch]: removed these files.
+
+	* app/gui/gui.c: create a global UI manager for the image popup
+	menu and the toolbox menubar.
+
+	* app/gui/menus.[ch]: removed all GtkItemFactory code.
+
+	* app/gui/image-menu.[ch]
+	* app/gui/toolbox-menu.[ch]: removed everything except the trivial
+	setup_funcs.
+
+	* app/gui/file-open-menu.c
+	* app/gui/file-save-menu.c
+	* app/gui/tool-options-menu.c: don't use the macros from menus.h
+	any more, they are gone.
+
+	* app/gui/gui-vtable.c
+	* app/gui/plug-in-menus.[ch]: create/destroy the dynamic plug-in
+	menu entries.
+
+	* app/tools/gimpimagemaptool.c: s/gimp_item_factory_update/
+	gimp_ui_manager_update/g
+
+	* app/widgets/gimpuimanager.[ch]: added API to get an action
+	group by name.
+
+	* app/widgets/gimpmenufactory.c: don't choke on the item_factory
+	entries being NULL.
+
+	* app/widgets/gimpactiongroup.c: make sure booleans set using
+	g_object_set() only have TRUE or FALSE values.
+
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimpcomponenteditor.c
+	* app/widgets/gimpcontainereditor.[ch]
+	* app/widgets/gimpcontainergridview.c
+	* app/widgets/gimpcontainertreeview.c
+	* app/widgets/gimpdockable.[ch]
+	* app/widgets/gimpdocked.[ch]
+	* app/widgets/gimpeditor.[ch]
+	* app/widgets/gimperrorconsole.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimppaletteeditor.c
+	* app/widgets/gimptoolbox.c
+	* app/widgets/gimptooloptionseditor.c: removed all GtkItemFactory
+	code and enable the #if 0'ed UI manager stuff.
+
+	* menus/gradient-editor-menu.xml: fixed typos.
+
+	* menus/image-menu.xml: duplicate everything so we have both
+	an image menubar and an image popup menu. Badly cries for an
+	XSL processor.
+
+	* menus/toolbox-menu.xml: added an "Extensions" placeholder.
+
+2004-04-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimppluginaction.[ch]: new GtkAction subclass which
+	remembers the PlugInProcDef.
+
+	* app/widgets/gimpactiongroup.[ch]: added "gpointer user_data" to
+	the GimpActionGroup struct and to gimp_action_group_new(). Removed
+	the user_data parameter from gimp_action_group_add_*_actions().
+
+	* app/widgets/gimpactionfactory.[ch]: changed accordingly.
+
+	* app/actions/*-actions.[ch]: removed user_data from all setup_funcs.
+
+	* app/actions/plug-in-actions.c: use a GimpPlugInAction and
+	finally use the right user_data for the callback so plug-in
+	callbacks have a proper context.
+
+	* app/gui/plug-in-menus.[ch]: renamed plug_in_menus_create2() to
+	plug_in_menus_setup().
+
+	* app/gui/image-menu.c
+	* app/gui/toolbox-menu.c: changed accordingly.
+
+2004-04-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpactiongroup.[ch]: removed "translation-domain"
+	property and simply use gettext(). Plug-In domains are handled
+	by plug-in-actions.c
+
+	The following change finally starts breaking the old menu system
+	while the new one is not fully in place yet. Have fun:
+
+	* menus/image-menu.xml: added several <placeholder>s for plug-ins
+	to register their menu entries in the middle of already existing
+	menus.
+
+	* app/gui/menus.c
+	* plug-ins/common/mail.c
+	* plug-ins/print/print.c
+	* plug-ins/script-fu/scripts/copy-visible.scm: use the new
+	placeholders to register menu entries.
+
+2004-04-27  Michael Natterer  <mitch@gimp.org>
+
+	Correctly translated & sorted plug-in actions & menu entries:
+
+	* app/widgets/gimpuimanager.[ch]: added a "gchar *name" property
+	and a hash table which keeps all created UI managers (similar to
+	GimpActionGroup's hash table). Added function
+	gimp_ui_managers_from_name() which returns a list of all managers
+	with the given name.
+
+	* app/widgets/gimpmenufactory.c: register a name per UI manager
+	and pass the name to gimp_ui_manager_new().
+
+	* app/actions/plug-in-actions.c: added code which correctly
+	translates the created plug-in actions and also creates translated
+	menu actions for the plug-in's menu_path elements.
+
+	* app/gui/plug-in-menus.[ch]: sort the plug-ins' menu entries
+	using a GTree. For each entry, recursivlely create submenus
+	from the dynamic menu actions created above before creating
+	the plug-in's menu entry itself.
+
+	* app/gui/image-menu.c (image_menu_setup2)
+	* app/gui/toolbox-menu.c (toolbox_menu_setup2): call
+	plug_in_menus_create2().
+
+	* app/gui/gui-vtable.c (gui_menus_create_entry)
+	(gui_menus_delete_entry): added some uglyness which maps old <Prefix>
+	menu identifiers to new-style UI manager plus ui_path tuples and
+	call plug_in_menus_add,remove_proc() accordingly.
+
+	* menus/image-menu.xml
+	* menus/toolbox-menu.xml: added name="Foo" attributes to all menus
+	so plug-in entries find their place.
+
+2004-04-27  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/gui.c (gui_restore_callback): call actions_init()
+	(gui_exit_after_callback): call actions_exit().
+
+	* app/gui/menus.c (menus_init)
+	(menu_exit): don't call them here.
+
+2004-04-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/widgets-types.h: added GimpUIManagerSetupFunc typedef.
+
+	* app/widgets/gimpuimanager.[ch]: added the setup_func to the
+	GimpUIManagerUIEntry struct and to gimp_ui_manager_ui_register().
+	Call the setup_func after creating the UI. Replaced the term
+	"identifier" by "ui_path".
+
+	* app/widgets/gimpmenufactory.c: ditto.
+
+	* app/gui/menus.c (menus_init): register the new setup_funcs below.
+
+	* app/gui/menus.[ch] (menus_open_recent_add)
+	* app/gui/image-menu.[ch] (image_menu_setup2)
+	* app/gui/toolbox-menu.[ch] (toolbox_menu_setup2): new setup_funcs
+	which add the "Open Recent" menu items.
+
+	* app/actions/file-actions.c: removed "file-open-recent-empty"
+	action because it's not needed.
+
+	* menus/image-menu.xml
+	* menus/toolbox-menu.xml: removed "file-open-recent-empty" menu
+	items and added <placeholder>s for the "Open Recent" menu items.
+
+2004-04-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp.[ch]: removed "locale_domain" and "help_domain"
+	parameters from GimpMenusCreateFunc.
+
+	* app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add)
+	* app/actions/plug-in-actions.[ch] (plug_in_actions_add_proc_def):
+	changed accordingly.
+
+	* app/widgets/gimpactiongroup.[ch]: remember all created action
+	groups is a hash table in GimpActionGroupClass.  Added
+	gimp_action_groups_from_name() which returns a GList of all groups
+	with the given name.
+
+	* app/actions/plug-in-actions.[ch] (plug_in_actions_setup):
+	removed the tree sorting code. Actions don't need to be ordered
+	alphabetically.
+
+	(plug_in_actions_update): copied & ported plug_in_menus_update().
+
+	* app/gui/gui-vtable.c (gui_menus_create,delete_entry):
+	dynamically add/remove plug-in actions in all "plug-in" action
+	groups.
+
+2004-04-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp.[ch]: changed GimpMenusDeleteFunc to take
+	a PlugInProcDef* instead of a const gchar*.
+
+	* app/plug-in/plug-ins.c
+	* app/gui/gui-vtable.c
+	* app/gui/plug-in-menus.[ch]: changed accordingly.
+
+2004-04-25  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/AlienMap2.c: some UI improvements based on a
+	patch by William Skaggs (bug #140079).
+
+2004-04-22  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/dialogs-constructors.c
+	* app/gui/preferences-dialog.c: silent the compiler.
+
+	* plug-ins/winicon/icodialog.c: simplified by using a
+	GimpIntComboBox.
+
+2004-04-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpuimanager.[ch]: remember and ref the created
+	widgets.  Added gimp_ui_manager_ui_popup() which pops up a GtkMenu
+	with a custom GimpMenuPositionFunc and a GtkDestroyNotify which is
+	called on popdown.
+
+	* app/widgets/gimpmenufactory.c (gimp_menu_factory_finalize):
+	don't forget to free the list of managed UIs.
+
+	* app/widgets/gimpdockable.[ch]
+	* app/widgets/gimpdockbook.[ch]
+	* app/widgets/gimpdocked.[ch]
+	* app/widgets/gimpeditor.[ch]: added GimpUIManager stuff parallel
+	to the to-be-removed GtkItemFactory stuff.
+
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimpcomponenteditor.c
+	* app/widgets/gimpcontainereditor.c
+	* app/widgets/gimpcontainergridview.c
+	* app/widgets/gimpcontainertreeview.c
+	* app/widgets/gimperrorconsole.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimpitemtreeview.c
+	* app/widgets/gimppaletteeditor.c
+	* app/widgets/gimptooloptionseditor.c: changed accordingly and added
+	#if 0'ed code which actually uses all the UI managers.
