diff options
Diffstat (limited to 'ChangeLog.pre-2-2')
| -rw-r--r-- | ChangeLog.pre-2-2 | 21166 |
1 files changed, 21166 insertions, 0 deletions
diff --git a/ChangeLog.pre-2-2 b/ChangeLog.pre-2-2 new file mode 100644 index 0000000..2703e81 --- /dev/null +++ b/ChangeLog.pre-2-2 @@ -0,0 +1,21166 @@ +2004-12-19 Sven Neumann <sven@gimp.org> + + * Made 2.2.0 release. + +2004-12-18 Sven Neumann <sven@gimp.org> + + * app/tools/gimprotatetool.c (gimp_rotate_tool_dialog): fixed label. + +2004-12-18 Sven Neumann <sven@gimp.org> + + * app/dialogs/resize-dialog.c: free the dialog's private data + struct using a weak reference, not in a "destroy" handler. Should + fix bug #161472. + + * app/dialogs/print-size-dialog.c + * app/dialogs/scale-dialog.c: same change here. + +2004-12-18 Sven Neumann <sven@gimp.org> + + * app/dialogs/quit-dialog.c: marked a message for translation that + had been forgotten. Fixes bug #161596. + +2004-12-17 Sven Neumann <sven@gimp.org> + + * autogen.sh: check for gtk-doc.m4, depend on intltool > 0.31. + +2004-12-17 Sven Neumann <sven@gimp.org> + + * app/tools/gimpmovetool.c (gimp_move_tool_cursor_update): don't + use the rect-select cursor if the tool is in move-layer mode. + Spotted by Joao S. O. Bueno, bug #161465. + +2004-12-17 Simon Budig <simon@gimp.org> + + * app/tools/gimpcurvestool.c: Kill some nonsensical code that + tried to set control points in a free form curve based on the + image coordinates (huh?). Update the Graph after adding a point. + Untabbified. + +2004-12-17 Sven Neumann <sven@gimp.org> + + * app/tools/gimpimagemaptool.c (gimp_image_map_tool_pick_color): + take drawable offsets into account. Fixes bug #161508. + +2004-12-17 Sven Neumann <sven@gimp.org> + + * docs/gimp-remote.1.in + * docs/gimp.1.in + * docs/gimptool.1.in: minor tweaks. + +2004-12-17 Simon Budig <simon@gimp.org> + + * data/images/gimp-splash.png: Added new splash by + Bill Luhtala <bluhtala@telus.net>. + + * data/images/gimp-logo.png: Added new Image for the about dialog + by Philip Lafleur <deathpudding@gmail.com>. + + * app/dialogs/about-dialog.c: Adjusted text colors and placement + to the new image. + + * data/images/gimp2_0_logo.png + * data/images/gimp2_0_splash.png: Added for historical reasons. + + * data/images/gimp_logo.png: Removed (renamed to gimp-logo.png) + * data/images/Makefile.am: changed accordingly. + +2004-12-16 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/core/gimpgradient-load.c: reject .ggr files whose + segments don't properly span the range 0-1. + Fixes bug #161430. + +2004-12-16 Manish Singh <yosh@gimp.org> + + * app/widgets/gimppdbdialog.c (gimp_pdb_dialog_set_property): Cast + result of g_value_dup_object() to GIMP_CONTEXT(). + +2004-12-16 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/script-fu/scripts/circuit.scm: don't try to + desaturate a grayscale layer, fixes bug #161470. + +2004-12-16 Sven Neumann <sven@gimp.org> + + * INSTALL: updated location of fontconfig sources. + +2004-12-16 Sven Neumann <sven@gimp.org> + + * app/config/gimpconfig-dump.c + * docs/gimp-remote.1.in + * docs/gimp.1.in + * docs/gimprc.5.in: hyphens revisited. + +2004-12-16 Sven Neumann <neumann@jpk.com> + + * app/config/gimpconfig-dump.c (dump_gimprc_manpage): escape hyphens. + + * docs/gimp.1.in: documented the way that splash images are choosen. + + * docs/gimprc.5.in: regenerated. + +2004-12-16 Michael Natterer <mitch@gimp.org> + + * app/actions/actions.c (action_data_get_*): get gimp, display or + image from a context only if it isn't NULL. Fixes warnings and + crashes when dragging around some dockables (the dockables' + context temporarily becomes NULL while dragging). + + Reordered checks for the passed "data" to be consistent across the + various functions. + + Removed assertions which said "#warning: remove me before 2.2" + +2004-12-16 Sven Neumann <neumann@jpk.com> + + * app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog): + added a note on how to use the dialog, copied from the GNOME keyboard + shortcuts editor. + +2004-12-15 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/text_tool.pdb: let gimp_text() and + gimp_text_fontname() succeed but return -1 if no layer was created. + Fixes bug #161272. + + * app/pdb/text_tool_cmds.c + * libgimp/gimptexttool_pdb.c: regenerated. + +2004-12-15 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable-preview.[ch]: added utility function + gimp_drawable_preview_bytes() and use it. Some cleanup, + untabified. + + * app/widgets/gimpviewrendererdrawable.c: use + gimp_drawable_preview_bytes() instead of duplicating its code. + +2004-12-15 Michael Natterer <mitch@gimp.org> + Sven Neumann <sven@gimp.org> + + * app/core/gimpdrawable-preview.c (gimp_drawable_preview_scale): + fixed RGBA resampling by using premultiplied values for the + intermediate accumulation buffer. Fixes bugs #72880 and #72881. + +2004-12-14 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-proc-frame.[ch]: added "gint ref_count" to + the PlugInProcFrame struct. Added new functions + plug_in_proc_frame_ref/unref(). + + (plug_in_proc_frame_new): set the ref_count to 1. + + * app/plug-in/plug-in.[ch] (plug_in_proc_frame_push): return the + new proc_frame. + + (plug_in_proc_frame_pop): use unref() instead of free(). + + * app/plug-in/plug-in-run.c (plug_in_temp_run): ref the proc_frame + while running its main loop. Removed the call to + plug_in_proc_frame_pop(). + + * app/plug-in/plug-in-message.c (plug_in_handle_temp_proc_return): + call plug_in_proc_frame_pop() immediately after + plug_in_main_loop_quit() so the proc_frame goes away from the + stack and can't be used accidentially if the core is too busy to + return to the main loop before the next command arrives on the + wire. Really fixes bug #161114 this time. + +2004-12-14 Simon Budig <simon@gimp.org> + + * app/vectors/gimpstroke.[ch]: Changed the "gradient" parameter + to "slope" to make it more clear what the returned result is (which + was wrong earlier). + * tools/pdbgen/pdb/paths.pdb: changed accordingly + + * app/pdb/paths_cmds.c + * libgimp/gimppaths_pdb.[ch]: regenerated. + + Fixes bug #161274. + +2004-12-14 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/imagemap/imap_selection.c: don't use + gtk_tree_selection_get_selected with GTK_SELECTION_MULTIPLE. Should + finally fix bug #149157. + +2004-12-14 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpstock.c (gimp_stock_init): documented. + +2004-12-14 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_misc.c (make_toolbar_radio_icon): don't + call gtk_radio_tool_button_new_with_stock_from_widget() with a + NULL widget. Fixes bug #161210. + +2004-12-14 Sven Neumann <sven@gimp.org> + + * configure.in: added GIMP_API_VERSION to the generated gimpversion.h. + + * libgimpbase/gimpenv.c (gimp_toplevel_directory): use + GIMP_API_VERSION instead of GIMP_MACRO_VERSION.GIMP_MINOR_VERSION + when building a path to test the plug-in executable path against. + +2004-12-14 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/drawable.pdb: added gimp_drawable_sub_thumbnail() + to enable plug-ins avoiding #142074-alike bugs if they need to. + + * app/pdb/drawable_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpdrawable_pdb.[ch]: regenerated. + + * libgimp/gimpdrawable.[ch] + * libgimp/gimppixbuf.[ch]: wrap it with the same convenience + APIs as gimp_drawable_thumbnail(). + + * libgimp/gimp.def + * libgimp/gimpui.def: changed accordingly. + +2004-12-13 Sven Neumann <sven@gimp.org> + + * HACKING + * autogen.sh + * configure.in: switched to using gtkdocize for the build of the + API docs. + +2004-12-13 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/imagemap/imap_selection.c: don't try do to anything when + selection is empty. Fixes bug #149157. + +2004-12-13 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/imagemap/imap_misc.[ch] + * plug-ins/imagemap/imap_selection.[ch] + * plug-ins/imagemap/imap_toolbar.[ch] + * plug-ins/imagemap/imap_tools.[ch]: removed need for + GTK_DISABLE_DEPRECATED. Looking at #149157 next... + +2004-12-13 Sven Neumann <sven@gimp.org> + + * app/tools/gimpcroptool.c: don't show the Crop tool window if + Shift is being pressed on the initial button_press event. + +2004-12-13 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/pygimp/gimpfu.py: display PF_RADIO options vertically + instead of horizontally, as suggested by Joao S. O. Bueno Calligaris. + Fixes bug #160546. + +2004-12-13 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/gfig/gfig.c: make the "gfig" layer parasites persistent, + so that they will be saved in xcf files. Stop printing "GFig + parasite found" message. + +2004-12-13 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimppdbdialog.[ch]: don't forget the context we + were created with but rmember it as pdb_dialog->caller_context. + + * app/widgets/gimpbrushselect.c + * app/widgets/gimpfontselect.c + * app/widgets/gimpgradientselect.c + * app/widgets/gimppaletteselect.c + * app/widgets/gimppatternselect.c: use the caller_context when + calling the temp_proc so the temp_proc's stack frame doesn't + contain the dialog's private context (which is just a scratch + model for the container views) but the plug-in's real context + which is fully initialized. Fixes bug #161114. + +2004-12-13 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablecombobox.c: fixed gtk-doc comment. + +2004-12-13 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-style.c: let objects keep their own fill_style + context. + +2004-12-13 Sven Neumann <sven@gimp.org> + + * app/core/gimpimage-convert.c: applied patch from Adam D. Moss with + more fixed dither improvements (bug #161123). + +2004-12-13 Sven Neumann <sven@gimp.org> + + * app/gui/splash.c: restrict splash image to screen size to guard us + from insanely large splash images. + +2004-12-13 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdock.c (gimp_dock_delete_event): invert logic so + everything except GTK_RESPONSE_OK keeps the dock open + (e.g. hitting escape). + +2004-12-12 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable-preview.c (gimp_drawable_get_sub_preview): + added precondition check for the coords of the src area. Some + cleanup and simplification. + + * app/widgets/gimpviewrendererdrawable.c + (gimp_view_renderer_drawable_render): don't request sub-previews + of area outside the drawable and don't reuqest previews of zero + width or height. Fixes crashes with the new preview code. + +2004-12-12 Sven Neumann <sven@gimp.org> + + Applied patch from Adam D. Moss (bug #161113): + + * app/core/gimpimage-convert.c: Use a slower but much nicer + technique for finding the two best colours to dither between when + using fixed/positional dither methods. Makes positional dither + much less lame. + +2004-12-12 Sven Neumann <sven@gimp.org> + + * plug-ins/common/film.c (film): push a context around code that + changes the foreground color. + +2004-12-12 Sven Neumann <sven@gimp.org> + + * app/batch.c (batch_run): changed handling of the 'gimp -b -' + command-line. It used to spawn three instances of Script-Fu, two + should be more than enough. + +2004-12-12 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/widgets/gimpdataeditor.c: make Revert button insensitive + because revert is not yet implemented (bug #152259). + +2004-12-12 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpdock.c: show a confirmation dialog if a dock + with multiple tabs is being closed. Sorry for the new strings, + they were carefully copied from gnome-terminal. + +2004-12-12 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/pnm.c: make export do the right thing when + saving as .pgm or .ppm. Fixes bug #160045. + +2004-12-12 Sven Neumann <sven@gimp.org> + + * libgimp/gimp.def: added gimp_edit_copy_visible. + + * plug-ins/script-fu/scripts/copy-visible.scm: deprecated. + +2004-12-12 Sven Neumann <sven@gimp.org> + + * plug-ins/common/winclipboard.c: applied patch from Brion Vibber + that adds an alpha channel to the pasted layer. Fixes bug #148601. + +2004-12-12 Sven Neumann <sven@gimp.org> + + * app/base/tile-manager-crop.c: removed trailing whitespace. + + * plug-ins/imagemap/imap_selection.c: need to define + GTK_DISABLE_DEPRECATED for gtk_toolbar_append_space(). + +2004-12-12 Michael Natterer <mitch@gimp.org> + + * app/paint-funcs/paint-funcs.[ch]: added new function + copy_region_nocow() as a workaround for the fact that sharing + tiles with the projection is heavily broken. + + * app/base/tile-manager.c (tile_invalidate): added a warning when + entering the code path that breaks badly. + + * app/core/gimp-edit.[ch]: added gimp_edit_copy_visible(), using + the non-COW copying function above. + + * app/widgets/gimphelp-ids.h: added GIMP_HELP_COPY_VISIBLE. + + * app/actions/edit-actions.c + * app/actions/edit-commands.[ch]: added action & callback for + "edit-copy-visible". + + * menus/image-menu.xml.in: added "edit-copy-visible" to the image + menu. + + * tools/pdbgen/pdb/edit.pdb: added gimp_edit_copy_visible() + PDB wrapper. + + * app/pdb/edit_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpedit_pdb.[ch]: regenerated. + + * plug-ins/script-fu/scripts/copy-visible.scm: removed all code + and made it a backward compat wrapper around gimp-edit-copy-visible. + Fixes bug #138662. + +2004-12-11 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable-preview.c (gimp_drawable_preview_private): + implement it using gimp_drawable_get_sub_preview(). Removes + massive code duplication introduced by yesterday's fix. + +2004-12-11 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/copy-visible.scm: Apply the layer mask + when copying a single layer with a layer mask. Fixes bug #138662. + + * plug-ins/script-fu/scripts/t-o-p-logo.scm: Removed ' character. + +2004-12-11 Sven Neumann <sven@gimp.org> + + * INSTALL + * NEWS + * README: updates for the GIMP 2.2.0 release. + +2004-12-11 Sven Neumann <sven@gimp.org> + + * plug-ins/common/unsharp.c: got rid of a global variable. + + * plug-ins/common/bumpmap.c (dialog_bumpmap_callback): more changes + to restore the gimp-2.0 behaviour. + +2004-12-11 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable-preview.[ch]: added new function + gimp_drawable_get_sub_preview() which returns a scaled preview of + a part of a drawable. + + (gimp_drawable_preview_scale): made it work with srcPR.x and + srcPR.y being != 0. + + * app/core/gimpimage-preview.c (gimp_image_get_new_preview) + * app/widgets/gimpviewrendererdrawable.c + (gimp_view_renderer_drawable_render): if the area of the drawable + preview is more than 4 times larger than the drawable itself (evil + heuristic, but seems to work fine), use above function to get a + sub-preview of the drawable instead of getting an insanely large + preview of the whole drawable just to use a small part of it. + Fixes bug #142074. + + * app/core/gimpimage-preview.c (gimp_image_get_new_preview): + optimized by skipping layers which do not intersect with the + canvas. + +2004-12-11 Sven Neumann <sven@gimp.org> + + * plug-ins/common/bumpmap.c (dialog_bumpmap_callback): do actually + change the bumpmap drawable. Fixes bug #160985, hopefully without + reopening bug #158494. + +2004-12-11 Sven Neumann <sven@gimp.org> + + * configure.in: set version to 2.2.0. + + * tools/Makefile.am + * tools/authorsgen/Makefile.am + * tools/authorsgen/authorsgen.pl + * tools/authorsgen/contributors: removed authorsgen, a perl script + that used to be used to create AUTHORS and authors.h. + + * Makefile.am + * authors.dtd + * authors.xml: added a simple XML file that lists authors and + contributors and a DTD to validate it. + + * authors.xsl: a stylesheet to generate AUTHORS from authors.xml. + + * app/dialogs/Makefile.am + * app/dialogs/authors.xsl: a stylesheet to generate authors.h from + authors.xml. + + * app/dialogs/authors.h: regenerated. + + * app/dialogs/about-dialog.c: added a const modifier. + +2004-12-09 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/widgets/gimphistogrameditor.c: make histogram editor, + and therefore histogram dialog, use the selection. Should + resolve bug #72959. + + * app/core/gimpdrawable-histogram.h: remove trailing whitespace. + +2004-12-10 Manish Singh <yosh@gimp.org> + + * app/widgets/gimpdatafactoryview.c + * app/widgets/gimpitemtreeview.c: #include <string.h> for strcmp() + +2004-12-10 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdatafactoryview.c + (gimp_data_factory_view_tree_name_edited) + * app/widgets/gimpitemtreeview.c + (gimp_item_tree_view_name_edited) + * app/widgets/gimptemplateview.c + (gimp_template_view_tree_name_edited): call gimp_object_set_name() + or gimp_item_rename() only if the item's name has actually changed + and restore the old text otherwise. Fixes one instance of "name is + not updated correctly after editing" for which I blamed GTK+ in + bug #145463 :-) The other instances should be fixed in GTK+ HEAD + and are imho unfixable with GTK+ 2.4. + +2004-12-10 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainertreeview.c + (gimp_container_tree_view_clear_items): clear all viewable cell + renderers so they don't keep pointers to layers/masks which don't + exist any more. Fixes the additional problem in bug #148852 but + not the bug itself. + +2004-12-09 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/core/gimpbrushpipe.c (gimp_brush_pipe_select_brush): + Don't initialize a new random number generator every time a brush + is selected from a pipe. Fixes bug #148205). + +2004-12-09 DindinX <dindinx@gimp.org> + + * plug-ins/common/cartoon.c: marked the menu entry for translation + (reported by Zigomar) + +2004-12-09 Michael Natterer <mitch@gimp.org> + + * app/dialogs/print-size-dialog.c + * app/widgets/gimpsizebox.c: set a focus_chain on the size_entries + so the focus order is width->height->chain->unitmenu and not + width->chain->height->unitmenu. + + * app/widgets/gimptemplateeditor.c: changed focus_chain code to + work like above (cosmetics). + +2004-12-09 Sven Neumann <sven@gimp.org> + + * app/gui/splash.c (splash_update): only expose the area of the + window that actually changed. + + * app/plug-in/plug-in-rc.c (plug_in_rc_write): changed the header + and footer to be more in line with the other rc files. + +2004-12-08 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/dialogs/print-size-dialog.c (print_size_dialog_size_changed): + Previous fix only worked if units were inches -- now seems to + work for all units. (fixes #159273 ?) + +2004-12-08 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/randomize.c: Changed algorithm for Pick and + Slur to treat all channels within a pixel in the same way; + intended to fix bug #72852. + +2004-12-08 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/dialogs/print-size-dialog.c (print_size_dialog_size_changed): + fixed kludgy use of size entry, seems to fix bug #159273. + +2004-12-08 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpuimanager.[ch]: renamed + gimp_ui_manager_get_action() to gimp_ui_manager_find_action(). + + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimppaletteeditor.c + * app/widgets/gimptoolbox.c + * app/widgets/gimptooloptionseditor.c + * app/display/gimpdisplayshell-close.c: changed accordingly. + + (this change is quite useless as it stands, but will help keeping + the diff between 2.2 and 2.3 small as soon as we're branched). + + * app/widgets/gimpcolormapeditor.c + (gimp_colormap_preview_button_press): invoke the "edit-color", not + "new-color" action upon double click. + + (palette_editor_select_entry): update the ui manager after + selecting the entry so the entry-specific actions become sensitive + if there was no entry selected before. + +2004-12-08 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimppropwidgets.[ch]: added new prop_widget + gimp_prop_int_combo_box_new() which takes a pre-built GimpIntStore + and allows to create views on int properties with arbitrary sets + of values (not just enums). + + * app/widgets/gimpcontrollereditor.c + (gimp_controller_editor_constructor): added support for generic + combo boxes controlled exclusively by controller properties: if an + int property "foo" is followed by an object property "foo-values" + and the contained object is a GimpIntStore, use that store as + model for selecting "foo"'s values using + gimp_prop_int_combo_box_new(). + + (Allows for more flexible controller configuration, the actual use + case in the midi controller is still work in progress). + +2004-12-06 Sven Neumann <sven@gimp.org> + + * tools/authorsgen/contributors: removed duplicate entry for Roman. + + * AUTHORS + * app/dialogs/authors.h: regenerated. + +2004-12-06 Roman Joost <romanofski@gimp.org> + + * tools/authorsgen/contributors: added Róman Joost to + contributors + +2004-12-06 Michael Natterer <mitch@gimp.org> + + * app/tools/gimptransformtool.c: applied patch from Sven Neumann + which removes code that prevents layers with mask from being + transformed. + + * app/tools/gimptransformtool.[ch]: added "gboolean mask_empty" + parameter to GimpTransformTool::transform(). Needed because the + selection gets cleared by cutting from the drawable and we need + the selection's state before that cutting. + + (gimp_transform_tool_doit): pass "mask_empty" to + GimpTransformTool::transform(): + + * app/tools/gimptransformtool.c (gimp_transform_tool_real_transform) + * app/tools/gimpfliptool.c (gimp_flip_tool_transform): when + transforming a layer with mask and there is no selection, + transform the mask just as if it was a linked item. + Fixes bug #143837 and bug #159697. + +2004-12-05 Sven Neumann <sven@gimp.org> + + * app/core/gimp-transform-utils.c (gimp_transform_matrix_flip_free): + applied patch from Joao S. O. Bueno that fixes bug #160339. + +2004-12-05 Sven Neumann <sven@gimp.org> + + * plug-ins/help/domain.c + * plug-ins/help/gimp-help-lookup.c + * plug-ins/help/help.[ch]: if the help files are not installed, + uninstall the temporary procedure and quit. Fixes bug #160258. + +2004-12-05 Sven Neumann <sven@gimp.org> + + * plug-ins/common/lic.c: applied patch from Joao S. O. Bueno that + sets a lower limit for the filter length (bug #160121). The patch + also makes the plug-in work on drawables with alpha channel. + +2004-12-05 Sven Neumann <sven@gimp.org> + + * plug-ins/common/wmf.c: applied patch from Karine Proot that + limits the size of the preview in the WMF loader (bug #133521). + +2004-12-04 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-arc.c + * plug-ins/gfig/gfig-arc.h + * plug-ins/gfig/gfig-bezier.c + * plug-ins/gfig/gfig-bezier.h + * plug-ins/gfig/gfig-circle.c + * plug-ins/gfig/gfig-circle.h + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-dobject.h + * plug-ins/gfig/gfig-ellipse.c + * plug-ins/gfig/gfig-ellipse.h + * plug-ins/gfig/gfig-line.c + * plug-ins/gfig/gfig-line.h + * plug-ins/gfig/gfig-poly.c + * plug-ins/gfig/gfig-poly.h + * plug-ins/gfig/gfig-preview.c + * plug-ins/gfig/gfig-spiral.c + * plug-ins/gfig/gfig-spiral.h + * plug-ins/gfig/gfig-star.c + * plug-ins/gfig/gfig-star.h: updating a object is now a virtual + function. + +2004-12-03 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage-undo-push.c (undo_pop_layer): when removing + the floating selection, call gimp_drawable_invalidate_boundary() + *before* setting gimage->floating_sel to NULL because otherwise + gimp_display_shell_selection_invis() won't clear the correct + selection bounds and leave garbage on screen. Fixes bug #160247. + +2004-12-02 Michael Natterer <mitch@gimp.org> + + * app/actions/tool-options-actions.c + (tool_options_actions_update_presets): don't forget to initialize + the "value_variable" boolean of GimpEnumActionEntry. Fixes myriads + of warnings about wrong values for boolean properties. + + * app/actions/file-actions.c (file_actions_setup): same + here. Fixes nothing but is cleaner. + +2004-12-02 Simon Budig <simon@gimp.org> + + * app/vectors/gimpvectors.c: Fixed stupid typo that caused + distorted vectors on scaling after resizing. Spotted by + Joao S. O. Bueno. + + Fixes bug #157852. + +2004-12-01 Sven Neumann <sven@gimp.org> + + * autogen.sh: rephrased the warning that is shown when the + intltool check fails. + +2004-12-01 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpuimanager.c (gimp_ui_manager_ui_get): improved + error message about missing XML files. + +2004-12-01 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-appearance.c + * app/display/gimpdisplayshell.c + * app/widgets/gimpdockable.c + * app/widgets/gimptexteditor.c + * app/widgets/gimptoolbox.c: check if gimp_ui_manager_ui_get() + actually returns something. Prevents crashes caused by missing + ui manager xml files. Fixes bug #159346. + +2004-12-01 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimptoolview.c (gimp_tool_view_select_item): no need + to update the ui manager here, the parent class already does it. + +2004-11-30 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/README: removed some very obsolete stuff. + + * plug-ins/gfig/gfig-arc.c + * plug-ins/gfig/gfig-arc.h + * plug-ins/gfig/gfig-bezier.c + * plug-ins/gfig/gfig-bezier.h + * plug-ins/gfig/gfig-circle.c + * plug-ins/gfig/gfig-circle.h + * plug-ins/gfig/gfig-dobject.c: small cleanups + +2004-11-30 Michael Natterer <mitch@gimp.org> + + * app/gui/themes.c (themes_init): use gtk_rc_parse() instead of + gtk_rc_add_default_file() to add ~/.gimp-2.2/themerc to the list + of files parsed by GTK+ because the latter works only before + gtk_init(). Fixes bug #155963. + +2004-11-30 Michael Natterer <mitch@gimp.org> + + * app/dialogs/print-size-dialog.c: reordered prototypes to match + order of implementations. + +2004-11-30 Sven Neumann <sven@gimp.org> + + * app/sanity.c: we check for the same version of freetype on all + platforms, no need for an ifdef here. + +2004-11-30 Sven Neumann <sven@gimp.org> + + * libgimp/gimpexport.c: some more HIG-ification tweaks to the + Export dialogs. + +2004-11-30 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpactiongroup.c + (gimp_action_group_set_action_color) + (gimp_action_group_set_action_color): allow to set color and + viewable to NULL, GimpAction handles this nicely. Fixes warnings + some foo_actions_update() functions were triggering. + +2004-11-30 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/*[ch]: code cleanup + +2004-11-29 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/display.pdb: make it work as documented (fail + if the new_image already has a display). Also fail if the + old_image doesn't have any display (changed docs accordingly). + On success, take over the initial reference count of the new + image, just as the gimp_display_new() PDB wrapper does. + Fixes bug #159051. + + * app/pdb/display_cmds.c + * libgimp/gimpdisplay_pdb.c: regenerated. + +2004-11-29 Sven Neumann <sven@gimp.org> + + * app/file/file-save.c (file_save_as): when the image filename + changes, forget the filename that was last used with "save-a-copy". + +2004-11-29 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback): + change the "update" property and notify listeners (in particular + GimpDrawablePreview) before invalidating the preview. Plug-ins + might (needlessly) look at the property to decide whether they + need to redraw. Fixes bug #159816. + + * plug-ins/common/unsharp.c (preview_update): no need to look at + the value of the "Preview" toggle. GimpPreview takes care this. + +2004-11-29 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: issue a repaint after the + "show previous", "show next" and "show all" callbacks. + + * plug-ins/gfig/gfig-style.c: fixed some comments. + +2004-11-29 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_preview.c + * plug-ins/imagemap/imap_selection.c: undeprecated. + +2004-11-28 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dobject.c: copy the style of the object when + pushing it to the undo stack, so undoing works as expected. + +2004-11-28 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-style.c + * plug-ins/gfig/gfig-style.h: create a new function to get the current + style instead of using a global pointer for this + (gfig_context_get_current_style ()) + + * plug-ins/gfig/gfig-circle.c + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig.h: use this function everywhere it is needed. And + remove the current_style field from GfigContext. + + (unrelated): + * plug-ins/FractalExplorer/Dialogs.h + * plug-ins/FractalExplorer/FractalExplorer.c: small cleanups + +2004-11-28 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-style.[ch] + * plug-ins/gfig/gfig.h: removed unused stack of styles. Removed + gimp_style from GFigContext. + +2004-11-28 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig.c (run): push a context for GFig. + +2004-11-28 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.[ch] + * plug-ins/gfig/gfig-dobject.c: renamed undo_water_mark to undo_level. + Fixed the style handling when clearing the whole thing and undoing in + some very particular cases. The undo part should certainly be redone + to some extent. + + Btw, this is the revision 1.10000 of the ChangeLog, yeah! + +2004-11-28 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/gfig/gfig-style.c: make sure PaintType is saved and + loaded with the style. + +2004-11-28 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: correctly initializes the paint_type + field of the default style. + + * plug-ins/gfig/gfig-style.c: don't print an useless error message + where no-one can see it when loading an other with no style but use + the default style instead. + +2004-11-28 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.[ch] + * plug-ins/gfig/gfig-dobject.c: moved Undo and Clear to the Edit + menu. Added a utility function to set the sensitivity of an action + by name. Cleaned up action callbacks. + + * plug-ins/gfig/gfig-style.c: minor cleanup. + +2004-11-28 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-arc.c + * plug-ins/gfig/gfig-bezier.c + * plug-ins/gfig/gfig-circle.c + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-ellipse.c + * plug-ins/gfig/gfig-line.c + * plug-ins/gfig/gfig-poly.c + * plug-ins/gfig/gfig-spiral.c + * plug-ins/gfig/gfig-star.c: made the class name uppercase since it is + used to parse a gfig file. + +2004-11-28 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: make sure that widgets in the Grid + and Preferences dialogs are only accessed while the dialogs exist. + +2004-11-28 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: made the Grid and Preferences + dialogs singletons and declared them as transient to the GFig + window. Don't let them run their own main loop. + +2004-11-28 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: added a Close menu item to the + menubar. Removed help buttons from popup dialogs. Set the same + default directory in load and save filechoosers. + +2004-11-27 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/pdb/drawable_transform.pdb: escape utf8 as hex, to + avoid perl trying to be so smart that it's stupid. + + * app/pdb/drawable_transform_cmds.c: regenerated. + +2004-11-27 Manish Singh <yosh@gimp.org> + + * plug-ins/common/jpeg.c (save_image): thumbnail buffer variable + declarations should be guarded under HAVE_EXIF. + +2004-11-27 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/plug-ins/colorxhtml.py: s/colorhtml/colorxhtml/, + so it doesn't clash with the perl version. + + * plug-ins/pygimp/plug-ins/Makefile.am: reflect filename change. + +2004-11-27 Sven Neumann <sven@gimp.org> + + * plug-ins/common/jpeg.c: delay the creation of the display for + the export image preview until the user requests a preview. Fixes + bug #159376. + +2004-11-27 Øyvind Kolås <pippin@gimp.org> + + * libgimp/gimpexport.c: minor layout adjustments for HIG compliance. + +2004-11-27 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/spyrogimp.scm: Force number of teeth + to be integer values. Changed default for Outer teeth to give a + more interesting image. Detabified file. Fixes bug #158448. + +2004-11-27 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc): + don't look at the menu path to determine if the script is + image-based. Instead look at the number of parameters we are being + called with. + +2004-11-27 Sven Neumann <sven@gimp.org> + + * app/tools/gimpinkoptions-gui.c: made the Size scale logarithmic + as suggested in bug #159632. + +2004-11-27 Sven Neumann <sven@gimp.org> + + * plug-ins/common/tiff.c (save_image): tell the user that we can't + handle indexed images with alpha channel (bug #159600). + +2004-11-27 Sven Neumann <sven@gimp.org> + + * app/main.c + * app/widgets/gimpenumstore.h + * app/widgets/gimpunitstore.c + * plug-ins/common/retinex.c: applied patch by Tim Mooney that + removes extraneous ; + +2004-11-27 Sven Neumann <sven@gimp.org> + + * plug-ins/common/wmf.c (run): applied patch by Tim Mooney that + increase the size of values[] to accomodate the use of + file_wmf_load_thumb (bug #159601). + +2004-11-27 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/drawable.pdb: minor change to the PDB docs. + + * libgimp/gimpdrawable_pdb.c + * tools/pdbgen/pdb/drawable.pdb: regenerated. + +2004-11-27 Sven Neumann <sven@gimp.org> + + * plug-ins/winicon/icosave.c + * plug-ins/winicon/main.[ch]: moved code around. + +2004-11-26 Manish Singh <yosh@gimp.org> + + * plug-ins/common/dog.c: make sure the preview image type matches + the source image type. + +2004-11-26 Sven Neumann <sven@gimp.org> + + * plug-ins/winicon/icosave.c: don't fiddle with the source image, + a save plug-in should save, nothing else. + + * plug-ins/winicon/main.