+
+	* app/display/gimpdisplay.c
+	* app/display/gimpdisplayshell.c
+	* app/gui/gui-vtable.c: disabled some gimp_ui_manager_update()
+	calls because they were invoking toggle and radio callbacks
+	which still have the wrong signature.
+
+2004-04-22  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gflare/gflare.c: ported the last plug-in from
+	GtkOptionMenu to GimpIntComboBox.
+
+	* plug-ins/common/newsprint.c: changed a comment that was still
+	talking about option menus.
+
+2004-04-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/menus.c (menus_init): fixed some typos in the UI Manager
+	registration code.
+
+2004-04-22  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpactiongroup.[ch]: implemented
+	gimp_action_group_set_action_color() and
+	gimp_action_group_set_action_viewable().
+
+	* app/actions/*-actions.c: added stock IDs to all actions which
+	represent toplevel popup menus. Fixed typos.
+
+	* menus/brushes-menu.xml
+	* menus/colormap-editor-menu.xml
+	* menus/dockable-menu.xml
+	* menus/gradients-menu.xml
+	* menus/patterns-menu.xml
+	* menus/toolbox-menu.xml: fixed typos.
+
+2004-04-22  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/rcm/rcm_callback.[ch]
+	* plug-ins/rcm/rcm_dialog.c: ported from GtkOptionMenu to
+	GimpIntComboBox.
+
+2004-04-22  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpintstore.[ch]: automatically add an "(Empty)"
+	item if the store is empty and remove it as soon as other items
+	are being added.
+
+	* libgimp/gimpdrawablecombobox.c
+	* libgimp/gimpimagecombobox.c: removed handling of the empty list;
+	the store does this for us now.
+
+2004-04-22  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpintcombobox.c (gimp_int_combo_box_new):
+	removed the check for first_label != NULL. Passing a NULL label
+	makes a perfect empty combo_box.
+
+	* plug-ins/common/newsprint.c
+	* plug-ins/common/spheredesigner.c: ported from GtkOptioMenu to
+	GimpIntComboBox.
+
+2004-04-22  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/flame/flame.c
+	* plug-ins/gimpressionist/brush.c: ported the last two users of
+	gimpmenu.h to GimpDrawableComboBox.
+
+	* libgimp/gimpmenu.[ch]: declared the functions found here as
+	deprecated.
+
+	* plug-ins/common/plugindetails.c
+	* plug-ins/ifscompose/ifscompose.c: silent the compiler.
+
+2004-04-21  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablecombobox.c
+	* libgimp/gimpimagecombobox.c
+	* libgimp/gimpmenu.c: changed the label for the empty menu from
+	"None" to "Empty" since that's what GTK+ uses.
+
+	* libgimpwidgets/gimpintcombobox.[ch]: added convenience function
+	gimp_int_combo_box_connect().
+
+	* plug-ins/common/bumpmap.c
+	* plug-ins/common/compose.c
+	* plug-ins/common/depthmerge.c
+	* plug-ins/common/displace.c
+	* plug-ins/common/lic.c
+	* plug-ins/common/warp.c: ported to GimpDrawableComboBox.
+
+	* plug-ins/Lighting/lighting_ui.c
+	* plug-ins/MapObject/mapobject_ui.c
+	* plug-ins/common/sample_colorize.c: use
+	gimp_int_combo_box_connect(). This restores the correct behaviour
+	of setting the drawable_ID to the first drawable from the list if
+	it's invalid.
+
+2004-04-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpuimanager.[ch]: new GtkUIManager subclass. Adds
+	API to update all action groups and knows which UIs it can create
+	from which XML files.
+
+	* app/widgets/gimpmenufactory.[ch]: register the XML file
+	basenames along with path of their toplevel menus. Create
+	GimpUIManagers instead of GtkUIManagers and register the
+	XML files and menu paths with them.
+
+	* app/gui/menus.c: register all XML files and their toplevel
+	menu paths.
+
+	* app/widgets/gimpeditor.[ch]: also create a GimpUIManager when
+	creating the GtkItemFactory. Added "const gchar *ui_identifier"
+	parameter to gimp_editor_create_menu().
+
+	* app/widgets/gimpcontainereditor.[ch]
+	* app/widgets/gimpdataeditor.[ch]
+	* app/widgets/gimpdatafactoryview.[ch]
+	* app/widgets/gimpitemtreeview.[ch]: added "ui_identifier"
+	parameters to all constructors.
+
+	* app/widgets/gimpbrusheditor.c
+	* app/widgets/gimpbrushfactoryview.c
+	* app/widgets/gimpbufferview.c
+	* app/widgets/gimpcolormapeditor.c
+	* app/widgets/gimpcomponenteditor.c
+	* app/widgets/gimpcontainerpopup.c
+	* app/widgets/gimpdocumentview.c
+	* app/widgets/gimperrorconsole.c
+	* app/widgets/gimpfontview.c
+	* app/widgets/gimpgradienteditor.c
+	* app/widgets/gimpimageview.c
+	* app/widgets/gimppaletteeditor.c
+	* app/widgets/gimppatternfactoryview.c
+	* app/widgets/gimptemplateview.c
+	* app/widgets/gimptooloptionseditor.c
+	* app/gui/dialogs-constructors.c
+	* app/gui/gradient-select.c
+	* app/gui/palette-select.c
+	* app/gui/pattern-select.c: pass UI identifiers to the changed
+	functions above.
+
+	* app/display/gimpdisplayshell.[ch]: added a GimpUIManager for
+	the menubar (menubar creating code still commented out).
+
+	* app/display/gimpdisplay.c
+	* app/gui/gui-vtable.c: update the ui manager.
+
+2004-04-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/actions.c: forgot to register the "patterns" actions.
+
+	* app/actions/*-actions.c: added actions representing the toplevel
+	menus (popups and menubars). Fixed some typos.
+
+	* menus/*-menu.xml: added action="foo" attributes to all toplevel
+	menus. Fixed typos here too.
+
+	* menus/gtkuimanager.dtd: fixed possible attributes.
+
+2004-04-21  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpmenu.c (gimp_menu_add_none): use the same label as
+	in the new combo_box widgets.
+
+	* libgimpwidgets/gimpintcombobox.[ch]
+	* libgimpwidgets/gimpintstore.[ch]: use LibGIMP copyright headers.
+
+2004-04-21  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/gimpdrawablecombobox.c
+	* libgimp/gimpimagecombobox.c
+	* libgimp/gimppixbuf.c
+	* libgimpwidgets/gimpintcombobox.c
+	* libgimpwidgets/gimpintstore.c: API documentation.
+
+2004-04-21  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpintcombobox.[ch]: added new functions
+	gimp_int_combo_box_[prepend|append].
+
+	* plug-ins/common/sample_colorize.c: ported to GimpDrawableComboBox.
+
+2004-04-21  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/qmask-actions.c
+	* app/actions/qmask-commands.c: prepared qmask_actions_update()
+	and the qmask callbacks to be merged into the image ui manager.
+
+	* app/actions/dialogs-actions.c
+	* app/actions/edit-actions.c
+	* app/actions/file-actions.c
+	* app/actions/image-actions.c
+	* app/actions/layers-actions.c
+	* app/actions/plug-in-actions.c
+	* app/actions/tools-actions.c
+	* app/actions/view-actions.c: fixed lots of typos and buglets
+	spotted in my first test run.
+
+	* app/gui/menus.c: register the needed action groups with the
+	<Image> menu.
+
+	* app/tools/gimp-tools.c
+	* app/tools/gimpdodgeburntool.[ch]
+	* app/tools/gimppaintoptions-gui.c: s/dodgeburn/dodge_burn/g.
+
+	* app/widgets/gimpactionfactory.c
+	* app/widgets/gimpmenufactory.[ch]: s/G_GNUC_FUNCTION/G_STRFUNC/g,
+	updated copyright header.
+
+	* menus/image-menu.xml: fixed typos and added the "Filters"
+	submenus.
+
+2004-04-21  Michael Natterer  <mitch@gimp.org>
+
+	More unused action stuff:
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpactionfactory.[ch]: added a simple factory which
+	produces GimpActionGroups.
+
+	* app/widgets/gimpactiongroup.[ch]: added an "update_func" member
+	to the GimpActionGroup struct. Added it as parameter to
+	gimp_action_group_new(). Added function gimp_action_group_update().
+
+	* app/widgets/gimpmenufactory.[ch]: added an "action_factory"
+	member and constructor parameter. Added code to create
+	GtkUIManagers from registered action group identifiers.
+
+	* app/actions/Makefile.am
+	* app/actions/actions.[ch]: new files: create a
+	"global_action_factory" and register all action groups with it.
+
+	* app/actions/edit-actions.c: s/edit_action_update/edit_actions_update/
+
+	* app/actions/plug-in-actions.[ch]: added API to add/remove
+	plug-in procedure actions dynamically (unfinished).
+
+	* app/gui/menus.c (menus_init): call actions_init().
+	(menus_exit): call actions_exit().
+
+2004-04-21  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/Lighting/lighting_ui.c
+	* plug-ins/MapObject/mapobject_ui.c: ported to the new API.
+
+2004-04-21  Sven Neumann  <sven@gimp.org>
+
+	* libgimp/Makefile.am
+	* libgimp/gimpui.h
+	* libgimp/gimppixbuf.[ch]: new file that holds pixbuf accessors
+	to gimp data (drawable and image thumbnails for now).
+
+	* libgimp/gimpdrawablecombobox.[ch]
+	* libgimp/gimpimagecombobox.[ch]: new files with GimpIntComboBox
+	constructors for image, drawable, channel and layer menus.
+
+	* plug-ins/script-fu/script-fu-scripts.c: use the new functions
+	instead of the gimpmenu API that is about to be deprecated.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail): removed
+	color cast. Merged from stable branch.
+
+	* app/pdb/fileops_cmds.c: regenerated.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgets.h
+	* libgimpwidgets/gimpwidgetstypes.h
+	* libgimpwidgets/gimpintstore.[ch]: added a GimpIntStore, derived
+	from GtkListStore, to be used by GimpIntComboBox and also by the
+	image and drawable menus.
+
+	* libgimpwidgets/gimpintcombobox.c: use the new GimpIntStore.
+
+	* app/widgets/gimpenumstore.[ch]: derive from GimpIntStore,
+	removed API that is provided by the parent class.
+
+	* app/widgets/gimpenumcombobox.[ch]: derive from GimpIntComboBox,
+	removed API that is provided by the parent class.
+
+	* app/gui/resize-dialog.c
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimplevelstool.c
+	* app/widgets/gimpcolorframe.c
+	* app/widgets/gimphistogrameditor.c
+	* app/widgets/gimppropwidgets.c
+	* app/widgets/gimpstrokeeditor.c: changed accordingly.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpenumstore.[ch]
+	* app/widgets/gimpenumcombobox.c: let the pixbuf renderer take care
+	of rendering the pixbuf from the stock_id.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/gimpmemsizeentry.c
+	* modules/cdisplay_colorblind.c
+	* modules/cdisplay_proof.c: ported to GimpIntComboBox.
+
+	* libgimpwidgets/gimpwidgets.[ch]: declared the gimp option_menu
+	API as deprecated and removed the code here.
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpoldwidgets.[ch]: new files with deprecated
+	code, guarded with #ifndef GIMP_DISABLE_DEPRECATED ... #endif.
+
+	* libgimpwidgets/gimpintcombobox.h: added G_BEGIN_DECLS, G_END_DECLS.
+
+	* configure.in (CPP_FLAGS): added -DGIMP_DISABLE_DEPRECATED.
+
+	* app/widgets/gimpwidgets-constructors.c: added a #warning and
+	#undef GIMP_DISABLE_DEPRECATED. The paint mode menu is the last
+	remaining user of gimp_int_option_menu_new().
+
+2004-04-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/convert-dialog.[ch]: renamed convert_to_indexed()
+	to convert_dialog_new() and return the dialog. Removed
+	convert_to_rgb() and convert_to_grayscale().
+
+	* app/gui/offset-dialog.[ch]: renamed offset_dialog_create()
+	to offset_dialog_new() and return the dialog.
+
+	* app/Makefile.am
+	* app/actions/drawable-commands.c
+	* app/actions/image-commands.c: changed accordingly.
+
+2004-04-20  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/*-commands.[ch]: removed...
+
+	* app/actions/*-commands.[ch]: ...and added here.
+
+	* app/gui/Makefile.am
+	* app/gui/*-menu.c
+	* app/gui/dialogs-constructors.c
+	* app/gui/gui.c
+	* app/gui/menus.c
+	* app/actions/Makefile.am
+	* app/actions/*-actions.c: changed accordingly.
+
+	* app/actions/plug-in-actions.[ch]
+	* app/actions/tools-actions.[ch]: new files.
+
+	* app/Makefile.am: had to add more -u evilness because gui/
+	and actions/ have cyclic dependencies.
+
+	* menus/image-menu.xml: added some more items.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpwidgets-constructors.[ch]: added new function
+	gimp_paint_mode_menu_set_history().
+
+	* app/gui/brush-select.c
+	* app/widgets/gimplayertreeview.c
+	* app/widgets/gimppropwidgets.c: use the new function instead of
+	the deprecated gimp_int_option_menu API.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/align_layers.c
+	* plug-ins/common/borderaverage.c
+	* plug-ins/common/channel_mixer.c
+	* plug-ins/common/gif.c
+	* plug-ins/common/mng.c
+	* plug-ins/flame/flame.c
+	* plug-ins/gfig/gfig.c: ported remaining plug-ins to GimpIntComboBox.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/iwarp.c (iwarp_get_pixel): check tile != NULL
+	before unrefing it. Fixes bug #140554; merged from stable branch.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpenumcombobox.c: added more sanity checks.
+
+	* libgimpwidgets/gimpintcombobox.[ch]: added another GimpIntComboBox
+	constructor: gimp_int_combo_box_new_array().
+
+	* plug-ins/Lighting/lighting_ui.c
+	* plug-ins/MapObject/mapobject_ui.c
+	* plug-ins/common/CML_explorer.c: ported to GimpIntComboBox.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* libgimpwidgets/Makefile.am
+	* libgimpwidgets/gimpwidgets.h
+	* libgimpwidgets/gimpwidgetstypes.h
+	* libgimpwidgets/gimpintcombobox.[ch]: added new widget
+	GimpIntComboBox, a GtkComboBox with a simple list store to hold a
+	label and an associated integer value. This is going to replace
+	gimp_int_option_menu.
+
+	* plug-ins/common/jpeg.c
+	* plug-ins/print/gimp_main_window.c: ported these two plug-ins to
+	the newly added widget.
+
+2004-04-20  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/gfig/gfig.c: removed unused return locations for menu
+	item pointers.
+
+2004-04-19  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: set gimp_plugin_version, gimp_sysconf_version and
+	gimp_data_version to 2.1 so that the development version is
+	clearly separated from stable gimp 2.0.
+
+2004-04-19  Michael Natterer  <mitch@gimp.org>
+
+	* menus/Makefile.am
+	* menus/image-menu.xml
+	* menus/tool-options-menu.xml: more menus.
+
+2004-04-19  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpactiongroup.c
+	* app/widgets/gimpenumcombobox.c
+	* app/widgets/gimpenumstore.c: fixed inline docs.
+
+	* app/widgets/gimpenumaction.c: fixed property declaration.
+
+2004-04-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/gui/colormap-editor-commands.[ch]
+	* app/gui/debug-commands.[ch]
+	* app/gui/dockable-commands.[ch]
+	* app/gui/error-console-commands.[ch]
+	* app/gui/file-commands.[ch]
+	* app/gui/gradient-editor-commands.[ch]
+	* app/gui/help-commands.[ch]
+	* app/gui/qmask-commands.[ch]
+	* app/gui/tool-options-commands.[ch]: removed "guint action"
+	parameter from all callbacks which don't need it.
+
+2004-04-19  Sven Neumann  <sven@gimp.org>
+
+	* menus/Makefile.am
+	* menus/gtkuimanager.dtd: added a DTD (basically copied from the
+	GTK+ API docs). Added a "validate" rule that allows to easily
+	validate the XML files.
+
+	* menus/*.xml: added a DOCTYPE declaration that refers to the
+	newly added DTD.
+
+	* app/widgets/gimpenumstore.[ch]:
+	* app/widgets/gimpenumcombobox.c: documented the new API.
+
+2004-04-19  Michael Natterer  <mitch@gimp.org>
+
+	* app/actions/Makefile.am
+	* app/actions/actions-types.h: oops, forgot to commit this one.
+
+2004-04-19  Michael Natterer  <mitch@gimp.org>
+
+	* menus/Makefile.am
+	* menus/toolbox-menu.xml: added the toolbox menu.
+
+2004-04-19  Michael Natterer  <mitch@gimp.org>
+
+	More GtkAction stuff (still unused):
+
+	* configure.in: added new directories menus/ and app/actions/
+
+	* Makefile.am: build menus/
+
+	* menus/.cvsignore
+	* menus/Makefile.am
+	* menus/*-menu.xml: new files: XML menu descriptions for each menu
+	which is now defined in gui/*-menu.c.
+
+	* app/widgets/widgets-types.h: some typedefs for GimpActionGroup.
+
+	* app/widgets/gimpactiongroup.[ch]: added a "Gimp" construct-only
+	property. Added APIs to set actions visible/sensitive/active
+	and an unimplemented stub for setting the action's color.
+
+	* app/Makefile.am: build actions/ and link libappactions.a
+
+	* app/actions/.cvsignore
+	* app/actions/Makefile.am
+	* app/actions/*-actions.[ch]: new files: GtkActions for each
+	*-commands.c file in gui/. Ported all "update" functions from the
+	*-menu.c files.