[ch]: handle all sorts of image types. + Fixes bug #157803. + +2004-11-26 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/drawable.pdb: fixed docs for + gimp_drawable_type_with_alpha(). + + * app/pdb/drawable_cmds.c + * libgimp/gimpdrawable_pdb.c: regenerated. + +2004-11-26 Sven Neumann <sven@gimp.org> + + * plug-ins/winicon/main.[ch] (ico_image_get_reduced_buf) + * plug-ins/winicon/icodialog.c + * plug-ins/winicon/icoload.c + * plug-ins/winicon/icosave.c: fixed drawable handling. This + plug-in is still a complete mess and needs a lot more work. + +2004-11-26 Sven Neumann <sven@gimp.org> + + * app/tools/gimppaintoptions-gui.c (gimp_paint_options_gui): only + show the Incremental toggle for tools that use it (bug #159306). + +2004-11-26 Sven Neumann <sven@gimp.org> + + * app/core/gimpdocumentlist.c (gimp_document_list_deserialize): + don't add documents w/o a name to the list. Fixes bug #159510. + + * app/core/gimpdrawable.c (gimp_drawable_resize): extended the + check to take the offsets into account as well. + +2004-11-25 Manish Singh <yosh@gimp.org> + + * plug-ins/common/dog.c: Add the temporary layers to the image, so + things work. Fixes bug #158895. + + * plug-ins/common/iwarp.c: Fix same naughtiness as above. There's + other naughtiness still though. + + * plug-ins/common/sunras.c: use gboolean for byte2bit invert argument. + +2004-11-25 Manish Singh <yosh@gimp.org> + + * plug-ins/common/jpeg.c: Use a jpeg_error_mgr that lives within + PreviewPersistent, instead of an automatic variable in save_image. + Fixes bug #159076. + +2004-11-25 Simon Budig <simon@gimp.org> + + * modules/controller_linux_input.c: Add some sample code to retrieve + the name of the connected MIDI device (ALSA). + Do not set the "name" when connected to Alsa, since snd_seq_name() + returns an uninteresting name. + +2004-11-24 Michael Natterer <mitch@gimp.org> + + * app/gui/gui.c (gui_display_changed): if the active display + becomes NULL (e.g. by closing a view), don't leave the user + context with an image but no display. Instead, try to find another + display of the same image and if that fails set the image to NULL. + + Prevents the various foo_actions_update() functions from being + called with a NULL display while there is still an active image in + the context. + + Fixes bug #159304. + + (Removed #warning about being misplaced from that function because + it's a typical piece of ugly glue code that belongs exactly here). + +2004-11-24 Simon Budig <simon@gimp.org> + + * modules/controller_linux_input.c: Accept >= 0 return values of the + ioctl() to figure out the device name. Apparently it is the number of + bytes written to the string, so we might omit the strlen() following, + but I don't like to rely on that... + +2004-11-24 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcontroller.[ch]: guarded the whole header + with GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION because it's no + fixed API yet. Added a "state" property bacause "name" was abused + as the controller's state. Added "help_domain" to the controller + class. + + * libgimpwidgets/gimpwidgets.h: don't include gimpcontroller.h + + * modules/controller_linux_input.c + * modules/controller_midi.c: set the "name" property to the name + retrieved from the device, or to a default string if no name is + available. Store the status in the "state" property. Added and + changed some strings, but it's better to have the controller + strings untranslated than to have no tooltips at all or misleading + labels. + + * app/widgets/gimpcontrollerkeyboard.c + * app/widgets/gimpcontrollerwheel.c: set default strings for both. + + * app/widgets/gimpcontrollereditor.c: added a GUI for the "state" + property. + + * app/widgets/gimpcontrollerkeyboard.h + * app/widgets/gimpcontrollerwheel.h + * app/widgets/gimpcontrollerinfo.c + * app/widgets/gimpcontrollers.c: #define + GIMP_ENABLE_CONTROLLER_UNDER_CONSTRUCTION (just as in all files + above). + + * app/widgets/gimphelp-ids.h: added the IDs of all controller + modules and also of all other modules. The defines are not + actually used, but this file is the canonical place to collect all + the core's help IDs. + +2004-11-23 Sven Neumann <sven@gimp.org> + + * app/core/gimp-templates.[ch] + * app/dialogs/user-install-dialog.c: merge the migrated user + templaterc with the system templaterc so the users who have used + gimp-2.0 before get our changes to the default templates. + +2004-11-23 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpwidgets-utils.[ch]: added new function + gimp_toggle_button_set_visible() which can be used as "toggled" + callback on a GtkToggleButton and sets a widget (in)visible + according to the toggle's "active" state. + + * app/tools/gimpblendoptions.c + * app/tools/gimppaintoptions-gui.c + * app/tools/gimpselectionoptions.c: use it to hide (rather than + just insensitize) the seldomly used "Feather edges", "Autoshrink + selection", "Adaptive supersampling", "Fade out" and "Use color + from gradient" widgets when their enabling toggle is unchecked. + Makes the affected tool options much less crowded and noisy in + their default appearance. Fixes bug #159008. + +2004-11-23 Michael Natterer <mitch@gimp.org> + + * app/menus/plug-in-menus.c (plug_in_menus_add_proc): create + dynamic sub-menus using a separate, ui-manager-global merge_id + instead of the procedure's merge_id. Has the effect that the ui + manager keeps around these sub-menus forever, even if the + procedure that initially registered them is unregistered. + Fixes menu ordering after Script-Fu->Refresh. + +2004-11-23 Michael Natterer <mitch@gimp.org> + + * app/core/gimpparasitelist.c: cosmetics, untabified. + + * libgimpbase/gimpparasiteio.[ch]: added g_return_if_fail()'s + to all functions. + + (gimp_pixpipe_params_parse): changed "gchar*" param to "const + gchar*" (sortof API change, but these files are most probably only + used by GIMP itself). Still uses strtok() on the internal copy, + but at least not on the passed string. + + * plug-ins/common/csource.c + * plug-ins/common/gif.c + * plug-ins/common/gih.c + * plug-ins/common/jpeg.c + * plug-ins/common/png.c + * plug-ins/common/tiff.c: use parasite getters instead of + accessing the scruct members directly. Always use g_strndup() + instead of just g_strdup() to get strings stored in parasites + because there is no guarantee that they are nul-terminated. + +2004-11-23 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_file.c (do_file_save_as_dialog): do + actually use a save dialog here. Fixes bug #159194. + +2004-11-23 Sven Neumann <sven@gimp.org> + + * app/core/gimpdrawable.c (gimp_drawable_resize): do nothing if + the size doesn't change. This keeps text layers from being + modified when an image is cropped and the layer is entirely inside + the cropped area. + + * menus/image-menu.xml.in: put the Quit item back for now. We + should think about this again in the next development cycle. + +2004-11-22 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/copy-visible.scm: Fixed incorrect + comparison in if statement. Partial(?) fix for bug #138662. + +2004-11-22 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/Makefile.am + * plug-ins/pygimp/pygimp-logo.png: New pygimp logo, by Carol Spears. + + * plug-ins/pygimp/gimpfu.py: Use new external logo file, some layout + tweaks. + +2004-11-22 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontrollerinfo.c (gimp_controller_info_init): + always create the event mapping table. Fixes tons of warnings and + non-functional controller mapping dialog when an empty controller + was deserialized from controllerrc. Spotted by drc. + +2004-11-22 Sven Neumann <sven@gimp.org> + + * app/app_procs.c (app_exit_after_callback): call base_exit() + before quitting the application using exit(). Fixes bug #159019. + + * app/base/tile-swap.c: moved the warning about a non-empty swap + file into #ifdef GIMP_UNSTABLE ... #endif. + +2004-11-22 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: correctly initialize the Antialising + check box. Reported by Zigomar. + +2004-11-22 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.c: sort the SFMenu structs + by their menu_paths *and* the procedure's menu_labels. Fixes menu + item sorting after "Refresh". + +2004-11-22 Michael Natterer <mitch@gimp.org> + + * app/tools/gimptextoptions.[ch] (gimp_text_options_editor_new): + added a "menu_factory" parameter instead of trying to get it from + the toplevel GimpDock (which does not exists if the tool options + dialog does not exist). Fixes bug #159071. + + * app/tools/gimptexttool.c (gimp_text_tool_editor): pass the + menu_factory. + + * app/dialogs/dialogs.c (dialogs_init): pass the global menu + factory also when constructing the "toplevel" dialog factory so + the above works. + +2004-11-22 Michael Natterer <mitch@gimp.org> + + * libgimpbase/gimputils.c (gimp_any_to_utf8): use g_strndup() + instead of g_strdup() if a length was passed. + + * app/dialogs/info-window.c: g_strndup() the comment parasite's + data and pass -1 as length to gimp_any_to_utf8() so we don't + encounter the questionable (buggy?) behavior of g_utf8_validate() + to fail upon finding '\0' within the "length" passed. + Fixes bug #159051. + +2004-11-22 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/struc.c: applied patch from Wolfgang Hofer + which makes the plug-in use its procedure name for + storing the "last_vals" struct. Fixes bug #159028. + + * plug-ins/common/tileit.c: ditto. Fixes bug #159029. + +2004-11-22 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-line.c: fixed a stupid bug which made all lines + half-selected. + +2004-11-22 Sven Neumann <sven@gimp.org> + + * app/dialogs/file-open-location-dialog.c: changed border-size of + GimpContainerEntry to 0. + +2004-11-21 Sven Neumann <sven@gimp.org> + + * tools/gimp-remote.c: added --no-splash command-line option that + is passed to gimp. Addresses Debian bug report #277989. + + * docs/gimp-remote.1.in: document the new option. + +2004-11-21 Manish Singh <yosh@gimp.org> + + * configure.in: reverted previous change, as not all the lv.pos are + in CVS yet. + +2004-11-21 Peteris Krisjanis <pecisk@gmail.com> + + * configure.in: Added Latvian (lv) language support to ALL_LINGUAS. + +2004-11-21 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/erase-rows.scm: Applied patch from BM + which makes the script work layers that have their top-left corner + at a position other than the top-left corner of the image. + Fixes bug #158863. + +2004-11-21 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-arc.c + * plug-ins/gfig/gfig-bezier.c + * plug-ins/gfig/gfig-circle.c + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-ellipse.c + * plug-ins/gfig/gfig-line.c + * plug-ins/gfig/gfig-poly.c + * plug-ins/gfig/gfig-spiral.c + * plug-ins/gfig/gfig-star.c + * plug-ins/gfig/gfig.h: makes which object is selected more obvious by + using filled handles for the selected object. Not perfect, but + certainly a good hint. + +2004-11-21 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-preview.c: call gfig_grid_colours() in the + realize callback of the preview, so the gray gc of the grid works + again. Reported by Zigomar. + + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-preview.h + * plug-ins/gfig/gfig-spiral.h + * plug-ins/gfig/gfig-star.h + * plug-ins/gfig/notes.txt: small cosmetics fixes. + +2004-11-21 Sven Neumann <sven@gimp.org> + + * plug-ins/common/compose.c + * plug-ins/common/decompose.c: transfer the image resolution to + newly created images. + +2004-11-21 Sven Neumann <sven@gimp.org> + + * plug-ins/gimpressionist/Brushes/snow1.pgm: reverted a change + that Hans Breuer committed here, probably accidentally. + + * plug-ins/script-fu/script-fu.c + * plug-ins/script-fu/siod-wrapper.c: reverted Hans's changes. There + is indeed a Script-Fu server on Win32. + +2004-11-21 Sven Neumann <sven@gimp.org> + + * menus/image-menu.xml.in: removed "Quit" from the image menu. + +2004-09-21 Hans Breuer <hans@breuer.org> + + * app/dialogs/makefile.msc : [new file] + app/dialogs/Makefile.am : added to EXTRA_DIST + + * **/makefile.msc app/gimpcore.def : updated + + * app/gimp.rc : let wilber be first + + * app/widgets/gimppropwidgets.c : msvc6 can't cast uint64 either + + * libgimpbase/gimpwin32-io.h : make up recent loss of ftruncate in GLib + + * libgimpthumbnail/gimpthumbnail.c : <process.h> for getpid() on win32 + + * plug-ins/helpbrowser/dialog.c : include gimpwin32-io.h + + * plug-ins/script-fu/siodwrapper.c plug-ins/script-fu/script-fu.c : + there is no script-fu-server on win32 + +2004-11-21 Michael Schumacher <schumaml@cvs.gnome.org> + + * plug-ins/script-fu/scripts/addborder.scm: first resize the + image, then add the border layer and then fill it + +2004-11-20 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/script-fu-scripts.c: Need to call gettext in + script-fu_menu_compare. Spotted by Sven. Removed obsolete #define's. + +2004-11-20 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.c: renamed variable + "script_list" to "script_tree" because it's a GTree. + + (script_fu_remove_script): g_list_free() the right list (don't + leak all lists of scripts at the tree leaves). + +2004-11-20 Sven Neumann <sven@gimp.org> + + * Made 2.2-pre2 release. + +2004-11-20 Sven Neumann <sven@gimp.org> + + * plug-ins/common/glob.c: added an (optional) parameter that + allows to request the output in the filesystem encoding. + +2004-11-19 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.c (script_fu_menu_compare): + compare the menu paths, not the struct pointers. + +2004-11-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/glob.c: added a naive glob() implementation + which handles the most common use case and is certainly better + than nothing. Closes bug #143661 again. + +2004-11-19 Sven Neumann <sven@gimp.org> + + * libgimp/gimp.c: converted a g_warning() to g_printerr(). + +2004-11-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/xpm.c: just some minor code cleanup. + +2004-11-19 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-style.c: combined two "Stroke" labels into a + single one. + +2004-11-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/noisify.c: applied a (modified) patch that adds + the possibility to correlate the noise with the signal. Adds the + new PDB procedure "plug_in_scatter_rgb". Fixes bug #158700. + + * plug-ins/helpbrowser/dialog.c: set a reasonable default size. + +2004-11-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/postscript.c (skip_ps) (ps_close): fixed use of + fread(). Unfortunately this slowed down the plug-in again. + Disabled the code that reads the pipe to the end. This brings it + back to speed. Seems to work fine for me, let's see if this causes + problems for anyone... + +2004-11-19 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/selection-round.scm: moved into the + <Image>/Select/Modify menu now that we can safely use placeholders + from Script-Fu. + +2004-11-19 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/lib.pl + * tools/pdbgen/stddefs.pdb: added support for deprecated procedures + without any replacement. + + * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): added + a special warning for procedures without replacement. + + * tools/pdbgen/pdb/drawable.pdb: deprecated drawable_set_image() + without any replacement and made it a nop (which fails if the + passed image is different from the drawable's image). It's not + needed any longer since 2.0 and moreover dangerous to use. + + * app/pdb/drawable_cmds.c + * libgimp/gimpdrawable_pdb.[ch]: regenerated. + + * app/core/gimpitem.c (gimp_item_set_image): replaced assertion + for gimp_item_is_floating() by !gimp_item_is_attached(). The + former warned when adding a layer with already added mask to the + image (which is a perfectly valid operation). + +2004-11-18 Sven Neumann <sven@gimp.org> + + * plug-ins/common/wmf.c: added a thumbnail load procedure + (bug #158193). + +2004-11-18 Michael Natterer <mitch@gimp.org> + + Script-Fu string cleanup/simplification: apply the same fix for + menu path translation that was done for plug-ins a while ago. + + * plug-ins/script-fu/script-fu.c (script_fu_auxillary_init): use + gimp_plugin_menu_register() on the "Refresh" temp_proc. + + * plug-ins/script-fu/scripts/*.scm: ported all scripts to use + script-fu-menu-register and pass just the menu label in + script-fu-register. Cleaned up all register calls to share a + somewhat similar formatting. + +2004-11-18 Sven Neumann <sven@gimp.org> + + * plug-ins/common/postscript.c: changed the default to load only + the first page of the document and added a tooltip describing how + to specify what pages to get. + +2004-11-18 Sven Neumann <sven@gimp.org> + + * app/file/file-open.c (file_open_thumbnail): fixed check for + number of return values. + +2004-11-18 Sven Neumann <sven@gimp.org> + + * plug-ins/common/postscript.c: speed up loading of multi-page + documents significantly by skipping in large chunks instead of using + fgetc() to crawl through the stream. + +2004-11-18 Sven Neumann <sven@gimp.org> + + * app/file/file-open.c (file_open_thumbnail): check the number of + return values. Only retrieve width and height if the thumbnail + load procedure does actually provide this information. + + * plug-ins/common/postscript.c: added a procedure to load a + thumbnail. For now it only renders the first page of the + document at low resolution. It should be extended to load an + embedded thumbnail if one is available. + + * plug-ins/common/jpeg.c + * plug-ins/common/svg.c: no need to register a menu label for the + thumbnail loaders. Allocate the return_vals array large enough to + hold all return values. + +2004-11-18 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpenumaction.[ch]: added boolean property + "value-variable" which specifies if the GimpEnumAction::selected() + signal may be emitted with arbirtary values (value-variable = TRUE) + or *only* with enum_action->value (value-variable = FALSE). + + * app/widgets/gimpactiongroup.[ch]: added "gboolean + value_variable" to GimpEnumActionEntry and set it in + gimp_action_group_add_enum_actions(). + + * app/actions/channels-actions.c + * app/actions/colormap-editor-actions.c + * app/actions/context-actions.c + * app/actions/drawable-actions.c + * app/actions/edit-actions.c + * app/actions/error-console-actions.c + * app/actions/gradient-editor-actions.c + * app/actions/image-actions.c + * app/actions/layers-actions.c + * app/actions/palette-editor-actions.c + * app/actions/plug-in-actions.c + * app/actions/vectors-actions.c + * app/actions/view-actions.c: set "variable" to FALSE for all enum + actions except those which are used with the GIMP_ACTION_SELECT_SET + voodoo. + + * app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped): + fall back to gtk_action_activate() if the action specified in a + GIMP_CONTROLLER_EVENT_VALUE mapping is not variable. Enables + triggering of enum actions from GIMP_CONTROLLER_EVENT_VALUE events + (like midi note-on and note-off). + +2004-11-18 Michael Natterer <mitch@gimp.org> + + * acinclude.m4: pasted the complete alsa.m4 so compiling from + CVS doesn't require alsa.m4 to be installed. + + * configure.in: check for alsa >= 1.0.0 and define HAVE_ALSA + if found. + + * modules/Makefile.am: build controller_midi with ALSA_CFLAGS + and ALSA_LIBS. + + * modules/controller_midi.c: s/HAVE_ALSALIB_H/HAVE_ALSA/. + +2004-11-18 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/compressor.c (compressors): added back the + .xcf.gz and .xcf.bz2 extensions because they are the only way + to figure the special nature of this plug-in's extensions. + + * app/widgets/gimpfileprocview.[ch]: keep a list of "meta + extensions" (extensions which have a '.' themselves). + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed): + try to replace the whole extension if the last extension is one of + the meta extensions kept by GimpFileProcView. Fixes bug #158377. + +2004-11-18 Sven Neumann <sven@gimp.org> + + * plug-ins/maze/maze.[ch] + * plug-ins/maze/maze_face.c: removed the extra help button from + the Maze plug-in. Fixes bug #158605. + +2004-11-18 Michael Natterer <mitch@gimp.org> + + The following fixes have no visible effect because nobody + uses gimp_plugin_menu_register() on temp_procs yet: + + * app/actions/plug-in-actions.[ch]: added + plug_in_actions_add_path() which just adds the actions needed for + a given menu math, but not the procedure action itself. + + * app/gui/gui-vtable.c (gui_menus_create_entry): create the + menu_path's actions using above function so adding of submenus to + existing ui managers works. + + * tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register_invoker): + don't add a menu if "no_interface" is TRUE. + + * app/pdb/plug_in_cmds.c: regenerated. + + * plug-ins/script-fu/script-fu-scripts.c: pass untranslated + menu_paths to the core, not translated ones. Don't store the + scripts directly in the "script_list" tree but use a list of + scripts per key because there can be identical keys for different + scripts now. Fixed sorting of menu entries and menus. + +2004-11-18 Simon Budig <simon@gimp.org> + + * modules/controller_midi.c: implemented support for ALSA-midi, + currently disabled. Needs a configure-check and proper linking + against libasound. + +2004-11-17 Dave Neary <bolsh@gimp.org> + + * plug-ins/common/bumpmap.c: Fixed initialisation issue + that was crashing the plug-in on repeat runs. Fixes bug + #158494. + +2004-11-17 Sven Neumann <sven@gimp.org> + + * app/dialogs/print-size-dialog.c: added missing callbacks for the + size entries. Needs some more work though... + +2004-11-17 Manish Singh <yosh@gimp.org> + + * plug-ins/dbbrowser/Makefile.am: make libgimpprocbrowser a libtooled + library. + + * plug-ins/dbbrowser/gimpprocbrowser.[ch]: add a user_data pointer + for GimpProcBrowserApplyCallback. + + * plug-ins/dbbrowser/gimpprocbrowser.c: only convert the name to + scheme style if scheme_names in the proc info pane too. + + * plug-ins/dbbrowser/procedure-browser.c + * plug-ins/script-fu/script-fu-console.c: pass NULL as user_data. + + * plug-ins/script-fu/Makefile.am: reference libgimpprocbrowser.la. + + * plug-ins/pygimp/Makefile.am + * plug-ins/pygimp/procbrowser.c: new module, which wraps + libgimprocbrowser. + + * plug-ins/pygimp/gimpmodule.c + * plug-ins/pygimp/pygimp.h + * plug-ins/pygimp/pygimp-pdb.c: export GimpPDBFunction so other + modules can use it. + + * plug-ins/pygimp/plug-ins/pdbbrowse.py + * plug-ins/pygimp/plug-ins/gimpcons.py: use gimpprocbrowser. + +2004-11-17 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c: added a utility + function to reduce code duplication. + +2004-11-17 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.[ch] + * plug-ins/script-fu/siod-wrapper.c: appled patch from Kevin + Cozens which adds (script-fu-menu-register) and allows scripts to + register their menu_paths the same undeprecated way as plug-ins. + Fixes bug #158117. + + * plug-ins/script-fu/scripts/test-sphere.scm: example how to use + the new API. Doesn't change strings because test-shpere.scm is an + untranslated example script. + +2004-11-17 Michael Natterer <mitch@gimp.org> + + Made plug-in menu registration work the same way for ordinary and + temporary procedures. Addresses bug #158117. + + * app/core/gimp-gui.[ch]: added "const gchar *menu_path" to + gimp_menus_create_entry(). + + * app/gui/gui-vtable.c (gui_menus_create_entry): if menu_path is + NULL, behave as before and create an action and its menu entries + for all the procedure's menu_paths. If it is non-NULL, skip action + creation and create a menu entry just for that path. + + * app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add): call + gimp_menus_create_entry() with a NULL menu path and call it if + proc_def->menu_paths *or* proc_def->menu_label is non-NULL, so + it creates at least the procedure's action, even if it has + no menu_path (yet). + + * tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): check both + the list of procs and temp_procs when trying to register the + entry. Allow ordinary procedures and extensions to install stuff + at query() and init() time and allow temp_procs to install stuff + at any time. + + * app/pdb/plug_in_cmds.c: regenerated. + +2004-11-17 Michael Natterer <mitch@gimp.org> + + * plug-ins/dbbrowser/gimpprocbox.c + * plug-ins/dbbrowser/gimpprocbrowser.[ch] + * plug-ins/dbbrowser/gimpprocview.c: some cleanup in preparation + of moving it to a more public place. + + * plug-ins/dbbrowser/procedure-browser.c + * plug-ins/script-fu/script-fu-console.c: changed accordingly. + +2004-11-17 Sven Neumann <sven@gimp.org> + + * Makefile.am (DISTCHECK_CONFIGURE_FLAGS): removed --enable-gtk-doc + here since it only causes 'make distcheck' to break earlier as usual. + +2004-11-17 Sven Neumann <sven@gimp.org> + + * plug-ins/rcm/Makefile.am + * plug-ins/rcm/rcm_callback.c + * plug-ins/rcm/rcm_dialog.c + * plug-ins/rcm/rcm_stock.[ch]: applied a patch from Karine Proot + that replaces the XPM icons with stock icons (bug #140202). + + * plug-ins/rcm/pixmaps/*.xpm: removed. + + * plug-ins/Lighting/lighting_stock.c + * plug-ins/MapObject/mapobject_stock.c + * plug-ins/gfig/gfig-stock.c: fixed a common but harmless mistake + in the icon factory code. + +2004-11-16 Manish Singh <yosh@gimp.org> + + * app/widgets/gimpvectorstreeview.c: Hide SVG drop g_print under + be_verbose. + +2004-11-16 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/gimpui.py: Handle placeholder defaults for gimp + objects (bug #158392). Patch by Joao S. O. Bueno. + +2004-11-16 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/gimpui.py: Use img.name if filename is not + available (bug #158392). Patch by Joao S. O. Bueno. + +2004-11-16 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/gimpfu.py + * plug-ins/pygimp/gimpui.py: Add a palette selector (bug #155325). + Patch by Joao S. O. Bueno. + +2004-11-16 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/gimpfu.py: Fix -fu slider behavior (bug #155103). + Patch by Joao S. O. Bueno. + +2004-11-16 Manish Singh <yosh@gimp.org> + + * plug-ins/common/glasstile.c: Remove unnecessary G_OBJECT() casts. + +2004-11-16 Manish Singh <yosh@gimp.org> + + * configure.in: + * plug-ins/pygimp/Makefile.am: Compile pygimp with + -fno-strict-aliasing if the compiler supports it. + + * plug-ins/pygimp/gimpui.py: Make "..." into "Browse..." for + everything but the filesel, for slightly more consistency with + script-fu. Addresses #124791. + + * plug-ins/pygimp/gimpmodule.c: Wrapped + gimp_context_{get,set}_gradient and + gimp_gradient_get_{uniform,custom}_samples. Deprecated the deprecated + versions of these, and rewrote them in terms of the new functions. + +2004-11-17 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in.c (plug_in_close): replaced the + while(plug_in->temp_procs) "loop" which called + plug_in_proc_frame_quit() by a real for()-loop iterating over the + list of PlugInProcFrames, calling g_main_loop_quit() on each main + loop. The old version did not unroll the stack but looped + infinitely. Spotted by Yosh. + +2004-11-17 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_selection.c + * plug-ins/imagemap/imap_preferences.c: silent the compiler. + +2004-11-17 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/jpeg.c: applied (modified) patch from S. Mukund + which adds EXIF thumbnail loading and saving. + Fixes bugs #155761 and #158190. + +2004-11-16 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-arc.c + * plug-ins/gfig/gfig-bezier.c + * plug-ins/gfig/gfig-circle.c + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-ellipse.c + * plug-ins/gfig/gfig-line.c + * plug-ins/gfig/gfig-poly.c + * plug-ins/gfig/gfig-spiral.c + * plug-ins/gfig/gfig-star.c + * plug-ins/gfig/gfig-style.c + * plug-ins/gfig/gfig-style.h + * plug-ins/gfig/gfig-types.h + * plug-ins/gfig/gfig.h: added a toggle so we can now choose to stroke + the painting or not. + +2004-11-16 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: implemented the gradient fill, using a + shapeburst blend. This is very slow, but I dont see how it could be + done otherwise. + +2004-11-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpfgbgeditor.c: get rid of the + gimp_fg_bg_editor_context_changed() callback and + g_signal_connect_swapped() gtk_widget_queue_draw() directly. + +2004-11-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpchanneltreeview.c: implement + GimpDockedInterface::set_context() and set the context of the + embedded GimpComponentEditor. Fixes NULL-context crashes in + action callbacks when invoked from the component editor. + Spotted by Jimmac. + + Unrelated: + + * app/widgets/gimpitemtreeview.c: get rid of the + gimp_item_tree_view_context_changed() callback and + g_signal_connect_swapped() gimp_item_tree_view_set_image() + directly. + +2004-11-16 Sven Neumann <sven@gimp.org> + + * plug-ins/common/jigsaw.c: added missing braces around initializer. + +2004-11-16 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/drawable_transform.pdb: renamed the new + drawable_foo_defaults() functions to drawable_foo_default() to be + consistent with paintbrush_default() and friends. + + * tools/pdbgen/pdb/transform_tools.pdb + * libgimp/gimp.def: changed accordingly. + + * app/pdb/drawable_transform_cmds.c + * app/pdb/transform_tools_cmds.c + * libgimp/gimpdrawabletransform_pdb.[ch] + * libgimp/gimptransformtools_pdb.c: regenerated. + + * plug-ins/script-fu/scripts/coolmetal-logo.scm + * plug-ins/script-fu/scripts/image-structure.scm + * plug-ins/script-fu/scripts/text-circle.scm: follow the API change. + +2004-11-16 Sven Neumann <sven@gimp.org> + + * app/config/gimpbaseconfig.c: increased default tile-cache-size + to 128MB. + + * app/config/gimpcoreconfig.c: increased default undo size to 16MB. + +2004-11-16 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/image.pdb + * tools/pdbgen/pdb/selection.pdb: entirely removed the deprecated + functions "selection_clear", "image_set_cmap" and "image_get_cmap". + + * app/pdb/procedural_db.c: and added them to the compat hash table + because they have undeprecated replacements with identical + signature. + + * libgimp/gimpselection.[ch]: added gimp_selection_clear() here + instead because we need the symbol in libgimp. + + * app/pdb/image_cmds.c + * app/pdb/internal_procs.c + * app/pdb/selection_cmds.c + * libgimp/gimpselection_pdb.[ch]: regenerated. + +2004-11-16 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dobject.h: renamed the DObject type to + GfigObject, according to our common type naming. This type will + certainly become an abstract class in a near future. + + * plug-ins/gfig/gfig-arc.c + * plug-ins/gfig/gfig-bezier.c + * plug-ins/gfig/gfig-bezier.h + * plug-ins/gfig/gfig-circle.c + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-ellipse.c + * plug-ins/gfig/gfig-line.c + * plug-ins/gfig/gfig-line.h + * plug-ins/gfig/gfig-poly.c + * plug-ins/gfig/gfig-poly.h + * plug-ins/gfig/gfig-spiral.c + * plug-ins/gfig/gfig-star.c + * plug-ins/gfig/gfig-types.h + * plug-ins/gfig/gfig.c + * plug-ins/gfig/gfig.h: changed accordingly. + +2004-11-16 Michael Natterer <mitch@gimp.org> + + * app/core/gimpitem-linked.[ch] (gimp_item_linked_get_list): + removed redundant "gimage" parameter. + + * app/tools/gimpeditselectiontool.c: changed accordingly. + +2004-11-16 Michael Natterer <mitch@gimp.org> + + * app/core/gimpchannel-select.c + * app/core/gimpchannel.c + * app/core/gimpdrawable-desaturate.c + * app/core/gimpdrawable-equalize.c + * app/core/gimpdrawable-histogram.c + * app/core/gimpdrawable-invert.c + * app/core/gimpdrawable-levels.c + * app/core/gimpdrawable-offset.c + * app/core/gimpdrawable-stroke.c + * app/core/gimpdrawable-transform.c + * app/core/gimpdrawable.c + * app/core/gimpitem-linked.c + * app/core/gimpitem.c + * app/core/gimplayer.c + * app/core/gimpselection.c + * app/paint/gimppaintcore-stroke.c + * app/text/gimptextlayer.c: in all functions which somehow + (explicitely or implicitely) touch undo, either g_return_if_fail() + on gimp_item_is_attached() or simply don't push an undo step if + feasible (e.g. for simple stuff like layer opacity). + + * tools/pdbgen/pdb/color.pdb + * tools/pdbgen/pdb/drawable.pdb + * tools/pdbgen/pdb/image.pdb + * tools/pdbgen/pdb/layer.pdb + * tools/pdbgen/pdb/paint_tools.pdb: let PDB wrappers fail + accordingly so they don't run into the assertions added above. + + * app/pdb/color_cmds.c + * app/pdb/drawable_cmds.c + * app/pdb/image_cmds.c + * app/pdb/layer_cmds.c + * app/pdb/paint_tools_cmds.c: regenerated. + +2004-11-16 Sven Neumann <sven@gimp.org> + + * app/actions/file-commands.c + * app/dialogs/file-save-dialog.c + * app/file/file-save.[ch] + * app/widgets/gimpfiledialog.[ch]: combined "set_uri_and_proc" and + "set_image_clean" parameters into a single "save_a_copy" + parameter. When saving a copy, attach the used URI to the image and + let the "Save a Copy" file chooser default to the last used value. + +2004-11-16 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/glossy.scm: fixed typo (bug #158425). + +2004-11-15 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig.c: added a blurb proposed by Alan Horkan. + + * plug-ins/gfig/gfig-line.