+	(everything completely unused, untested and partly #if 0'ed)
+
+	* app/core/gimpimage.[ch]: for reasons of (action-) symmetry, added
+	API to raise/lower channels/vectors to top/bottom.
+
+	* app/gui/channels-commands.[ch]
+	* app/gui/vectors-commands.[ch]: added callbacks for the new
+	to top/bottom functions.
+
+	* app/gui/Makefile.am
+	* app/gui/dockable-commands.[ch]: new files split out of
+	dialogs-commands.[ch].
+
+	* app/gui/dialogs-commands.[ch]
+	* app/gui/dialogs-menu.c: changed accordingly.
+
+	* app/gui/edit-commands.[ch]: added edit_paste_into_cmd_callback()
+	and remove usage of "guint action".
+
+	* app/gui/image-menu.c: changed accordingly.
+
+	* app/gui/palette-editor-commands.[ch]: split
+	+palette_editor_new_color_cmd_callback() into separate callbacks
+	for adding from FG and BG.
+
+	* app/gui/palette-editor-menu.c: changed accordingly.
+
+2004-04-19  Henrik Brix Andersen  <brix@gimp.org>
+
+	* plug-ins/script-fu/scripts/gimp-headers.scm
+	* plug-ins/script-fu/scripts/gimp-labels.scm: applied a patch from
+	William Skaggs which changes the sub menu title for the gimp web
+	theme to classic.gimp.org. Fixes bug #137036.
+
+2004-04-19  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpdrawabletreeview.c: removed unused includes.
+
+2004-04-19  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimppropwidgets.[ch]
+	* app/gui/preferences-dialog.c: replaced
+	gimp_prop_boolean_option_menu_new() with
+	gimp_prop_boolean_combo_box_new().
+
+2004-04-19  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpenumstore.[ch]: avoid unnecessary casts.
+
+	* app/widgets/gimpenumcombobox.[ch]: added an API that inserts a
+	GtkTreeModelFilter to make items invisible. This is a kludge to
+	workaround bug #135875.
+
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimplevelstool.c
+	* app/widgets/gimphistogrameditor.c: use the new function to hide
+	channels that are not available.
+
+2004-04-18  Henrik Brix Andersen  <brix@gimp.org>
+
+	* app/widgets/gimptemplateeditor.c
+	(gimp_template_editor_constructor): use g_signal_connect_object()
+	instead of g_signal_connect(). Fixes bug #140315.
+
+2004-04-18  Pedro Gimeno  <pggimeno@wanadoo.es>
+
+	* plug-ins/common/gauss_rle.c (gauss_rle): Oops, fixed my fix.
+
+2004-04-18  Pedro Gimeno  <pggimeno@wanadoo.es>
+
+	* plug-ins/common/gauss_iir.c: Change tabs to spaces all over the
+	file, in preparation for other changes. Minor cleanup.
+
+	* plug-ins/common/gauss_rle.c (gauss_rle): Plug a leak with the
+	returned value from make_curve().
+
+	* plug-ins/common/tga.c (load_image): Fix a condition which was
+	preventing GRAYA images from loading.
+
+2004-04-18  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu.
+
+	* app/widgets/gimpenumwidgets.[ch]: moved widget constructors that
+	don't use GimpEnumMenu from gimpenummenu.[ch] to these new files.
+
+	* app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget
+	using GimpEnumStore; replaces GimpEnumMenu.
+
+	* app/widgets/gimpenumstore.[ch]: added new function
+	gimp_enum_store_lookup_by_value().
+
+	* app/widgets/gimppropwidgets.[ch]: replaced
+	gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new().
+
+	* app/gui/brush-select.[ch]
+	* app/gui/convert-dialog.c
+	* app/gui/layers-commands.c
+	* app/gui/preferences-dialog.c
+	* app/gui/resize-dialog.c
+	* app/tools/gimpblendoptions.c
+	* app/tools/gimpcolorbalancetool.c
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpcurvestool.c
+	* app/tools/gimplevelstool.c
+	* app/tools/gimpmagnifytool.c
+	* app/tools/gimppaintoptions-gui.c
+	* app/tools/gimpselectionoptions.c
+	* app/tools/gimptransformoptions.c
+	* app/widgets/gimpcolorframe.c
+	* app/widgets/gimpeditor.c
+	* app/widgets/gimpgrideditor.c
+	* app/widgets/gimphistogrameditor.c
+	* app/widgets/gimpstrokeeditor.c
+	* app/widgets/gimptemplateeditor.c
+	* app/widgets/gimptexteditor.c: ported to GimpEnumComboBox.
+
+2004-04-18  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpenumstore.[ch]: added (yet unused) GimpEnumStore,
+	a GtkListStore for enum values.
+
+2004-04-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/print/gimp_main_window.c: replaced wrong use of
+	gimp_option_menu with gimp_int_option_menu.
+
+2004-04-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/script-fu-scripts.c: use a GtkComboBox for
+	SF-OPTION.
+
+2004-04-18  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/winicon/icodialog.c
+	* plug-ins/winicon/icosave.c: ported GtkOptionMenu to GtkComboBox.
+
+2004-04-17  Sven Neumann  <sven@gimp.org>
+
+	* app/widgets/gimpwidgets-constructors.[ch]:
+	s/GtkSignalFunc/GCallback/
+
+2004-04-17  Henrik Brix Andersen  <brix@gimp.org>
+
+	* app/tools/gimphuesaturationtool.c
+	(gimp_hue_saturation_tool_dialog): resolved conflicting
+	mnemonic. Fixes bug #139868.
+
+2004-04-17  Henrik Brix Andersen  <brix@gimp.org>
+
+	* plug-ins/common/jpeg.c (save_dialog): live preview doesn't
+	modify the undo history of the image anymore, label changed
+	accordingly. Fixes bug #140296.
+
+2004-04-16  Pedro Gimeno  <pggimeno@wanadoo.es>
+
+	* plug-ins/common/tile.c (tile): changed a call to
+	gimp_image_undo_enable to _undo_disable which was obviously the
+	intention of the author. Added a call to gimp_drawable_update to
+	get the previews refreshed.
+
+2004-04-16  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpcolorpickertool.c
+	* app/tools/gimpmeasuretool.c: don't use gtk_window_present() to
+	raise the tool dialog since it also moves the focus away from the
+	image window. Fixes the problem described in bug #139349.
+
+2004-04-16  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpcroptool.c: some code cleanup that I forgot to do
+	when applying the patch.
+
+2004-04-16  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/helpbrowser/dialog.c (browser_dialog_load): present the
+	help browser window.
+
+2004-04-16  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/helpbrowser/dialog.c: use a GtkComboBox instead of
+	GtkCombo and keep the history in a GtkListStore.
+
+2004-04-16  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpmarshal.list: new marshaller VOID:STRING
+
+	* app/widgets/Makefile.am
+	* app/widgets/widgets-types.h
+	* app/widgets/gimpactiongroup.[ch]
+	* app/widgets/gimpenumaction.[ch]
+	* app/widgets/gimpstringaction.[ch]: added some completely unused
+	GtkAction infrastructure.
+
+2004-04-15  Manish Singh  <yosh@gimp.org>
+
+	* tools/Makefile.am
+	* app/Makefile.am
+	* configure.in: app, tools, and user dir bumped to version 2.1 names.
+
+	* app/text/gimpfontlist.c: since we now depend on pango 1.4, we can
+	use pango_fc_font_description_from_pattern() instead of our
+	cut-n-paste function, gimp_font_list_font_desc_from_pattern().
+
+2004-04-15  Tor Lillqvist  <tml@iki.fi>
+
+	* app/plug-in/plug-in-message.c (plug_in_handle_proc_install)
+	* app/plug-in/plug-in-proc.h (struct _PlugInProcDef)
+	* app/plug-in/plug-in-rc.c (plug_in_rc_write)
+	* app/plug-in/plug-ins.c (plug_ins_init): Make PDB procedures
+	(including their menu entries) installed during a plug-ins init()
+	phase show up. Add a flag to PlugInProcDef that tells whether the
+	proc was installed during the init() phase. Such procs aren't
+	saved to the pluginrc. Move the code that initializes plug-ins
+	that need initialization earlier, before the procs are added to
+	the PDB and menus are built. Fixes bug #139969.
+
+2004-04-16  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/Makefile.am
+	* plug-ins/common/plugin-defs.pl
+	* plug-ins/common/AlienMap.c: removed the AlienMap plug-in since
+	AlienMap2 duplicates its functionality.
+
+	* plug-ins/common/AlienMap2.c: applied patch from William Skaggs
+	with a couple of user interface improvements (bug #140079).
+
+2004-04-15  Tor Lillqvist  <tml@iki.fi>
+
+	* libgimpthumb/Makefile.am: For Win32, install gimpthumb.def, like
+	the .def files of the other libgimp* libs.
+
+	* app/Makefile.am (INCLUDES): Add PANGOFT2_CFLAGS.
+
+	* gimp-zip.in: Put also libgimpthumb in the developer package.
+
+2004-04-15  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/winicon/icodialog.c: fixed gtk+ includes, added a
+	warning that deprecated widgets are being used.
+
+2004-04-15  Sven Neumann  <sven@gimp.org>
+
+	* configure.in
+	* plug-ins/Makefile.am
+	* plug-ins/winicon/Makefile.am
+	* plug-ins/winicon/icodialog.[ch]
+	* plug-ins/winicon/icoload.[ch]
+	* plug-ins/winicon/icosave.[ch]
+	* plug-ins/winicon/main.[ch]: added plug-in to load and save
+	Windows icon files. Plug-in written by Christian Kreibich, port to
+	GIMP-2.0 API by Gregor Riepl, massive code cleanup by me. Fixes
+	bug #139160.
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpdnd.c (gimp_dnd_data_source_add)
+	(gimp_dnd_data_source_remove): use the new dynamic GtkTargetList
+	based API for changing the widget's drag source types.
+
+	* app/widgets/gimpdocumentview.c (gimp_document_view_new): simply
+	call gimp_dnd_file_source_add() instead of duplicating the whole
+	GtkTargetEntry array insanity just for adding one source type.
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/FractalExplorer/Dialogs.c
+	* plug-ins/flame/flame.c
+	* plug-ins/gfig/gfig.c: first plug-ins ported to GtkFileChooser.
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/display/gimpdisplayshell-callbacks.c
+	* app/display/gimpdisplayshell.c
+	* app/widgets/gimpcontainertreeview.c: removed runtime version
+	checks and workarounds for bugs which are fixed in GTK+ 2.4.
+
+	* app/widgets/gimpfiledialog.c
+	(gimp_file_dialog_selection_changed): added runtime check for GTK+
+	2.4.1 and work around GtkFileChooser's missing "update_preview"
+	functionality for multiple selections if the dependency is not
+	met.
+
+	* app/widgets/gimpwidgets-utils.c (gimp_menu_position)
+	(gimp_menu_button_position): call gtk_menu_set_monitor() until
+	bug #139187 is fixed.
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/widgets/gimpfiledialog.[ch]: derive it from GtkFileChooser
+	instead of GtkFileSelection.
+
+	* app/gui/file-dialog-utils.c
+	* app/gui/file-open-dialog.c
+	* app/gui/file-save-dialog.c
+	* app/widgets/gimpthumbbox.c: changed accordingly.
+
+	* app/gui/gradients-commands.c
+	* app/gui/vectors-commands.c
+	* app/tools/gimpimagemaptool.c
+	* app/widgets/gimperrorconsole.c
+	* app/widgets/gimptexteditor.c
+	* libgimpwidgets/gimpfileentry.c: use file choosers instead of
+	file selectors.
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	* configure.in: depend on glib 2.4.0, gtk+ 2.4.0, pangoft2 1.4.0
+
+	* app/sanity.c: changed accordingly.
+
+2004-04-15  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimpcropoptions.[ch]
+	* app/tools/gimpcroptool.[ch]: applied a patch from Jordi Gay that
+	allows to keep the aspect ratio fixed.
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimplayermask.c (gimp_layer_mask_class_init): set
+	translate_desc to "Move Layer Mask".
+
+	* app/tools/gimpeditselectiontool.c: take the undo desc
+	from the moved item's class instead of duplicating all
+	strings here.
+
+2004-04-15  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimppalette-import.[ch]
+	* app/gui/palette-import-dialog.c: added palette import from RIFF
+	palette files based on a patch from ÉRDI Gergõ (bug #129788).
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/xcf/xcf.c (xcf_save_invoker) (xcf_load_invoker): forgot
+	to add context parameters to this non-generated PDB invokers.
+	Fixes XCF loading/saving.
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpitem.[ch]: added "const gchar *stroke_desc" to
+	the GimpItemClass struct and always push an undo group
+	around GimpItem::stroke().
+
+	* app/core/gimpchannel.c
+	* app/core/gimpselection.c
+	* app/vectors/gimpvectors.c: set the stroke_desc accordingly
+	and don't push undo groups.
+
+	* app/text/gimptextlayer.c (gimp_text_layer_class_init): set
+	all of GimpItemClass' undo_descs.
+
+	* app/text/gimptextlayer-transform.c: don't push undo groups here.
+
+2004-04-15  Sven Neumann  <sven@gimp.org>
+
+	* libgimpcolor/gimpcolorspace.c (gimp_rgb_to_hsv): applied patch
+	from Marco Munari that removes a redundant "if" (bug #133540).
+
+2004-04-15  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/ifscompose/ifscompose.c: applied patch from Yeti that
+	adds spinbuttons instead of simple text entries (bug #138132).
+
+2004-04-15  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/Makefile.am
+	* plug-ins/common/plugin-defs.pl
+	* plug-ins/common/gicon.c: removed the GIcon plug-in (addresses
+	one aspect of bug #139160).
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	Context cleanup continued:
+
+	* app/core/gimpitem.[ch]: added context parameter to
+	GimpItem::stroke().
+
+	* app/core/gimpchannel.c (gimp_channel_stroke)
+	* app/vectors/gimpvectors.c (gimp_vectors_stroke): use it to get
+	default values from instead of gimp_get_user_context().
+
+	* app/core/gimpselection.c
+	* app/gui/stroke-dialog.c
+	* tools/pdbgen/pdb/edit.pdb
+	* tools/pdbgen/pdb/paths.pdb: changed accordingly.
+
+	* app/pdb/edit_cmds.c
+	* app/pdb/paths_cmds.c: regenerated.
+
+	* app/plug-in/plug-in.[ch]: added GimpContext member to the PlugIn
+	struct. Added context parameter to plug_in_new(),
+	plug_in_call_query() and plug_in_call_init().
+
+	* app/plug-in/plug-in-run.[ch]: added context parameters to
+	plug_in_run() and plug_in_repeat().
+
+	* app/gui/plug-in-commands.c
+	* app/gui/vectors-commands.c
+	* app/pdb/procedural_db.c
+	* app/widgets/gimphelp.c: pass a context to plug_in_run() and
+	plug_in_repeat().
+
+	* app/plug-in/plug-in-message.c (plug_in_handle_proc_run): call
+	procedures with the plug-in's context.
+
+	* app/plug-in/plug-ins.c: use a temporary context for running the
+	plug-ins' query() and init() functions. Use the same context for
+	running automatic extensions. This temporarily separates the main
+	Script-Fu extension from the user context (i.e. scripts have no
+	way of setting/getting the global FG, BG, brush etc.).
+
+2004-04-15  Sven Neumann  <sven@gimp.org>
+
+	* NEWS
+	* README: mention that this is the development branch.
+
+2004-04-15  Sven Neumann  <sven@gimp.org>
+
+	* app/paint-funcs/paint-funcs.[ch]:
+	* app/paint-funcs/paint-funcs-generic.h: header cleanup, added
+	some const qualifiers, converted tabs to spaces. Fixes bug #140115
+	for the HEAD branch.
+
+2004-04-15  Michael Natterer  <mitch@gimp.org>
+
+	Get rid of the "current_context" which was in fact just a bunch of
+	global variables. Instead, pass the needed context all the way
+	from the GUI and the PDB to the core. This is a prerequisite for
+	macro recording and generally helps separating the various
+	subsystems from each other. Work in progress...
+
+	* app/core/gimp.[ch]: removed member "current_context" and
+	gimp_[get|set]_current_context().
+
+	* app/core/gimp-edit.[ch]
+	* app/core/gimpdrawable-blend.[ch]
+	* app/core/gimpdrawable-bucket-fill.[ch]
+	* app/core/gimpdrawable-offset.[ch]
+	* app/core/gimpdrawable-transform.[ch]
+	* app/core/gimpimage-crop.[ch]
+	* app/core/gimpimage-flip.[ch]
+	* app/core/gimpimage-merge.[ch]
+	* app/core/gimpimage-resize.[ch]
+	* app/core/gimpimage-rotate.[ch]
+	* app/core/gimpimage.[ch]
+	* app/core/gimpimagefile.[ch]
+	* app/core/gimpitem-linked.[ch]
+	* app/core/gimpitem.[ch]
+	* app/core/gimplayer.[ch]
+	* app/core/gimpselection.[ch]
+	* app/core/gimptemplate.[ch]
+	* app/file/file-open.[ch]
+	* app/file/file-save.[ch]
+	* app/pdb/procedural_db.[ch]
+	* app/text/gimptext-compat.[ch]
+	* app/text/gimptextlayer-transform.[ch]
+	* app/gui/brush-select.[ch]
+	* app/gui/font-select.[ch]
+	* app/gui/gradient-select.[ch]
+	* app/gui/palette-select.[ch]
+	* app/gui/pattern-select.[ch]: added tons of "GimpContext *context"
+	parameters and use the passed context instead of
+	gimp_get_current_context().