[ch]: smallish style fix. + +2004-11-15 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/images/stock-ellipse.png: better icon for the ellipse + tool (a lot more elliptical) by Jimmac and Zigomar. + +2004-11-15 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): + limit the number of file extensions that are added to the file + filter menu to keep the file dialog from growing too wide. + +2004-11-15 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/display/gimpdisplayshell-preview.c: Further optimization of + perspective tool preview - never calculate the same vertex more + than once. + +2004-11-15 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfileprocview.c (gimp_file_proc_view_get_proc) + * app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed): + better fix for bug #158369. + +2004-11-15 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_proc_changed): + return early if gimp_file_proc_view_get_proc() didn't return a file + procedure. Should fix bug #158369. + +2004-11-15 Øyvind Kolås <pippin@gimp.org> + + * docs/gimp.txt: removed, outdated. + * docs/make_todo: removed, unused. + +2004-11-15 Sven Neumann <sven@gimp.org> + + * app/dialogs/print-size-dialog.c: started to redo this dialog + without using a GimpSizeBox. The widgets aren't connected, so it + isn't usable yet. + + * app/widgets/gimpprogressbox.c + * app/widgets/gimpprogressdialog.c + * app/widgets/gimpsizebox.c: trivial cleanups. + + * data/images/gimp-splash.png: splash for 2.2-pre2, done by Jimmac. + +2004-11-14 Sven Neumann <sven@gimp.org> + + * app/actions/image-commands.c: converted error messages that should + never appear to warnings. + +2004-11-14 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-dobject.h: fixed a crash (the one triggered by + this sequence: draw a line, delete it, redraw something), and + corrected some ui spacing. + +2004-11-14 Sven Neumann <sven@gimp.org> + + * app/core/gimppalette-import.c: applied a (slightly modified) + patch from Nickolay V. Shmyrev that changes the palette import + function to not only read palettes in the RIFF format but also + GIMP and Photoshop ACT palette files (bug #158297). + +2004-11-14 Sven Neumann <sven@gimp.org> + + * Makefile.am (EXTRA_DIST) + * MAINTAINERS + * PLUGIN_MAINTAINERS + * TODO.xml: removed these files from the tarball and from CVS. + Doesn't make sense to keep unmaintained files around that provide + outdated and in large parts wrong information. + +2004-11-14 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.c (load_button_callback): use the + proper parent widget. + +2004-11-14 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-types.h: small UI tweaks, suggested by Sven. + +2004-11-14 Sven Neumann <sven@gimp.org> + + * configure.in + * plug-ins/rcm/Makefile.am + * plug-ins/rcm/images/Makefile.am + * plug-ins/rcm/images/rcm-360.png + * plug-ins/rcm/images/rcm-a-b.png + * plug-ins/rcm/images/rcm-ccw.png + * plug-ins/rcm/images/rcm-cw.png: added PNG versions of the XPM + icons used by the RCM plug-in. Added rules to build a header file + that can be used to get rid of the XPM files (bug #140202). + +2004-11-14 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dialog.h + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-dobject.h + * plug-ins/gfig/gfig-types.h + * plug-ins/gfig/gfig.c + * plug-ins/gfig/gfig.h: replace the crappy DAllObjs struct by a GList. + Makes the code cleaner and less error prone. + +2004-11-14 Sven Neumann <sven@gimp.org> + + * plug-ins/pagecurl/pagecurl.c: applied a patch from Karine Proot + that replaces the XPM icons with pixbufs (bug #140202). + + * plug-ins/pagecurl/curl[0-7].xpm: removed. + +2004-11-14 Sven Neumann <sven@gimp.org> + + * plug-ins/gimpressionist/Makefile.am: fixed typo. + + * plug-ins/pagecurl/Makefile.am + * plug-ins/pagecurl/curl[0-7].png: added PNG versions of the XPM + icons used by the PageCurl plug-in. Added rules to build a header + file that can be used to get rid of the XPM files (bug #140202). + +2004-11-14 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/display/gimpdisplayshell-preview.c: Eliminated about 396 + floating-point divides per frame in the persective preview. + +2004-11-13 Manish Singh <yosh@gimp.org> + + Fix a bunch of warnings from Sparse: + + * app/actions/dockable-commands.c + * app/actions/layers-actions.c + * app/actions/view-commands.c + * app/base/pixel-surround.c + * app/config/gimpconfig-utils.c + * app/config/gimpscanner.c + * app/core/gimpbrushgenerated.c + * app/core/gimpcontainer.c + * app/core/gimpimage.c + * app/dialogs/palette-import-dialog.c + * app/file/gimprecentlist.c + * app/plug-in/plug-in-params.c + * app/text/gimptext-compat.c + * app/text/gimptext-parasite.c + * app/vectors/gimpbezierstroke.c + * app/vectors/gimpstroke.c + * app/widgets/gimpcellrendereraccel.c + * app/widgets/gimpselectiondata.c + * app/xcf/xcf.c + * libgimp/gimp.c + * libgimpthumb/gimpthumb-utils.c + * libgimpthumb/gimpthumbnail.c + * modules/cdisplay_proof.c + * plug-ins/Lighting/lighting_ui.c + * plug-ins/common/csource.c + * plug-ins/common/glasstile.c + * plug-ins/common/nova.c + * plug-ins/common/pcx.c + * plug-ins/common/pnm.c + * plug-ins/common/randomize.c + * plug-ins/common/screenshot.c + * plug-ins/common/sel_gauss.c + * plug-ins/common/spheredesigner.c + * plug-ins/common/wind.c + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gimpressionist/gimpressionist.c + * plug-ins/ifscompose/ifscompose.c + * plug-ins/print/gimp_main_window.c + * plug-ins/print/print.c: Cleanup integer vs. pointer confusion. + + * app/base/temp-buf.c + * app/dialogs/about-dialog.c + * plug-ins/common/bumpmap.c + * plug-ins/common/jigsaw.c + * plug-ins/gfig/gfig-dobject.c: Cosmetic cleanups. + + * app/config/gimpconfig-deserialize.c + * app/config/gimpconfig-path.c + * app/config/gimpconfigwriter.c + * app/core/gimpgradient.c + * app/tools/gimpdrawtool.c + * plug-ins/common/nlfilt.c + * plug-ins/common/unsharp.c + * plug-ins/common/zealouscrop.c: Define inline functions before they + are used. + + * app/core/gimpdrawable-blend.c: PixelRegion definition was changed + some time ago, but the initialization here didn't change. Fix it. + + * app/plug-in/plug-in-rc.c (plug_in_extra_deserialize): No need to + assign token twice in a row. + + * libgimpbase/gimpdatafiles.c (gimp_datafiles_read_directories): No + need to initialize file_data, since the code fills out all the fields. + + * plug-ins/common/CML_explorer.c + * plug-ins/common/vpropagate.c: Declare function pointers fully. + + * plug-ins/common/grid.c (pix_composite): G_INLINE_FUNC isn't needed, + we assume we can use the "inline" keyword always. + + * plug-ins/common/psd_save.c + * plug-ins/common/vinvert.c + * plug-ins/gfig/gfig-arc.c + * plug-ins/gfig/gfig-bezier.c + * plug-ins/gfig/gfig-circle.c + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-ellipse.c + * plug-ins/gfig/gfig-line.c + * plug-ins/gfig/gfig-poly.c + * plug-ins/gfig/gfig-spiral.c + * plug-ins/gfig/gfig-star.c + * plug-ins/gfig/gfig.c + * plug-ins/gimpressionist/orientmap.c + * plug-ins/gimpressionist/placement.c + * plug-ins/gimpressionist/sizemap.c + * plug-ins/imagemap/imap_grid.c + * plug-ins/imagemap/imap_main.c + * plug-ins/imagemap/imap_preferences.c + * plug-ins/imagemap/imap_settings.c + * plug-ins/maze/maze.c + * plug-ins/sel2path/curve.c + * plug-ins/sel2path/fit.c + * plug-ins/sel2path/pxl-outline.c + * plug-ins/sel2path/spline.c + * plug-ins/xjt/xjt.c: Functions with no args should be declared + with (void). + + * plug-ins/common/retinex.c (MSRCR): Initialize max_preview to quiet + the compiler. + +2004-11-14 Sven Neumann <sven@gimp.org> + + * themes/Default/images/Makefile.am + * themes/Default/images/stock-center-16.png + * themes/Default/images/stock-center-24.png + * themes/Default/images/stock-print-resolution-16.png + * themes/Default/images/stock-print-resolution-24.png: new icons + drawn by Jimmac. + + * libgimpwidgets/gimpstock.[ch]: registered the new icons. + + * app/actions/image-actions.c + * app/dialogs/print-size-dialog.c + * app/dialogs/resize-dialog.c + * plug-ins/ifscompose/ifscompose.c: use them. + +2004-11-14 Sven Neumann <sven@gimp.org> + + * configure.in: bumped version to 2.2-pre2. + +2004-11-13 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/pdb/image.pdb: Adapted Sven's code into pdbgen so + that gimp_image_set_filename() validates that it is called with + a filename in the filesystem encoding which can safely be converted + to UTF-8 and back. Fixes #153751. + + * app/pdb/image_cmds.c + * libgimp/gimpimage_pdb.c: Regenerated. + +2004-11-13 Sven Neumann <sven@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/print-size-dialog.[ch]: new files for the Print Size + dialog that was missing. Still work in progress... + + * app/actions/image-actions.c + * app/actions/image-commands.[ch] + * app/widgets/gimphelp-ids.h + * menus/image-menu.xml.in: integrate the new dialog. + +2004-11-13 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/selection.pdb: deprecate gimp_selection_clear() + in favor of gimp_selection_none(). Fixes bug #156765. + + * app/pdb/selection_cmds.c + * libgimp/gimpselection_pdb.[ch]: regenerated. + +2004-11-13 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/gfig/gfig.c + * plug-ins/gfig/gfig-dialog.c: Changed gimp_selection_clear() to + gimp_selection_none() (bug #156765). + +2004-11-13 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/gimp-headers.scm + * plug-ins/script-fu/scripts/gimp-labels.scm + * plug-ins/script-fu/scripts/news-text.scm + * plug-ins/script-fu/scripts/speed-text.scm: Changed calls to + gimp-selection-clear to use gimp-selection-none in preparation + for the deprecation of -clear. (bug #156765) + +2004-11-13 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/image.pdb: document the fact that + gimp_image_get_filename() returns the filename in the filesystem + encoding. Fixed gimp_image_get_name() to actually return the name + in UTF-8 encoding. + + * app/pdb/image_cmds.c + * libgimp/gimpimage_pdb.c: Regenerated. + + * app/vectors/gimpbezierstroke.h: formatting. + +2004-11-13 Sven Neumann <sven@gimp.org> + + * app/core/gimpimagefile.[ch] + * app/file/file-open.c + * app/file/file-save.c: pass the MIME type from the save procedure + to gimp_imagefile_save_thumbnail() so that it can be stored with + the thumbnail. + + * tools/pdbgen/pdb/fileops.pdb + * app/pdb/fileops_cmds.c: changed accordingly. + +2004-11-13 Sven Neumann <sven@gimp.org> + + * app/plug-in/plug-in-proc-def.[ch] + * app/plug-in/plug-in-rc.c + * app/plug-in/plug-ins.[ch]: allow to associate a procedure for + thumbnail loading with any file load procedure. + + * tools/pdbgen/pdb/fileops.pdb: export this functionality to the + PDB as gimp_register_thumbnail_loader(). + + * app/pdb/fileops_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpfileops_pdb.[ch]: regenerated. + + * app/core/gimpimagefile.c + * app/file/file-open.[ch]: when creating a thumbnail for an image + file, use a thumbnail load procedure if available. + + * plug-ins/common/svg.c: added "file_svg_load_thumb", a procedure + that allows to load a small preview of the SVG image. + +2004-11-13 DindinX <dindinx@gimp.org> + + * app/actions/layers-actions.c: added back <control>H as a shortcut + for "Anchor Layer". Spotted by Bruno Ronzani. + +2004-11-13 DindinX <dindinx@gimp.org> + + * plug-ins/common/retinex.c: use a GimpAspectPreview instead of a + GimpDrawablePreview. Fixes bug #157915. Also fixed the funny behaviour + of the progress bar. + +2004-11-13 Sven Neumann <sven@gimp.org> + + * libgimpbase/gimputils.c (gimp_strip_uline): changed based on a + patch by Joao S. O. Bueno to remove mnemonics as used in languages + like Chinese. Fixes bug #157561. + +2004-11-13 Sven Neumann <sven@gimp.org> + + * plug-ins/ifscompose/README.ifscompose: updated link to the + tutorial (pointed out by Alan Horkan) and added another link. + + * plug-ins/ifscompose/ifscompose.c: changed plug-in name from + "IfsCompose" to "IFS Fractal". Sorry for the late string changes + but the old name definitely was akward and probably hard to + translate anyway. Fixes bug #157135. + + * plug-ins/ifscompose/ifscompose_storage.c: removed trailing + whitespace. + +2004-11-13 Sven Neumann <sven@gimp.org> + + * plug-ins/common/retinex.c (retinex_dialog): fixed table size. + +2004-11-13 Simon Budig <simon@gimp.org> + + * app/core/gimpimage-merge.c: Return the active layer instead of + the bottom layer when just merging down a floating selection. + Untabbified. + + Fixes bug #158130. + +2004-11-12 Sven Neumann <sven@gimp.org> + + * app/config/gimpconfig-dump.c: better fix for bug #157971. + + * docs/gimprc.5.in: regenerated. + +2004-11-12 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/images/stock-show-all.png + * plug-ins/gfig/images/stock-select-object.png: new icons made by + Jimmac. + +2004-11-12 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage-undo-push.c: disallow non-attached items + to be pushed to the undo stack. + +2004-11-12 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/images/stock-show-all.png + * plug-ins/gfig/images/stock-select-object.png: added these two stock + icons. Jimmac, these two are screaming to be redone, please. + + * plug-ins/gfig/images/Makefile.am: added these icons. + + * plug-ins/gfig/gfig-bezier.c + * plug-ins/gfig/gfig-bezier.h + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-poly.c + * plug-ins/gfig/gfig-poly.h + * plug-ins/gfig/gfig-spiral.c + * plug-ins/gfig/gfig-spiral.h + * plug-ins/gfig/gfig-star.c + * plug-ins/gfig/gfig-star.h + * plug-ins/gfig/gfig-stock.c + * plug-ins/gfig/gfig-stock.h + * plug-ins/gfig/gfig.h: moved all the buttons to a GtkUIManager + toolbar, which makes the code simpler and easier to read. + +2004-11-12 Sven Neumann <sven@gimp.org> + + * app/dialogs/tips-dialog.c: added icons to the Previous/Next + buttons (bug #158004). + +2004-11-11 Sven Neumann <sven@gimp.org> + + * app/gui/splash.c: lowered labels a few pixels. + +2004-11-11 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: minor code cleanup. + +2004-11-11 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: use a GtkUIManager for the menu and + automagically have it translated! The button bar will follow the same + path. Remove the now useless "Paint" button. + +2004-11-11 Sven Neumann <sven@gimp.org> + + * app/config/gimpconfig-dump.c: groff doesn't like lines to start + with a single quote, we better escape it. Fixes bug #157971. + + * docs/gimprc.5.in: regenerated. + +2004-11-11 Michael Natterer <mitch@gimp.org> + + * app/core/gimp-edit.c + * app/core/gimpdrawable-blend.c + * app/core/gimpdrawable-bucket-fill.c + * app/core/gimpitem.c (gimp_item_stroke): added precondition + checks for gimp_item_is_attached() and removed checks for + gimp_item_get_image() to actually return an image (because it + always returns an image). + + * tools/pdbgen/pdb/edit.pdb: let all wrappers fail if the drawable + is not attached. + + * app/pdb/edit_cmds.c: regenerated. + +2004-11-11 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/scripts/add-bevel.scm + * plug-ins/script-fu/scripts/addborder.scm + * plug-ins/script-fu/scripts/carve-it.scm + * plug-ins/script-fu/scripts/carved-logo.scm + * plug-ins/script-fu/scripts/chip-away.scm + * plug-ins/script-fu/scripts/clothify.scm + * plug-ins/script-fu/scripts/font-map.scm + * plug-ins/script-fu/scripts/slide.scm + * plug-ins/script-fu/scripts/swirltile.scm: don't call gimp-edit-* + functions on drawables which are not added to an image because + this will be forbidden soon (because it can trash the image's undo + stack). + +2004-11-11 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/scripts/lava.scm: replaced + undo-disable/enable by undo-group-start/end. + +2004-11-11 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpimagemaptool.c (gimp_image_map_tool_response): + call gimp_image_flush() after committing the image_map so the + menus are up-to-date. Fixes bug #157914. + +2004-11-11 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/display/gimpdisplayshell-preview.c: Use the transform + tool coordinates when creating subdivisions, not the + texture coordinates. Fixes breakage with layers that are not + the image size. + +2004-11-11 Jay Cox <jaycox@gimp.org> + + * app/base/brush-scale.c: Keep computed brush values from + overflowing with large reduction factors. Fixes bug #76228. + +2004-11-11 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpintstore.c + * app/vectors/gimpvectors-import.c: please the overly pedantic + IRIX MIPSpro compiler and don't initialize structs with + non-constant values. + +2004-11-10 Sven Neumann <sven@gimp.org> + + * app/file/file-open.c (file_open_layer): add the image to the + list of recently used documents. Fixes bug #157879. + +2004-11-10 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: moved the tool options closer to the + tools and made the dialog a bit smaller. + +2004-11-10 Sven Neumann <sven@gimp.org> + + * plug-ins/common/mail.c: added a menu icon (compiled-in). + +2004-11-10 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-handlers.c + (gimp_display_shell_resolution_changed_handler): if dot_for_dot is + off, resolution change has the same effect as size change, so call + gimp_display_shell_size_changed_handler(). Fixes display garbage. + +2004-11-10 Michael Natterer <mitch@gimp.org> + + * plug-ins/winicon/icodialog.[ch] + * plug-ins/winicon/icoload.[ch] + * plug-ins/winicon/icosave.[ch] + * plug-ins/winicon/main.[ch]: call progress functions + unconditionally; removed global "interactive" variable; use + standard strings for open/save progress messages; gui, indentation + & coding style cleanup; untabified. + +2004-11-10 Michael Schumacher <schumaml@cvs.gnome.org> + + * plug-ins/winsnap/winsnap.c: applied a patch from Sven Neumann + with some minor modifications. Fixes bug #157612 + Removed some unused variables. + +2004-11-10 Michael Natterer <mitch@gimp.org> + + * libgimpbase/gimputils.c (gimp_escape_uline): "Since: GIMP 2.2". + +2004-11-10 Sven Neumann <sven@gimp.org> + + * app/dialogs/preferences-dialog.c: set the padding-mode to custom + color if a custom color is choosen. Fixes bug #157844. + +2004-11-10 Michael Natterer <mitch@gimp.org> + + * plug-ins/dbbrowser/plugin-browser.c (browser_dialog_new): fixed + capitalization of notebook tab label. + +2004-11-10 Michael Natterer <mitch@gimp.org> + + * libgimpbase/gimputils.[ch]: renamed gimp_flags_get_value() to + gimp_flags_get_first_value(). Reordered functions so enum and + flags functions are grouped together. Added missing docs. + + * libgimpbase/gimpbase.def: changed accordingly. + +2004-11-09 Jay Cox <jaycox@gimp.org> + + * plug-ins/common/psd.c: Skip resources with unknown signatures + instead of quiting. Fixes bug #142468, and bug #152728 + + * app/core/gimpdrawable.c: in functions gimp_drawable_mask_bounds, + and gimp_drawable_mask_intersect: reinitialize the return values + after calling gimp_channel_bounds because gimp_channel_bounds + overwrites the values even when it returns false. This fixes the + bug where the gimp crashes when running color tools on layers + smaller than the image, and processes only part of the image when + the layer is larger than the image size. + +2004-11-10 Sven Neumann <sven@gimp.org> + + * HACKING: some updates. + +2004-11-10 Michael Natterer <mitch@gimp.org> + + * plug-ins/ifscompose/ifscompose.c: use a UI manager created + toolbar instead of two rows of buttons. Added a "dummy-menubar" so + the popup menu shows shortcuts again. Removed "Preview" and "Auto" + buttons since the preview doesn't block the GUI and can always be + updated. + +2004-11-10 Michael Natterer <mitch@gimp.org> + + * app/display/gimpstatusbar.[ch]: added new function + gimp_statusbar_push_length(), which works exactly like + push_coords() but takes only one value plus a GimpOrientationType + for specifying the value's axis. + + * app/tools/gimptool.[ch]: added the corresponding + gimp_tool_push_status_length(). + + * app/tools/gimpmovetool.c: use gimp_tool_push_status_length() + so the guide position is shown in the selected display unit. + Cleaned up the status message code a bit. + +2004-11-10 Sven Neumann <sven@gimp.org> + + * plug-ins/helpbrowser/dialog.c: use an idle handler to jump to the + anchor. + +2004-11-09 Manish Singh <yosh@gimp.org> + + * plug-ins/common/bmpread.c: if the file has space in the colormap for + more than 256 entries, ignore them instead of failing. Fixes bug + #157775. + +2004-11-09 Manish Singh <yosh@gimp.org> + + * plug-ins/common/bmpread.c: Fix cut'n'paste err so grayscale images + load again. Fixes bug #157764. + +2004-11-09 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-callbacks.c + (gimp_display_shell_canvas_tool_events): pass (gint)-truncated + coordinates instead of RINT()-rounded ones to + gimp_display_shell_update_cursor(). Restores correct coordinates + display for zoomed-in display and fixes bug #153534. + + * app/tools/gimpmovetool.c: added statusbar messages including the + (rounded) guide coordinate. Keeps bug #141719 closed. + +2004-11-09 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell.c (gimp_display_shell_new): don't + connect to "event" and don't connect any canvas event to + gimp_display_shell_events(). Connect all tool events separately + (doesn't include "configure-event" and thus fixes bug #141543). + + * app/display/gimpdisplayshell-callbacks.c + (gimp_display_shell_canvas_tool_events): call + gimp_display_shell_events() manually before doing tool event + processing. + + * app/display/gimpdisplayshell.c + * app/display/gimpdisplayshell-callbacks.[ch]: connect to + "size_allocate" of the canvas, not to "configure_event" + (suggested by Owen in bug #141543). + + * app/display/gimpdisplayshell-callbacks.[ch]: removed + gimp_display_shell_popup_menu(). + + (gimp_display_shell_origin_button_press): emit "popup-menu" on the + shell manually instead of calling above function. + + * app/display/gimpdisplayshell.c: added the whole menu popup code + here. + +2004-11-09 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpoffsetarea.c (gimp_offset_area_resize): queue + a resize. Fixes remaining issues with bug #157495. + +2004-11-09 Sven Neumann <sven@gimp.org> + + * plug-ins/common/url.c: removed debug output. + +2004-11-08 Sven Neumann <sven@gimp.org> + + * app/dialogs/user-install-dialog.c (user_install_migrate_files): + don't copy menurc, the format changed anyway. + +2004-11-08 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c (script_fu_ok): + actually retrieve the value from the GtkEntry for SF-VALUE. + +2004-11-08 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/layer.pdb: applied modified patch from Geert + Jordaens which adds the missing gimp_layer_from_mask() API. + Addresses bug #138662. + + * app/pdb/internal_procs.c + * app/pdb/layer_cmds.c + * libgimp/gimplayer_pdb.[ch]. regenerated. + + * libgimp/gimp.def: changed accordingly. + +2004-11-08 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/scripts/selection-round.scm: removed garbage + from beginning of file. Removed DOS line breaks. + +2004-11-08 Michael Natterer <mitch@gimp.org> + + * libgimp/gimppixelfetcher.c: added docs derived from a patch from + Cai Qian (bug #156271). + +2004-11-08 Sven Neumann <sven@gimp.org> + + * plug-ins/common/screenshot.c: changed label of default action + button to "Grab". + +2004-11-08 Sven Neumann <sven@gimp.org> + + * plug-ins/common/CEL.c + * plug-ins/common/CML_explorer.c + * plug-ins/common/channel_mixer.c + * plug-ins/common/gqbist.c + * plug-ins/common/spheredesigner.c + * plug-ins/flame/flame.c + * plug-ins/ifscompose/ifscompose.c: don't set help-ids on plug-in + file chooser dialogs. Set the default response for file dialogs. + +2004-11-08 Michael Natterer <mitch@gimp.org> + + * app/dialogs/resize-dialog.c (resize_dialog_response) + * app/dialogs/scale-dialog.c (scale_dialog_response): replaced + "case GTK_RESPONSE_CANCEL:" by "default:" so it also catches + hitting the escape key or clicking the WM close button. + +2004-11-08 Øyvind Kolås <pippin@gimp.org> + + * plug-ins/common/gqbist.c: fixed typo in construction of file + chooser, use gtk_dialog_run instead of separate callbacks for + the responses of the file chooser dialog. + +2004-11-08 Sven Neumann <sven@gimp.org> + + * app/core/gimpdrawable.c (gimp_drawable_mask_bounds) + (gimp_drawable_mask_intersect): initialize the return values before + checking if the drawable is attached. Keeps GIMP from going mad if + this assertion is ever triggered. + +2004-11-07 Sven Neumann <sven@gimp.org> + + * plug-ins/helpbrowser/dialog.c: don't connect the help browser to + the help system. + +2004-11-07 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/selection-round.scm: register the + compatibility procedure with the correct name. + +2004-11-07 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpcolorbutton.c: fixed unused code (tooltip was + taken from label field). + +2004-11-07 Sven Neumann <sven@gimp.org> + + * plug-ins/ifscompose/ifscompose.c: ported to GtkUIManager. + +2004-11-07 Sigurd Gartmann <sigurd-translate@brogar.org> + + * configure.in: Added support for the new locale nb to ALL_LINGUAS. + +2004-11-07 Sven Neumann <sven@gimp.org> + + * plug-ins/common/channel_mixer.c (query): the menu label should + have three dots (bug #157580). + +2004-11-07 DindinX <dindinx@gimp.org> + + * plug-ins/gflare/gflare.c: removed #undef GTK_DISABLE_DEPRECATED and + use a GtkListStore instead of the long-time deprecated GtkList. Done + some small cleanups, too. + +2004-11-06 Sven Neumann <sven@gimp.org> + + * app/core/gimpbrushgenerated.c: changed minimum brush radius from + 1.0 to 0.1. + + * app/widgets/gimpbrusheditor.c: allow a smaller brush radius to + be set in the brush editor. Fixes bug #157508. + +2004-11-06 Sven Neumann <sven@gimp.org> + + * app/dialogs/scale-dialog.c (scale_dialog_reset): same fix here. + +2004-11-06 Sven Neumann <sven@gimp.org> + + * app/dialogs/preferences-dialog.c: fixed typo (bug #157513). + +2004-11-06 Sven Neumann <sven@gimp.org> + + * app/dialogs/convert-dialog.c (convert_dialog_new): removed + trailing period from check button label. Fixes bug #157511. + +2004-11-06 Sven Neumann <sven@gimp.org> + + * app/dialogs/resize-dialog.c (resize_dialog_reset): fixed most of + the Reset functionality (bug #157495). The offset box is still not + working correctly. + + * app/widgets/gimpsizebox.c (gimp_size_box_update_resolution): + check for availability of the size entry before accessing it. + +2004-11-06 Sven Neumann <sven@gimp.org> + + New Win32 icons contributed by Jernej Simoncic: + + * app/Makefile.am + * app/makefile.msc + * app/gimp.rc + * app/fileicon.ico: added new file icon for the Win32 build. + + * app/wilber.ico: nicer application icon for the Win32 build. + +2004-11-05 Michael Natterer <mitch@gimp.org> + + * plug-ins/maze/maze.c + * plug-ins/maze/maze_face.c: some irrelevant cleanups while doing + code review. + +2004-11-05 Michael Natterer <mitch@gimp.org> + + * plug-ins/flame/flame.c: removed #undef GTK_DISABLE_DEPRECATED + because it's no longer needed. Cleaned up #defines and + declarations. Removed tabs and trailing whitespace. + +2004-11-04 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpsessioninfo.c: be more tolerant and silently + skip entries that the dialog factory doesn't recognize. + + * app/widgets/gimpdialogfactory.c: minor cleanup. + +2004-11-04 Sven Neumann <sven@gimp.org> + + * app/dialogs/user-install-dialog.c (user_install_response): don't + save the (empty) gimprc after migrating the user settings. + +2004-11-04 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/uniteditor.c: undeprecated by using a + GtkUIManager for creating the toolbar. Some cleanup and code + reordering. + +2004-11-04 Michael Natterer <mitch@gimp.org> + + * configure.in: disable the whole bunch of FOO_DISABLE_DEPRECATED + only for future versions of GLib, GTK+ and Pango because the + upcoming new stable versions add no new deprecations that are + relevant for the GIMP source. + +2004-11-04 Michael Natterer <mitch@gimp.org> + + * plug-ins/ifscompose/ifscompose.c: some undeprecation and + cleanup. Still uses GtkItemFactory. + +2004-11-04 Michael Natterer <mitch@gimp.org> + + Don't use deprecated GtkToolbar API in GimpTextEditor: + + * app/actions/Makefile.am + * app/actions/actions.c + * app/actions/text-editor-actions.[ch] + * app/actions/text-editor-commands.[ch]: added acions and + callbacks for the new "text-editor" action group. + + * app/menus/menus.c: register a "<TextEditor>" UI manager. + + * menus/Makefile.am + * menus/text-editor-toolbar.xml: new file for the toolbar. + + * app/widgets/gimptexteditor.[ch]: use the toolbar created by the + UI manager instead of constructing it using deprecated API. + + * app/tools/gimptextoptions.c: changed accordingly. + + * app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_load() + (used by text-editor-commands.c). + +2004-11-04 Michael Natterer <mitch@gimp.org> + + * plug-ins/ifscompose/ifscompose.c: #undef GTK_DISABLE_DEPRECATED. + +2004-11-04 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcolorbutton.[ch]: use a GtkUIManager instead + of a GtkItemFactory. Added virtual function ::get_action_type() + and create the manager's actions manually using that action type + instead of using gtk_action_group_add_actions(). + + * app/widgets/gimpcolorpanel.c: override ::get_action_type() so it + creates GimpActions (which can have a color attached) instead of + GtkActions. Changed the menu item visibility and color preview + code accordingly. + + * app/widgets/Makefile.am + * app/widgets/gimpitemfactory.[ch]: finally removed. + + * configure.in: added -DGTK_DISABLE_DEPRECATED to CPPFLAGS again. + +2004-11-04 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpoldwidgets.c: #undef GTK_DISABLE_DEPRECATED + + * libgimpwidgets/gimpunitmenu.h: #include <gtk/gtkoptionmenu.h> + explicitely and #undef GTK_DISABLE_DEPRECATED only around the + inclusion if it was defined before. + +2004-11-04 Michael Natterer <mitch@gimp.org> + + * libgimp/gimpunitcache.h + * libgimpbase/gimpchecks.h + * libgimpbase/gimpdatafiles.h + * libgimpbase/gimplimits.h + * libgimpbase/gimpmemsize.h + * libgimpbase/gimputils.h + * libgimpbase/gimpwin32-io.h + * libgimpthumb/gimpthumb-enums.h + * libgimpthumb/gimpthumb-error.h + * libgimpwidgets/gimppreviewarea.h: added G_BEGIN_DECLS / G_END_DECLS. + +2004-11-04 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/ccanalyze.c + * plug-ins/common/uniteditor.c + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-preview.c + * plug-ins/ifscompose/ifscompose.c + * plug-ins/imagemap/imap_misc.c + * plug-ins/imagemap/imap_selection.c + * plug-ins/imagemap/imap_toolbar.c + * plug-ins/imagemap/imap_tools.c + * plug-ins/print/gimp_color_window.c: stop using deprecated + functions, added some #undef GTK_DISABLE_DEPRECATED where needed. + +2004-11-03 Michael Natterer <mitch@gimp.org> + + * app/dialogs/module-dialog.c + * plug-ins/dbbrowser/gimpprocbrowser.c + * plug-ins/dbbrowser/plugin-browser.c: use + gtk_tree_model_get_iter_first() instead of the deprecated + _get_iter_root(). + + * app/display/gimpdisplayshell-callbacks.c: don't include + "widgets/gimpitemfactory.h". + +2004-11-03 Øyvind Kolås <pippin@gimp.org> + + * app/base/gimphistogram.h: %s/historgam/histogram/ + +2004-11-03 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdasheditor.c (gimp_dash_editor_finalize): don't + forget to g_free(editor->segments). + +2004-11-03 Michael Natterer <mitch@gimp.org> + + * app/display/gimpscalecombobox.c + (gimp_scale_combo_box_mru_remove_last) + * app/widgets/gimpeditor.c (gimp_editor_add_action_button) + * app/xcf/xcf-load.c (xcf_load_old_path): plugged some small leaks. + +2004-11-03 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): + plugged a mem-leak. + + * app/widgets/gimpviewrendererimagefile.c + (gimp_view_renderer_imagefile_render): don't leak the pixbuf here. + + * app/widgets/gimpviewrenderer-frame.c: added a comment. + +2004-11-03 Michael Natterer <mitch@gimp.org> + + * app/paint-funcs/paint-funcs.c (combine_sub_region): applied + patch from Joao S. O. Bueno which moves assignments into an "else" + branch and thus optimizes the (common) "if" branch. Did some + cosmetic cleanups. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c (script_fu_interface): + don't silently return when there is already a script running but + show a message instead. Unfortunately introduces two new strings, + but bugs are bugs. Fixes bug #123882. + +2004-11-02 Sven Neumann <sven@gimp.org> + + * app/core/gimpimagefile.c (gimp_imagefile_save_thumb): minor + cleanup. + + * libgimpthumb/gimpthumb-utils.c (_gimp_thumbs_delete_others): do + the right thing. Used to do the wrong thing when called with a + thumbnail size which is not from the GimpThumbSize enum. + +2004-11-02 Sven Neumann <sven@gimp.org> + + * app/actions/image-commands.c (image_new_from_image_cmd_callback): + call image_new_dialog_set() unconditionally. Fixes bug #157096. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/drawable_transform.pdb: factored out the + "invoke" bodies to two utility functions, getting rid of *tons* of + duplicated code. + + * app/pdb/drawable_transform_cmds.c: regenerated (only whitespace + and comments changed). + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/drawable_transform.pdb (drawable_*_defaults): + renamed parameter "interpolation" to "interpolate" as suggested by + pippin. + + * app/pdb/drawable_transform_cmds.c + * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * app/dialogs/user-install-dialog.c (user_install_migrate_files): + don't copy pluginrc* and themerc*. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * libgimp/gimpimage.h: one more s/cmap/colormap/. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/transform_tools.pdb: deprecated all functions. + + * app/pdb/transform_tools_cmds.c + * libgimp/gimptransformtools_pdb.[ch]: regenerated. + + * plug-ins/common/tiff.c + * plug-ins/script-fu/scripts/3dTruchet.scm + * plug-ins/script-fu/scripts/coolmetal-logo.scm + * plug-ins/script-fu/scripts/image-structure.scm + * plug-ins/script-fu/scripts/perspective-shadow.scm + * plug-ins/script-fu/scripts/text-circle.scm + * plug-ins/script-fu/scripts/truchet.scm: use the new transform API. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/drawable_transform.pdb: added _defaults() + variants (flip_defaults, rotate_defaults, ...) for all transform + functions which finally call gimp_drawable_transform_affine(). + The _defaults() functions don't take the whole interpolation_type, + supersample etc. parameter overkill, but only a "interpolation" + boolean like the old PDB wrappers. + + * libgimp/gimp.def: changed accordingly. + + * app/pdb/drawable_transform_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/drawable_transform.pdb: renamed flip() and + rotate() to flip_simple() and rotate_simple(). Renamed flip_free() + and rotate_free() to flip() and rotate() (the special cases should + have a special suffix, not the general ones). + + * libgimp/gimp.def: changed accordingly. + + * app/pdb/drawable_transform_cmds.c + * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/compressor.c (compressors): added missing bzip2 + command lines for Win32. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * plug-ins/bmp/bmpread.c + * plug-ins/bmp/bmpwrite.c + * plug-ins/common/CEL.c + * plug-ins/common/animationplay.c + * plug-ins/common/animoptimize.c + * plug-ins/common/autostretch_hsv.c + * plug-ins/common/c_astretch.c + * plug-ins/common/ccanalyze.c + * plug-ins/common/color_enhance.c + * plug-ins/common/film.c + * plug-ins/common/gee.c + * plug-ins/common/gee_zoom.c + * plug-ins/common/gif.c + * plug-ins/common/gifload.c + * plug-ins/common/grid.c + * plug-ins/common/header.c + * plug-ins/common/mng.c + * plug-ins/common/normalize.c + * plug-ins/common/pcx.c + * plug-ins/common/png.c + * plug-ins/common/pnm.c + * plug-ins/common/postscript.c + * plug-ins/common/psd.c + * plug-ins/common/psd_save.c + * plug-ins/common/raw.c + * plug-ins/common/sunras.c + * plug-ins/common/tga.c + * plug-ins/common/tiff.c + * plug-ins/common/tile.c + * plug-ins/common/vinvert.c + * plug-ins/common/winclipboard.c + * plug-ins/common/winprint.c + * plug-ins/common/xbm.c + * plug-ins/common/xpm.c + * plug-ins/common/xwd.c + * plug-ins/fits/fits.c + * plug-ins/gfli/gfli.c + * plug-ins/imagemap/imap_preview.c + * plug-ins/print/print.c + * plug-ins/pygimp/pygimp-image.c + * plug-ins/winicon/main.c: use the new "colormap" functions + instead of the deprecated "cmap" ones. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + More final API cleanup: + + * tools/pdbgen/pdb/image.pdb: added gimp_image_set,get_colormap() + and deprecated set,get_cmap(). + + * libgimpwidgets/gimppreviewarea.[ch]: renamed + gimp_preview_area_set_cmap() to set_colormap(). + + * libgimp/gimp.def + * libgimp/gimpdrawablepreview.c + * libgimp/gimpexport.c + * libgimp/gimpimage.[ch] + * libgimpwidgets/gimpwidgets.def: changed accordingly. + + * app/pdb/image_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpimage_pdb.[ch]: regenerated. + + (undeprecation of plug-ins will follow...) + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpcroptool.c (crop_recalc): added "gboolean + recalc_highlight" and call gimp_display_shell_set_highlight() only + when it's TRUE. Pass TRUE from all places where the crop outline + actually changed. + + (gimp_crop_tool_control): added back the call to crop_recalc() for + the RESUME case so the outline gets updated on zoom/scroll, but pass + recalc_highlight = FALSE because it has not changed. + Fixes bug #157001. + +2004-11-02 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/drawable_transform.pdb (flip): renamed + parameter "center" to "auto_center" and removed + "transform_direction". Renamed rotate() to rotate_free() and + added a "gboolean auto_center" parameter. Added new function + rotate() which takes enum GimpRotationType instead of an + arbiatrary angle so the flip and rotate APIs are symmetric. + + * libgimp/gimp.def: added the gimp_drawable_transform_* stuff. + + * app/pdb/drawable_transform_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. + +2004-11-02 Sven Neumann <sven@gimp.org> + + * app/dialogs/image-scale-dialog.c (image_scale_callback): actually + use the choosen interpolation type. Fixes bug #157102. + +2004-11-02 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-dobject.h + * plug-ins/gfig/gfig-preview.c + * plug-ins/gfig/gfig-style.h + * plug-ins/gfig/gfig-types.h + * plug-ins/gfig/gfig.h: some more cleanups. The current_style bug is + still there :( + +2004-11-01 Øyvind Kolås <pippin@gimp.org> + + * app/xcf/xcf-load.c: applied patch from David Gowers, extra sanity + checking for the xcf loader, colormaps read from non indexed images + are discarded. Does not fix bug #134097, but prevents gimp from + reloading an impossible state. + +2004-11-01 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable-transform.[ch] + (gimp_drawable_transform_flip): renamed "center" to "auto_center". + + (gimp_drawable_transform_rotate): added missing parameters so it + can be used for a to-be-added PDB wrapper offering a + GimpRotationType based rotate API. + + Both functions: always clip when transforming a whole channel, + since they must keep their size. + + (gimp_drawable_transform_affine): actually forward the passed + "clip_result" to transform_tiles_affine() instead of always FALSE. + +2004-11-01 Øyvind Kolås <pippin@gimp.org> + + * app/pdb/color_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpcolor_pdb.c + * libgimp/gimpcolor_pdb.h: regenerated + * tools/pdbgen/pdb/color.pdb: added levels-stretch to @procs, removed + metainformation from deprecated levels-auto. + +2004-11-01 Øyvind Kolås <pippin@gimp.org> + + * app/actions/drawable-actions.c + * app/actions/drawable-commands.c + * app/actions/drawable-commands.h + * app/base/levels.c + * app/base/levels.h + * app/core/gimpdrawable-levels.c + * app/core/gimpdrawable-levels.h + * app/pdb/color_cmds.c + * app/tools/gimplevelstool.c + * libgimp/gimpcolor_pdb.c + * menus/image-menu.xml + * menus/image-menu.xml.in + * tools/pdbgen/pdb/color.pdb: renamed [drawable-]levels-auto + to [drawable-]levels-stretch, anticipating other ways to automatically + determine levels settings, old PDB command maintained, but marked + as deprecated. + +2004-11-01 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): + don't check for file_proc->menu_paths. Our load and save procedure + don't necessarily register a menu path any longer. + + * app/plug-in/plug-ins.c: minor cleanup. + + * app/xcf/xcf.c (xcf_init): no need for adding menu paths for the + XCF load and save procedures. + + * tools/pdbgen/pdb/fileops.pdb: fixed outdated documentation. + + * app/pdb/fileops_cmds.c + * libgimp/gimpfileops_pdb.c: regenerated. + +2004-11-01 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/drawable_transform.pdb: added "clip_result" to + the transform_options_args() utility function and changed all + wrappers accordingly. Removed "interpolation", "supersample" and + "recursion_level" args from drawable_transform_flip(). + + * app/pdb/drawable_transform_cmds.c + * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. + +2004-11-01 Sven Neumann <sven@gimp.org> + + * plug-ins/common/tiff.c (query): fixed typo. + +2004-11-01 Michael Natterer <mitch@gimp.org> + + * app/actions/drawable-actions.c: trailing whitespace. + + * app/actions/drawable-commands.[ch]: partly revert alphabetical + ordering. Instead, group them as in drawable-actions.c and order + by alphabet inside the groups (different ordering in *-actions.c + and *-commands.c is inconvenient for the usual workflow of editing + both files at the same time). + + * app/core/gimpdrawable-levels.h: indentation. + +2004-11-01 Michael Natterer <mitch@gimp.org> + + * themes/Small/gtkrc: don't change GtkDialog::button_spacing and + ::action_area_border because it breaks alignment with all other + dialog spacings or borders (which are hardcoded). + +2004-11-01 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-types.h: new file to hold the types gfig uses. + This makes the sources easier to read. + + * plug-ins/gfig/Makefile.am: added gfig-types.h + + * plug-ins/gfig/gfig.h: removed some types definitions and put them + in gfig-types.h and ... + + * plug-ins/gfig/gfig-dobject.h + * plug-ins/gfig/gfig-style.h: ...into these files. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * Made 2.2-pre1 release. + +2004-10-31 Simon Budig <simon@gimp.org> + + * data/images/gimp-splash.png: new splash based on a great photo + (and pumpkin) by Seth Burgess <sjburges@gimp.org>. + +2004-10-31 Simon Budig <simon@gimp.org> + + * plug-ins/common/plasma.c: Fixed handling of 1x1 selection and + selection out of drawable. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/Makefile.am (EXTRA_DIST): removed pix-data.h. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * configure.in: changed gimp_version to 2.2-pre1, to match the + naming scheme of the 2.0 pre-releases. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * plug-ins/common/newsprint.c: removed an unused variable. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * app/dialogs/user-install-dialog.c: when migrating the user + settings, tolerate errors and create the tmp directory that was + explicitely not copied. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * app/config/gimpconfig-utils.c (gimp_config_file_copy): copy the + file permissions also. + + * app/dialogs/user-install-dialog.c: added code to migrate user + settings from ~/.gimp-2.0. It copies all files (except GIMP swap + files) and all subdirectories (except tmp) with all files. It + doesn't recurse into subdirectories. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * app/config/gimpguiconfig.c: disabled the image area by default + to reduce some clutter. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * app/dialogs/user-install-dialog.c: fixed page logic for migration + of user settings. Still missing code to actually copy the files. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpmemsizeentry.c: don't use camel case in memory + size identifiers. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpimageeditor.c (gimp_image_editor_set_context): + set the active image. Fixes bug #156942. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * app/dialogs/user-install-dialog.c: started to work on migration of + user settings (bug #156636). Not at all functional yet. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpwidgets.c: allow for mnemonics in radio + groups created with gimp_radio_group_new(). + +2004-10-31 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dobject.c: some more UI improvements. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpsizebox.c: added a size entry to edit the + resolution. This should close bug #151022. + +2004-10-31 Sven Neumann <sven@gimp.org> + + * app/dialogs/resize-dialog.c: connect the offset controls. + +2004-10-30 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-style.c: fixed some annoying popup messages at + the price of a smallish mem-leak that I will fix later. + +2004-10-30 Sven Neumann <sven@gimp.org> + + * app/composite/gimp-composite-generic.c + (gimp_composite_hue_any_any_any_generic): do nothing if the color + has no saturation. Patch by Joao S. Bueno. Fixes bug #123296. + +2004-10-30 Sven Neumann <sven@gimp.org> + + * app/actions/image-commands.c (image_scale_cmd_callback): destroy + the scale dialog when the display is disconnected. + + * app/dialogs/resize-dialog.c: fixed a couple of bugs related to + the offset area. Still work in progress. + +2004-10-30 DindinX <dindinx@gimp.org> + + * plug-ins/common/newsprint.c: Moved the preview to the left, as + suggested by Joao S. O. Bueno. + +2004-10-30 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-line.c + * plug-ins/gfig/gfig-line.h + * plug-ins/gfig/gfig-poly.c + * plug-ins/gfig/gfig-preview.c + * plug-ins/gfig/gfig-star.c + * plug-ins/gfig/gfig-style.c + * plug-ins/gfig/gfig-style.h: some more cleanups and UI tweaks. Still + work in progress. + + * plug-ins/gfig/pix-data.h: removed this empty, unused file. + +2004-10-30 Sven Neumann <sven@gimp.org> + + * app/config/gimpguiconfig.[ch] + * app/config/gimprc-blurbs.h + * app/dialogs/preferences-dialog.c + * app/tools/gimpmoveoptions.[ch] + * app/tools/gimpmovetool.[ch]: reverted changes for bug #156801. + Instead added a gimprc option that allows to get the old behaviour + back. + +2004-10-30 Sven Neumann <sven@gimp.org> + + * app/tools/gimpmoveoptions.[ch] + * app/tools/gimpmovetool.[ch]: applied (cleaned up version of) a + patch from Joao S. O. Bueno that adds a tool-option to restore the + old Move tool behaviour. Fixes bug #156801. + +2004-10-30 Sven Neumann <sven@gimp.org> + + * plug-ins/common/despeckle.c: applied a patch from Geert Jordaens + that improves the Despeckle algorithm. See bug #72862. + +2004-10-29 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/siod-wrapper.c (init_constants): Updated to + use convert_string() to change name of constant to Scheme format. + +2004-10-30 Sven Neumann <sven@gimp.org> + + * INSTALL + * NEWS + * README: updated for 2.2 pre-releases. + +2004-10-30 Sven Neumann <sven@gimp.org> + + * plug-ins/common/grid.c (run): applied patch by Joao S. O. Bueno + that implements the opacity parameters the way it is documented. + Fixes bug #156750. + +2004-10-30 Sven Neumann <sven@gimp.org> + + * plug-ins/common/glasstile.c: applied patch from Yeti, updated by + Kevin Cozens and modified by me. Fixes bug #85261. + +2004-10-29 Øyvind Kolås <pippin@gimp.org> + + * tools/pdbgen/pdb/color.pdb: moved body of code from here. + + * app/core/gimpdrawable-levels.[ch]: to here. + * app/core/Makefile.am: added gimpdrawable-levels.[ch]. + * app/pdb/color_cmds.c: regenerated. + + * app/actions/drawable-actions.c + * app/actions/drawable-commands.[ch]: added drawable-layers-auto + action. + + * app/widgets/gimphelp-ids.h: added GIMP_HELP_LAYER_WHITE_BALANCE. + * app/menus/image-menu.xml.in: added new auto/White Balance action. + * app/menus/image-menu.xml: regenerated. + +2004-10-29 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpuimanager.c (gimp_ui_manager_entry_load) + * app/widgets/gimpclipboard.c (gimp_clipboard_init): only be + verbose on request. + + * app/plug-in/plug-in.c (plug_in_close): turned warnings into + messages and respect gimp->be_verbose. + +2004-10-29 Øyvind Kolås <pippin@gimp.org> + + * app/actions/drawable-commands.[ch] + * app/actions/drawable-actions.