+
+	* app/app_procs.c
+	* app/batch.c
+	* app/core/gimpchannel.c
+	* app/core/gimpdrawable.c
+	* app/paint/gimperaser.c
+	* app/paint/gimppaintbrush.c
+	* app/plug-in/plug-in-message.c
+	* app/plug-in/plug-ins.c
+	* app/text/gimptextlayer.c
+	* app/tools/gimpblendtool.c
+	* app/tools/gimpbucketfilltool.c
+	* app/tools/gimpcroptool.c
+	* app/tools/gimpeditselectiontool.c
+	* app/tools/gimpfliptool.c
+	* app/tools/gimpinktool.c
+	* app/tools/gimptransformtool.c
+	* app/vectors/gimpvectors.c
+	* app/gui/convert-dialog.c
+	* app/gui/drawable-commands.c
+	* app/gui/edit-commands.c
+	* app/gui/file-commands.c
+	* app/gui/file-new-dialog.c
+	* app/gui/file-open-dialog.c
+	* app/gui/file-save-dialog.c
+	* app/gui/image-commands.c
+	* app/gui/layers-commands.c
+	* app/gui/offset-dialog.c
+	* app/gui/select-commands.c
+	* app/gui/vectors-commands.c
+	* app/widgets/gimpdnd.c
+	* app/widgets/gimpdocumentview.c
+	* app/widgets/gimphelp.c
+	* app/widgets/gimpthumbbox.c: pass gimp_get_user_context() or
+	GIMP_CONTEXT(tool_options) or whatever is the right context
+	to the changed core functions.
+
+	* tools/pdbgen/app.pl: pass "GimpContext *context" to all
+	generated PDB invokers.
+
+	* tools/pdbgen/pdb/brush_select.pdb
+	* tools/pdbgen/pdb/brushes.pdb
+	* tools/pdbgen/pdb/drawable.pdb
+	* tools/pdbgen/pdb/edit.pdb
+	* tools/pdbgen/pdb/font_select.pdb
+	* tools/pdbgen/pdb/gradient_select.pdb
+	* tools/pdbgen/pdb/gradients.pdb
+	* tools/pdbgen/pdb/image.pdb
+	* tools/pdbgen/pdb/layer.pdb
+	* tools/pdbgen/pdb/paint_tools.pdb
+	* tools/pdbgen/pdb/palette.pdb
+	* tools/pdbgen/pdb/palette_select.pdb
+	* tools/pdbgen/pdb/palettes.pdb
+	* tools/pdbgen/pdb/paths.pdb
+	* tools/pdbgen/pdb/pattern_select.pdb
+	* tools/pdbgen/pdb/patterns.pdb
+	* tools/pdbgen/pdb/selection.pdb
+	* tools/pdbgen/pdb/text_tool.pdb
+	* tools/pdbgen/pdb/transform_tools.pdb: pass the new context
+	parameter to the changed core functions.
+
+	* app/pdb/*_cmds.c: regenerated.
+
+2004-04-14  Raphaël Quinet  <quinet@gamers.org>
+
+	* plug-ins/script-fu/scripts/copy-visible.scm: New version of the
+	script that works on a temporary copy of the image instead of
+	copying the visible layers.  Fixes bug #139989.
+
+2004-04-14  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/common/film.c: fixed typo (bug #140039).
+
+2004-04-14  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: bumped version to 2.1.0, interface age 0, binary
+	age 0. Changed library versioning to include gimp_minor_version
+	similar to how gtk+ does it.
+
+2004-04-14  Sven Neumann  <sven@gimp.org>
+
+	* Made 2.0.1 release.
+
+2004-04-13  Raphaël Quinet  <quinet@gamers.org>
+
+	* plug-ins/common/mng.c (query, run): Workaround for bug #139947:
+	do not register the plug-in for INDEXED* modes and do not declare
+	that it can handle INDEXED images in gimp_export_image().  This
+	forces a conversion to RGB instead of generating broken indexed
+	images.  The generation of correct indexed MNG files is likely to
+	require a newer release of libmng.
+	(mng_data): Set default compression level to 9 instead of 6.
+
+2004-04-13  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_cern_parse.c
+	* plug-ins/imagemap/imap_csim_parse.c
+	* plug-ins/imagemap/imap_ncsa_parse.c: regenerated using GNU Bison
+	version 1.875a. Fixes bug #139894.
+
+2004-04-13  Sven Neumann  <sven@gimp.org>
+
+	* tools/gimp-remote.c: reverted last change and go back to the
+	solution using fork(). Hopefully fixes bug #139158 this time.
+
+2004-04-13  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimp-utils.[ch] (gimp_get_default_language): added a
+	category parameter to make this function more flexible.
+
+	* app/text/gimptext.c: changed accordingly.
+
+	* app/widgets/gimphelp.c (gimp_help): localize the help pages
+	according to the value of LC_MESSAGES. Fixes bug #139917.
+
+2004-04-13  Michael Natterer  <mitch@gimp.org>
+
+	Moved the calls to floating_sel_relax()/rigor() from various
+	places to two single spots in the core where they are actually
+	needed. Fixes bug #138356 (which was caused by the projection
+	being triggered in the middle of changing the floating selection's
+	size or the size of the drawable it is attached to). This commit
+	effectively removes floating selection fiddling from the core's
+	public API.
+
+	* app/core/gimpdrawable.[ch] (gimp_drawable_has_floating_sel): new
+	function which returns TRUE if there is a floating selection
+	attached to the drawable.
+
+	* app/core/gimpdrawable.c (gimp_drawable_translate)
+	(gimp_drawable_set_tiles_full): if the drawable *has* a floating
+	selection, relax/rigor it before/after modifying the drawable.
+
+	* app/core/gimplayer.c (gimp_layer_translate)
+	(gimp_layer_set_tiles): if the layer *is* the floating selection,
+	relax/rigor it before/after modifying it.
+
+	* app/core/gimpdrawable-transform.c
+	* app/core/gimpimage-convert.c
+	* app/core/gimpimage-crop.c
+	* app/core/gimpimage-flip.c
+	* app/core/gimpimage-resize.c
+	* app/core/gimpimage-rotate.c
+	* app/core/gimpimage-scale.c
+	* app/gui/layers-commands.c
+	* app/tools/gimpeditselectiontool.c
+	* tools/pdbgen/pdb/layer.pdb: removed calls to
+	floating_sel_rigor()/relax() all over the place. Also removed
+	lots of undo groups which are obsolete now.
+
+	* app/pdb/layer_cmds.c: regenerated.
+
+2004-04-13  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/imagemap/imap_file.c (do_file_error_dialog): convert
+	the filename to UTF-8 before displaying it.
+
+2004-04-13  Michael Natterer  <mitch@gimp.org>
+
+	GimpItem undo group cleanup in preparation of fixing bug #138356:
+
+	* app/core/core-enums.[ch]: renamed LAYER_SCALE and LAYER_RESIZE
+	undo groups to ITEM_SCALE and ITEM_RESIZE.
+
+	* app/core/gimpitem.[ch]: always push undo groups around
+	GimpItem::translate(), scale(), resize(), flip(), rotate() and
+	transform(). Added the resp. undo_desc strings to GimpItemClass.
+
+	* app/core/gimpchannel.[ch]
+	* app/core/gimpdrawable.[ch]
+	* app/core/gimplayer.c: removed all undo groups from
+	implementations of the above methods. Removed the undo_desc
+	strings which were moved to GimpItemClass.
+
+	* app/core/gimpimage-crop.c
+	* app/core/gimpselection.c
+	* app/gui/layers-commands.c
+	* app/vectors/gimpvectors.c
+	* tools/pdbgen/pdb/layer.pdb: changed accordingly.
+
+	* app/pdb/layer_cmds.c: regenerated.
+
+2004-04-12  Sven Neumann  <sven@gimp.org>
+
+	* configure.in: cleaned up the check for Xmu. Include <gdk/gdkx.h>
+	when testing for Xmu.h. Fixes bug #139803.
+
+2004-04-12  Sven Neumann  <sven@gimp.org>
+
+	* libgimpmath/Makefile.am: remove test-md5 on make clean.
+
+2004-04-11  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/pygimp/plug-ins/py-slice.py: When using a separate dir for
+	images, actually prepend the dir to the img srcs in the html. Allow
+	only horizontal or vertical guides in an image, do not require both.
+	A bit smarter path handling. Addresses most of bug #138714.
+
+2004-04-11  Hans Breuer  <hans@breuer.org>
+
+	* app/makefile.msc : build sanity.obj
+	  app/text/makefile.msc : gimptextundo.obj
+	  app/widgets/makefile.msc : gimppatternfactoryview.obj
+
+	* plug-ins/common/winclipboard.c : don't call
+	gimp_image_undo_enable() when it's not switched off.
+	Otherwise the undo history would be destroyed with
+	Gimp-Core-CRITICAL **: file gimpimage.c: line 1579: assertion
+	`gimage->undo_freeze_count > 0' failed
+
+2004-04-10  Sven Neumann  <sven@gimp.org>
+
+	* app/tools/gimptexttool.c (gimp_text_tool_apply): push an undo
+	group only when it's needed. This resurrects text undo compression
+	that broke when bug #137767 got fixed.
+
+2004-04-10  Sven Neumann  <sven@gimp.org>
+
+	* docs/gimp-remote.1.in: updated example URL.
+
+2004-04-10  Pedro Gimeno  <pggimeno@wanadoo.es>
+
+	* app/core/gimpdrawable-transform.c
+	(gimp_drawable_transform_tiles_affine): Applied patch from William
+	Skaggs that addresses bug #120490.
+
+	* app/sanity.c (sanity_check): Modified the message that reports
+	an old version of Fontconfig in an attempt to make it more
+	informative.
+
+2004-04-10  Sven Neumann  <sven@gimp.org>
+
+	* tools/gimp-remote.c (start_new_gimp): reverted the last change
+	and did a different fix that involves closing the X display before
+	starting gimp (bug #139158).
+
+2004-04-09  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/jpeg.c: Uglier workaround for bug #138357, since
+	the previous one did break error handling. Fixes bug #139571.
+
+2004-04-09  Henrik Brix Andersen  <brix@gimp.org>
+
+	* README.i18n: s/14/20/ plus whitespace clean-up.
+
+2004-04-08  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/siod-wrapper.c: applied a patch from Kevin
+	Cozens that makes the Script-Fu PDB marshaller handle NULL
+	strings. Some minor code cleanup. Fixes bug #139386.
+
+2004-04-08  Sven Neumann  <sven@gimp.org>
+
+	* tools/gimp-remote.c (start_new_gimp): applied a patch from
+	Michael Matz that calls fork() before starting gimp. This is to
+	avoid X server authentification problems (bug #139158).
+
+2004-04-07  Henrik Brix Andersen  <brix@gimp.org>
+
+	* configure.in (ALL_LINGUAS): revert addition of "is" until all
+	.po files are there.
+
+2004-04-07  Samúel Jón Gunnarsson  <sammi@techattack.nu>
+
+	* configure.in: Added "is" to ALL_LINGUAS
+
+2004-04-06  Iñaki Larrañaga  <dooteo@euskalgnu.org>
+
+	* configure.in: Added "eu" (Basque) to ALL_LINGUAS.
+
+2004-04-05  Pedro Gimeno  <pggimeno@wanadoo.es>
+
+	* plug-ins/script-fu/scripts/copy-visible.scm: Use
+	gimp-image-get-active-layer/channel instead of the passed
+	drawable for later restoring the initially active layer/channel.
+	Addresses bug #138662.
+
+	* plug-ins/script-fu/scripts/drop-shadow.scm: Add a call to
+	gimp-image-set-active-layer in order for it to fail early instead
+	of failing with the undo group open in case the drawable is not
+	suitable for applying the effect.
+
+2004-04-05  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage.c (gimp_image_real_mode_changed): update the
+	whole image.
+
+	* app/display/gimpdisplay-handlers.c: removed obsolete
+	"mode_changed" and "colormap_changed" handlers because GimpImage's
+	default handlers already update the whole image.
+
+2004-04-05  Pedro Gimeno  <pggimeno@wanadoo.es>
+
+	Sanitize rectangle and ellipse selection handling (bug #138237
+	and bug #138103):
+
+	* app/tools/gimprectselecttool.h
+	* app/tools/gimprectselecttool.c (GimpRectSelectTool): new
+	member "moved" indicating whether the cursor was moved after
+	the click.
+	(gimp_rect_select_tool_coords_to_integer): New function for
+	consistent conversion of the rectangle FP coords to pixels.
+	(gimp_rect_select_tool_button_press,
+	gimp_rect_select_tool_button_release,
+	gimp_rect_select_tool_motion, gimp_rect_select_tool_draw): use
+	it instead of fiddling with the FP coordinates. Update "moved"
+	and use it to detect whether the selection needs to be cleared.
+
+	* app/tools/gimpellipseselecttool.c
+	(gimp_ellipse_select_tool_draw): use the new coords_to_integer
+	function.
+
+2004-04-05  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/Lighting/lighting_ui.c: applied the second patch
+	attached to bug #138788 by William Skaggs. Removes some user
+	interface elements that have no corresponding implementation and
+	fixes preview updates.
+
+2004-04-04  Sven Neumann  <sven@gimp.org>
+
+	* Makefile.am
+	* NEWS.pre-2-0: moved old NEWS to this new file.
+
+	* NEWS: list bugs fixed since 2.0.0.
+
+2004-04-04  Sven Neumann  <sven@gimp.org>
+
+	* Makefile.am
+	* docs/Makefile.am: don't install gimptool symlinks to
+	gimptool-2.0 and its manpage. gimp.m4 as installed with gimp-1.2
+	looks for gimptool (bug #139024).
+
+2004-04-04  Sven Neumann  <sven@gimp.org>
+
+	* app/display/gimpdisplayshell-callbacks.c
+	* app/display/gimpdisplayshell-draw.[ch] pass the bounding box of
+	the exposed area to gimp_display_shell_draw_grid() and draw only
+	the relevant part of the grid. Fixes bug #138081.
+
+2004-04-04  Sven Neumann  <sven@gimp.org>
+
+	Cache the GC for drawing the grid as suggested in bug #138081:
+
+	* app/display/gimpdisplayshell.[ch]: added a grid_gc member to
+	GimpDisplayShell.
+
+	* app/display/gimpdisplayshell-handlers.c
+	(gimp_display_shell_grid_notify_handler)
+	(gimp_display_shell_disconnect): invalidate the grid GC.
+
+	* app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid):
+	use the cached grid_gc. Also applied the fix that Pedro Gimeno did
+	for bug #138606.
+
+2004-04-04  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpundo.c (gimp_undo_type_to_name): added a missing
+	call to gettext(). Fixes bug #139000.
+
+2004-04-03  Manish Singh  <yosh@gimp.org>
+
+	* gimptool-2.0.in: Create any directories in the install path that do
+	not already exist. Fixes bug #138980.
+
+	* docs/gimptool.1.in: s/dont/don't/g
+
+2004-04-04  Sven Neumann  <sven@gimp.org>
+
+	* app/core/gimpimagemap.c (gimp_image_map_apply): do nothing if the
+	selection is empty. Fixes bug #138973.
+
+2004-04-03  Sven Neumann  <sven@gimp.org>
+
+	* app/text/gimptextlayer.c (gimp_text_layer_new): create the
+	initial text layer with a size of 1 x 1 since tile_manager_new()
+	does not any longer accept 0 x 0.
+
+	* app/core/gimpdrawable.c (gimp_drawable_configure): check that
+	width and height are > 0.
+
+2004-04-03  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/Lighting/lighting_main.c
+	* plug-ins/Lighting/lighting_shade.c: applied the first of two
+	patches attached to bug #138788 by William Skaggs.
+
+2004-04-02  Simon Budig  <simon@gimp.org>
+
+	* plug-ins/common/whirlpinch.c: set a proper pixelfetcher
+	edge mode for bigger radii. Avoids getting garbage at the
+	image borders.
+
+2004-04-02  Dave Neary  <bolsh@gimp.org>
+
+	* plug-ins/common/jpeg.c: Added .jpe to the list of extensions
+	that the jpeg plug-in recognises. Fixes bug #138776.
+
+2004-04-01  Sven Neumann  <sven@gimp.org>
+
+	* app/gui/user-install-dialog.c: unset the bg_pixmap and tweak
+	style colors for all states. Sort of ugly but makes the dialog
+	work better with more obscure themes (bug #138379).
+
+2004-04-01  Sven Neumann  <sven@gimp.org>
+
+	* tools/kernelgen.c: updated a comment.
+
+2004-04-01  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-enums.[ch] (enum GimpUndoType): added undo type
+	GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types
+	GIMP_UNDO_GROUP_DRAWABLE and GIMP_UNDO_GROUP_DRAWABLE_MOD.
+
+	* app/core/gimpimage-undo-push.[ch]: added new new function
+	gimp_image_undo_push_text_layer_modified() which makes
+	modifications of the text_layer's "modified" boolean undoable.
+
+	* app/core/gimpdrawable.[ch]: added new virtual function
+	GimpDrawable::push_undo() and moved the actual undo pushing into
+	the default implementation gimp_drawable_real_push_undo().
+
+	* app/text/gimptextlayer.c (gimp_text_layer_push_undo): new
+	function. Pushes the text_layer's modified state to the undo stack
+	after upchaining and sets modified to TRUE.
+
+	(gimp_text_layer_set_tiles): ditto.
+
+	(gimp_lext_layer_apply_region)
+	(gimp_text_layer_replace_region): removed because their default
+	implementations already call gimp_drawable_push_undo().
+
+	(gimp_text_layer_swap_pixels): removed because swap_pixels() is
+	used by undo only and doesn't need to care about the text_layer's
+	modified state.
+
+	(gimp_text_layer_render): don't set modified to FALSE here because
+	we can't push an undo step here.
+
+	(gimp_text_layer_set): push the modified state to the undo stack
+	and set it to FALSE here. Also push the layer's tiles if the
+	layer was modified.
+
+	* app/tools/gimptexttool.c (gimp_text_tool_apply): push "modified"
+	to the undo stack and set it to FALSE here, too.
+
+	Fixes bug #137767.
+
+2004-03-31  Simon Budig  <simon@gimp.org>
+
+	* app/tools/gimptransformtool.c: One really should use braces
+	when mixing additions and multiplication and the operator
+	precedence is not the desired one...
+
+	I feel stupid...  :-)
+
+2004-03-31  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimp-transform-utils.c
+	(gimp_transform_matrix_perspective): make sure 0.0/0.0 results
+	in 1.0, not NaN.
+
+	* app/core/gimpdrawable-transform.c
+	(gimp_drawable_transform_tiles_affine): instead of returning NULL
+	if the transformation shrinks the tiles completely away, return at
+	least the pixel (or the row or column of pixels) which best covers
+	the sub-pixel area of the transform result:
+
+	- Changed rounding of the transformed coordinates from RINT()
+	  to floor()/ceil() so we don't cut off sub-pixel portions of the
+	  transform result.
+	- Force the minimal size if the changed rounding didn't help.
+
+	Fixes bug #138117.
+
+	Also added paranoia code which falls back to clip_result if the
+	passed matrix produces NaN coordinates (copied the FINITE() macro
+	from image_cmds.c).
+
+2004-03-30  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/grid-system.scm: define "map" here,
+	the script used to take the definition from alien-glow-arrow.scm
+	or beveled-pattern-arrow.scm. Also added an undo group around all
+	operations. Fixes bug #138524.
+
+2004-03-30  Michael Natterer  <mitch@gimp.org>
+
+	* app/Makefile.am
+	* app/sanity.[ch]: new files implementing sanity_check() for
+	run-time checking library versions. Added a check for FreeType but
+	disabled it until we figured if and how freetype causes some of
+	the DLL hell bugs.
+
+	* app/main.c (main): call it and abort if it fails.
+
+	* app/app_procs.[ch]: added app_gui_abort() so main.c doesn't
+	need to #include "gui/gui.h"
+
+	* app/gui/gui.[ch] (gui_libs_init): removed library sanity checking.
+
+	(gui_abort): new function which shows the abort message.
+
+2004-03-30  Michael Natterer  <mitch@gimp.org>
+
+	* configure.in (ALL_LINGUAS): revert addition of "pa" until
+	all .po files are there.
+
+2004-03-20  Guntupalli Karunakar  <karunakar@freedomink.org>
+
+	* configure.in: Added "pa" for Punjabi to ALL_LINGUAS.
+
+2004-03-29  Manish Singh  <yosh@gimp.org>
+
+	* plug-ins/common/jpeg.c (struct my_error_mgr): Move setjump_buffer
+	to the beginning of the structure, to make sure it is aligned on a
+	16-byte boundary for ia64, even with icc. Fixes #138357.
+
+2004-03-29  Sven Neumann  <sven@gimp.org>
+
+	* app/config/gimpguiconfig.c: changed the default for "help-locales"
+	from NULL to an empty string. Fixes the generated gimprc man-page.
+
+	* app/config/gimprc-blurbs.h (HELP_LOCALES_BLURB): added missing
+	whitespace.
+
+	* app/widgets/gimphelp.c: use the user's locale if "help-locales"
+	is NULL or the empty string.
+
+	* docs/gimprc.5.in
+	* etc/gimprc: regenerated.
+
+2004-03-29  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/core-enums.[ch] (enum GimpUndoType): added new group
+	GIMP_UNDO_GROUP_FS_REMOVE.
+
+	* app/core/gimplayer-floating-sel.c (floating_sel_remove): push an
+	undo group. Fixes undo corruption spotted by Pedro Gimeno.
+
+2004-03-29  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/guillotine.c (guillotine): Don't just skip
+	guides at the image edges but any guide which is at a position we
+	already remembered. Should catch all instances of bug #138312 this
+	time.
+
+2004-03-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/ifscompose/ifscompose.c: applied patch from David Necas
+	that updates the sensitivity of the Delete button and menu entry.
+	Fixes bug #138212.
+
+2004-03-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/MapObject/mapobject_main.c: fixed non-interactive call.
+
+	* plug-ins/script-fu/scripts/spinning-globe.scm: pass -1 as
+	drawable ID for unused drawables. Fixes bug #138253.
+
+2004-03-28  Sven Neumann  <sven@gimp.org>
+
+	* app/text/gimpfontlist.c (gimp_font_list_add_font): validate the
+	font name. This should work around the crashes that Windows users
+	were experiencing on startup (bug #132366). The real problem needs
+	to be fixed elsewhere though.
+
+2004-03-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpimage-undo-push.c (undo_pop_layer): when re-adding
+	a layer with mask, don't forget to set layer->mask->removed to FALSE.
+
+2004-03-28  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpitem.[ch]: added "gboolean removed" to the GimpItem
+	struct. Defaults to FALSE. Set it to TRUE in gimp_item_removed().
+	Added public function gimp_item_is_removed().
+
+	* app/core/gimpimage-undo-push.c (undo_pop_layer)
+	(undo_pop_layer_mask) (undo_pop_channel) (undo_pop_vectors):
+	set it to FALSE manually when re-adding something from the
+	undo stack.
+
+	* tools/pdbgen/app.pl
+	* tools/pdbgen/pdb.pl: don't allow any operation on items which
+	are removed from the image (and exist on the undo stack only).
+	Fixes bug #138311.
+
+	* app/pdb/channel_cmds.c
+	* app/pdb/color_cmds.c
+	* app/pdb/drawable_cmds.c
+	* app/pdb/edit_cmds.c
+	* app/pdb/floating_sel_cmds.c
+	* app/pdb/image_cmds.c
+	* app/pdb/layer_cmds.c
+	* app/pdb/paint_tools_cmds.c
+	* app/pdb/parasite_cmds.c
+	* app/pdb/selection_cmds.c
+	* app/pdb/selection_tools_cmds.c
+	* app/pdb/transform_tools_cmds.c: regenerated.
+
+2004-03-28  Sven Neumann  <sven@gimp.org>
+
+	* plug-ins/script-fu/scripts/slide.scm: applied a (modified) patch
+	from Nils Philippsen that fixes bug #138310.
+
+2004-03-28  Michael Natterer  <mitch@gimp.org>
+
+	* plug-ins/common/guillotine.c (guillotine): applied a (modified)
+	patch from Joao S. O. Bueno which removes any guides from the
+	cropped images. Fixes bug #138314.
+
+	Skip guides which are at the image's edges because the algorithm
+	already assumes that there are always guides at these positions.
+	Fixes bug #138312.
+
+2004-03-27  Tor Lillqvist  <tml@iki.fi>
+
+	* plug-ins/help/Makefile.am (AM_LDFLAGS): Use -mwindows on Windows
+	to avoid a console window popping up.
+
+2004-03-26  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/app.pl: don't generate code with tabs.
+
+	* tools/pdbgen/pdb/procedural_db.pdb: convert tabs to spaces in
+	helper function declaration.
+
+	* app/pdb/procedural_db.c: convert tabs to spaces.
+
+	* app/pdb/*.c: regenerated, no code changes, only tabs->spaces.
+
+2004-03-26  Manish Singh  <yosh@gimp.org>
+
+	* tools/pdbgen/app.pl: kill whitespace in blank lines.
+
+	* app/pdb/*.c: regenerated, no code changes, only whitespace.
+
+2004-03-26  Michael Natterer  <mitch@gimp.org>
+
+	* app/core/gimpdrawable-transform.c
+	(gimp_drawable_transform_tiles_affine): return NULL tiles if the
+	matrix would transform the drawable into nothing. Fixes the
+	core-crashing part of bug #138117 and makes the script fail
+	with an execution error.
+
+2004-03-25  Sven Neumann  <sven@gimp.org>
+
+	* README: mention the gimp-perl pre-release and provide a link.
+
+2004-03-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/base/tile-manager.c (tile_manager_new): g_return_if_fail()
+	on width, height or bpp <= 0. Doesn't fix anything but badly
+	warns (and helps debugging) on bug #138117.
+
+2004-03-25  Michael Natterer  <mitch@gimp.org>
+
+	* app/tools/gimpvectortool.c (gimp_vector_tool_button_release):
+	fixed condition which triggers the path tool's undo hack.  Fixes
+	bug #138086. Also g_object_unref() the undo step.
+
+	Removed trailing whitespace.
+
+2004-03-25  Manish Singh  <yosh@gimp.org>
+
+	* libgimp/gimp.c
+	* app/plug-in/plug-in-shm.c: close the shm_open fd in the POSIX
+	shm case. We were leaking an fd here.
+
+	* app/tools/gimptexttool.c (gimp_text_tool_connect): remove
+	unnecessary G_OBJECT() cast in g_object_set() call.
+
+2004-03-23  Michael Natterer  <mitch@gimp.org>
+
+	* autogen.sh: be verbose about AUTOGEN_CONFIGURE_ARGS in the
+	message that is printed if no arguments were passed.
+
+2004-03-23  Sven Neumann  <sven@gimp.org>
+	    Michael Natterer <mitch@gimp.org>
+
+	* Made 2.0.0 release.