[ch]: alphabetized file pending + addition. + +2004-10-29 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/test-sphere.scm: Added notes about + use of SF-PALETTE. + +2004-10-29 Sven Neumann <sven@gimp.org> + + * plug-ins/common/jpeg.c: pass the name in filesystem encoding to + gimp_image_set_filename(). Fixes bug #153751 for the JPEG plug-in. + +2004-10-29 Sven Neumann <sven@gimp.org> + + * app/file/file-utils.c (file_utils_uri_to_utf8_filename): when + the filename cannot be converted to UTF-8, warn and return the URI + instead. This is a workaround for the crash described in bug #153751. + +2004-10-29 Michael Natterer <mitch@gimp.org> + + * app/dialogs/dialogs.c (toplevel_entries): added foreign entries + for the keyboard shortcut and the controller action dialogs. + + * app/dialogs/preferences-dialog.c + * app/widgets/gimpcontrollereditor.c: register the dialogs with + the "toplevel" dialog factory so they remember their size and + position. + +2004-10-29 Michael Natterer <mitch@gimp.org> + + * plug-ins/dbbrowser/gimpprocbrowser.c + * plug-ins/dbbrowser/plugin-browser.c: don't say "1 Procedures" or + "1 Plug-In Interfaces" but use the singular form instead. + +2004-10-29 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/flarefx.c + * plug-ins/common/nova.c: changed preview cursors to GDK_CROSSHAIR. + + * plug-ins/common/iwarp.c + * plug-ins/gflare/gflare.c + * plug-ins/ifscompose/ifscompose.c: added GDK_CROSSHAIR preview + cursors. Not quite perfect for IfsCompose (actually needs tool- + and constext-sensitive cursors) but definitely better than + before. Fixes bug #90519. + +2004-10-29 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/edit.pdb: mention gimp_drawable_fill() in the + docs for gimp_edit_fill(). + + * app/pdb/edit_cmds.c + * libgimp/gimpedit_pdb.c: regenerated. + +2004-10-28 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-arc.c + * plug-ins/gfig/gfig-bezier.c + * plug-ins/gfig/gfig-bezier.h + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dialog.h + * plug-ins/gfig/gfig-dobject.c + * plug-ins/gfig/gfig-dobject.h + * plug-ins/gfig/gfig-ellipse.c + * plug-ins/gfig/gfig-grid.c + * plug-ins/gfig/gfig-grid.h + * plug-ins/gfig/gfig.c: small cleanups + +2004-10-28 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablecombobox.c + * libgimp/gimpimagecombobox.c: changed the API docs to suggest to + use gimp_int_combo_box_connect() with these widgets. We don't want + more people to be caught by bug #156659. + +2004-10-28 Sven Neumann <sven@gimp.org> + + * plug-ins/common/grid.c: fixed a long-standing cut'n'paste bug + which caused the intersection color to be drawn with the wrong + shade of gray when drawing on a grayscale drawable. + +2004-10-28 Sven Neumann <sven@gimp.org> + + * app/dialogs/resize-dialog.c: added the offset area back. Still + work in progress. + +2004-10-28 Sven Neumann <sven@gimp.org> + + * plug-ins/helpbrowser/dialog.c: only create a "Document not + found" error page if the requested URL was a page to load, not a + supplementary URL like an image. Fixes bug #138275. + +2004-10-28 Sven Neumann <sven@gimp.org> + + * plug-ins/bmp/bmp.c + * plug-ins/common/CEL.c + * plug-ins/common/aa.c + * plug-ins/common/compressor.c + * plug-ins/common/csource.c + * plug-ins/common/dicom.c + * plug-ins/common/gbr.c + * plug-ins/common/gif.c + * plug-ins/common/gifload.c + * plug-ins/common/gih.c + * plug-ins/common/gtm.c + * plug-ins/common/header.c + * plug-ins/common/jpeg.c + * plug-ins/common/mng.c + * plug-ins/common/pat.c + * plug-ins/common/pcx.c + * plug-ins/common/pix.c + * plug-ins/common/png.c + * plug-ins/common/pnm.c + * plug-ins/common/postscript.c + * plug-ins/common/psd.c + * plug-ins/common/psd_save.c + * plug-ins/common/psp.c + * plug-ins/common/sunras.c + * plug-ins/common/svg.c + * plug-ins/common/tga.c + * plug-ins/common/tiff.c + * plug-ins/common/url.c + * plug-ins/common/wmf.c + * plug-ins/common/xbm.c + * plug-ins/common/xpm.c + * plug-ins/common/xwd.c + * plug-ins/faxg3/faxg3.c + * plug-ins/fits/fits.c + * plug-ins/gfli/gfli.c + * plug-ins/sgi/sgi.c + * plug-ins/winicon/main.c + * plug-ins/xjt/xjt.c: removed the calls to gimp_plugin_menu_register() + from all plug-ins. File plug-ins don't register into a menu any longer. + +2004-10-28 Sven Neumann <sven@gimp.org> + + * plug-ins/common/raw.c (query): do not install an extension for + the raw plug-in to avoid confusion with the dcraw format. + +2004-10-28 Sven Neumann <sven@gimp.org> + + * app/actions/layers-actions.c (layers_actions_update): do not set + the "layers-mask-add" action insensitive if there's no alpha channel. + + * app/actions/layers-commands.c (layers_add_mask_response): add an + alpha channel if there isn't one already. Fixes bug #156676. + +2004-10-28 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c (script_fu_interface): + use gimp_int_combo_box_connect() so that the initial selection + causes the "changed" callback to be run. Should fix bug #156659. + +2004-10-28 Øyvind Kolås <pippin@gimp.org> + + * app/display/gimpdisplayshell-preview.c: Improve preview accuracy of + perspective transform, by subdiving into a 5x5 grid. + + Fixes bug #152222. + +2004-10-27 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/display/gimpdisplayshell-preview.c: Really fixed all cases + of the perspective tool preview breaking with certain orientations by + using triangles instead of quads. + +2004-10-27 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/display/gimpdisplayshell-preview.c: Hopefully fixed all cases + of the perspective tool preview breaking with certain orientations. + +2004-10-27 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/enumcode.pl: Don't declare $first twice. + + * libgimp/Makefile.am: Be sure to distribute gimpenums.c.tail. + + * libgimp/gimpenums.c.tail: Added into CVS. + +2004-10-27 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-bezier.[ch]: added a notebook page for the + bezier tool options instead of yet another popup window. + + * plug-ins/gfig/gfig-dialog.c: modified accordingly and HIGed a bit. + +2004-10-27 Øyvind Kolås <pippin@gimp.org> + + * app/core/gimpdrawable-transform.c: made the fixed point used in + supersampling configurable (in source) and changed from 15.16 to + 21.10 fixed point. + + Fixes bug #128594 for drawables less than 2G wide. + +2004-10-27 Michael Schumacher <schumaml@gmx.de> + + * app/widgets/gimpwidgets-utils.c: fixed a typo in + #include "libgimpbase/gimpwin32-io.h" + +2004-10-27 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/gfig-dialog.[ch] + * plug-ins/gfig/gfig-poly.[ch] + * plug-ins/gfig/gfig-spiral.[ch] + * plug-ins/gfig/gfig-star.[ch] + * plug-ins/gfig/gfig.h: first step of moving all the hidden popup + dialogs for the tool options in a GtkNotebook showing the options + within one page for each tool. + +2004-10-27 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/enumcode.pl: removed trailing commmas from output. + +2004-10-27 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/enumcode.pl: fixed loop control in + _gimp_enums_init(). This caused all plug-ins to crash immidiately. + You will need to make sure that libgimp/gimpenums.c.tail is + recreated and appended to libgimp/gimpenums.c + +2004-10-27 Michael Natterer <mitch@gimp.org> + + * app/core/gimp-transform-utils.[ch]. switch from x1,y1,x2,y2 + bounding boxes to x,y,width,height ones. Added + gimp_transform_matrix_flip_free(). Renamed some parameters to be + consistent with others. Some internal cleanup. + + * app/tools/gimpperspectivetool.c + * app/tools/gimpscaletool.c + * app/tools/gimpsheartool.c + * tools/pdbgen/pdb/drawable_transform.pdb + * tools/pdbgen/pdb/transform_tools.pdb: changed accordingly. + + * tools/pdbgen/pdb/drawable_transform.pdb + * tools/pdbgen/pdb/transform_tools.pdb: guard all transform + wrappers with if(gimp_drawable_mask_intersect(...)), also the + ones which don't need the returned bounding box. + + * tools/pdbgen/pdb/drawable_transform.pdb: renamed some parameters + and added gimp_drawable_transform_matrix() which takes the 9 + coefficients of a 3x3 matrix for ultimate flexibility ;) + + * app/pdb/drawable_transform_cmds.c + * app/pdb/internal_procs.c + * app/pdb/transform_tools_cmds.c + * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. + +2004-10-27 Sven Neumann <sven@gimp.org> + + * app/actions/dockable-actions.c (dockable_toggle_actions): changed + menu label from "Show Image Menu" to "Show Image Selection". + + * app/widgets/gimpsizebox.c: unmarked a string for translation. + + * app/dialogs/scale-dialog.c: added back the message when scaling + an indexed image. + +2004-10-27 DindinX <dindinx@gimp.org> + + * libgimp/gimpaspectpreview.c: really use the second parameter of + gimp_aspect_preview_new (), so plug-ins can now really remember the + state of the preview between invocations. + + * libgimpwidgets/gimpscrolledpreview.c: fix a little typo + + * plug-ins/common/channel_mixer.c: fix a warning by using TRUE for a + boolean value (initial state of the preview) instead of a weird NULL. + +2004-10-27 Michael Natterer <mitch@gimp.org> + + * modules/controller_linux_input.c + * modules/controller_midi.c: don't g_free(error) but + g_clear_error(&error) the GError. + +2004-10-27 Sven Neumann <sven@gimp.org> + + * app/dialogs/resize-dialog.[ch]: started to redo the Resize + dialog in the style of the new Scale dialog. Only halfway done but + at least the new API is there. + + * app/actions/image-commands.c + * app/actions/layers-commands.c: changed accordingly. + + * app/dialogs/image-scale-dialog.c: cosmetics. + +2004-10-27 DindinX <dindinx@gimp.org> + + * plug-ins/gfig/*[ch]: preliminary cleanups: removed all trailing + spaces. + +2004-10-26 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/pdb/drawable_transform.pdb: removed abuse of init, + called pdb_misc in all procedures. + + * app/pdb/drawable_transform_cmds.c + * libgimp/gimpdrawabletransform_pdb.c: regenerated. + +2004-10-27 Sven Neumann <sven@gimp.org> + + * libgimp/Makefile.am (PDB_WRAPPERS_H, PDB_WRAPPERS_C): added new + files gimpdrawabletranform_pdb.[ch]. + +2004-10-27 Sven Neumann <sven@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/image-scale-dialog.[ch]: a wrapper around the scale + dialog that takes care of verifying the user input and optionally + asking for confirmation. Most of this moved out of image-commands.c. + + * app/actions/image-commands.c: use the new image scale dialog + even though it doesn't allow to edit the resolution yet. That's a + temporary regression that will get fixed soon. + + * app/actions/layers-commands.c: cosmetics. + + * app/dialogs/scale-dialog.c (scale_dialog_reset): also reset the + resolution. + + * app/widgets/gimpsizebox.c: fixed cut'n'paste error. + +2004-10-27 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpsizebox.[ch]: added a resolution label similar + to one in the template editor. Prepared for editable resolution, + work in progress... + + * app/dialogs/scale-dialog.[ch]: added resolution and resolution + unit parameters to ScaleDialogCallback. + + * app/actions/layers-commands.c: changed accordingly. + +2004-10-26 Sven Neumann <sven@gimp.org> + + * app/widgets/gimptemplateeditor.c: commented out the memory size + label. The visual clutter of it's bold appearance was IMO not + appropriate. I think the dialog is better without it. + + * app/widgets/gimpsizebox.c: added a pixel size label as in the + Image New dialog. + +2004-10-26 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/enumcode.pl: added gtk-doc comment for + gimp_enums_get_type_names(). + +2004-10-26 Sven Neumann <sven@gimp.org> + + * plug-ins/common/retinex.c: applied patch by Geert Jordaens that + lets Retinex deal with RGBA drawables. Closes bug #135594 again. + +2004-10-26 Sven Neumann <sven@gimp.org> + + Added new drawable transform API to the PDB. Largely based on + patches from Joao S. O. Bueno. Fixes bug #137053. + + * app/core/gimpdrawable-transform.[ch]: added missing parameters + to gimp_drawable_transform_flip(). + + * tools/pdbgen/pdb/transform_tools.pdb: changed accordinly. + + * app/base/base-enums.h + * app/core/core-enums.h: removed pdp-skip for GimpInterpolationType + and GimpTransformDirection enums. + + * libgimp/gimpenums.h + * plug-ins/pygimp/gimpenums.py + * tools/pdbgen/enums.pl + * tools/pdbgen/groups.pl: regenerated. + + * tools/pdbgen/Makefile.am + * tools/pdbgen/pdb/drawable_transform.pdb: added new file defining + the new PDB calls. + + * app/pdb/Makefile.am + * app/pdb/drawable_transform_cmds.c + * app/pdb/internal_procs.c + * app/pdb/transform_tools_cmds.c + * libgimp/gimp_pdb.h + * libgimp/gimpdrawabletransform_pdb.[ch]: regenerated. + +2004-10-26 Michael Natterer <mitch@gimp.org> + + * modules/controller_linux_input.c + * modules/controller_midi.c: don't enter an infinite blocking loop + when the user selects an input file that can be opened, but not + read (like a directory). + +2004-10-26 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpactionview.[ch] (gimp_action_view_new): added + parameter "const gchar *select_action" and preselect the passed + action if non-NULL. Made the column enum public to users of this + widget can get data from its tree store. + + * app/dialogs/preferences-dialog.c (prefs_keyboard_shortcuts_dialog): + pass NULL because we don't want a preselected action here. + + * app/widgets/gimpcontrollereditor.[ch]: added "Edit" and "Delete" + buttons to change the event -> action mapping. Implement a action + chooser dialog using GimpActionView. Fixes bug #106920. + +2004-10-26 Sven Neumann <sven@gimp.org> + + * app/actions/channels-commands.c + * app/core/gimpchannel-select.c + * app/core/gimpimagefile.c + * app/core/gimpundo.c + * app/widgets/gimpcomponenteditor.c: use the new enum utility + functions from libgimpbase instead of accessing enum_value->value_name. + +2004-10-26 Michael Natterer <mitch@gimp.org> + + * app/dialogs/quit-dialog.c (quit_dialog_container_changed): when + changing the button's label to "Quit", also make it the default + action. + +2004-10-26 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcontrollereditor.[ch]: new widget built from + preliminary code from the prefs dialog. Prerequisite for finally + fixing bug #106920. + + * app/dialogs/preferences-dialog.c: use the new widget. + +2004-10-26 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/retinex.c: cleaned up the GUI and GIMP-specific + code a bit. Use gimp_drawable_mask_intersect(). + +2004-10-25 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/enumcode.pl: Use $1 instead of deprecated \1 for + regexp group. + +2004-10-26 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call): + my last change removed the sanity check for array_length >= 0. + Put it back. + +2004-10-26 Michael Natterer <mitch@gimp.org> + + * libgimpbase/gimpbase.def: updated. + +2004-10-25 DindinX <dindinx@gimp.org> + + * plug-ins/common/retinex.c: added this new plug-in. + Addresses bug #135594 + + * plug-ins/common/plugin-defs.pl: modified accordingly. + + * plug-ins/common/.cvsignore + * plug-ins/common/Makefile.am: regenerated. + + * plug-ins/gfig/gfig-arc.c + * plug-ins/gfig/gfig-arc.h + * plug-ins/gfig/gfig-circle.c + * plug-ins/gfig/gfig-circle.h + * plug-ins/gfig/gfig-dialog.c: smallish style cleanups + +2004-10-25 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call): + silently accept arrays which are longer than specified. Nothing + bad can happen and it's common practice to resize arrays in fixed + size chunks so avoid frequent resizing. Fixes bug #155359. + +2004-10-25 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/siod-wrapper.c (init_constants): removed + debugging output i forgot. + +2004-10-25 Sven Neumann <sven@gimp.org> + + * app/dialogs/quit-dialog.c: change the action button's label to + "Quit" if there are no images with unsaved changes. + +2004-10-25 Michael Natterer <mitch@gimp.org> + + * libgimpbase/gimpbaseenums.[ch]: register some missing enums. + + * tools/pdbgen/enumcode.pl: removed code to generate + plug-ins/script-fu/script-fu-constants.c, generate code to + explicitely initialize and query all of libgimp*'s enums + and write it to libgimp/gimpenums.c.tail + + * libgimp/gimpenums.h: regenerated. + + * libgimp/Makefile.am: append gimpenums.c.tail to gimpenums.c + + * libgimp/gimp.c (gimp_main): call g_type_init() and + _gimp_enums_init(). + + * libgimp/gimp.def: added gimp_enums_get_type_names(). + + * plug-ins/script-fu/Makefile.am + * plug-ins/script-fu/script-fu-constants.[ch]: removed these files. + + * plug-ins/script-fu/siod-wrapper.c: dynamically register all + constants using gimp_enums_get_type_names() and introspection. + Also register the built-in unit types. + + * plug-ins/script-fu/script-fu.c: changed accordingly. + +2004-10-25 Michael Natterer <mitch@gimp.org> + + Don't store human readable and translatable enum/flag strings in + GEnumValue's and GTypeValue's fields but attach them to their + GType using separate structs and utility functions: + + * tools/gimp-mkenums: added params and perl voodoo to support + generating a second array of values, which is used by the + Makefiles below to create and register arrays of value + descriptions. + + * libgimpbase/gimpbasetypes.[ch]: added API to attach/retreive + arrays of translatable strings to/from enum and flags types. Added + structs GimpEnumDesc and GimpFlagsDesc for that purpose. + + * libgimpbase/gimputils.[ch]: changed existing enum utility + functions, added new ones and added a symmetric API for flags. + + * app/base/Makefile.am + * app/core/Makefile.am + * app/display/Makefile.am + * app/paint/Makefile.am + * app/text/Makefile.am + * app/tools/Makefile.am + * app/widgets/Makefile.am + * libgimp/Makefile.am + * libgimpbase/Makefile.am: changed *-enums.c generation rules + accordingly. + + * app/base/base-enums.c + * app/core/core-enums.c + * app/display/display-enums.c + * app/paint/paint-enums.c + * app/text/text-enums.c + * app/tools/tools-enums.c + * app/widgets/widgets-enums.c + * libgimpbase/gimpbaseenums.c: regenerated. + + * app/widgets/gimpenumstore.c + * app/widgets/gimpenumwidgets.c + * app/widgets/gimptemplateeditor.c + * libgimpwidgets/gimppreviewarea.c: follow the enum utility + function API changes. + +2004-10-25 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_cmd_gimp_guides.c + * plug-ins/imagemap/imap_edit_area_info.c + * plug-ins/imagemap/imap_main.c + * plug-ins/imagemap/imap_menu.[ch] + * plug-ins/imagemap/imap_menu_funcs.[ch] + * plug-ins/imagemap/imap_misc.c + * plug-ins/imagemap/imap_settings.c + * plug-ins/imagemap/imap_source.c: added a menu entry for Help. + Did more minor layout adjustments for HIG compliance. + +2004-10-25 Michael Natterer <mitch@gimp.org> + + * app/core/gimpobject.c: #include "libgimpbase/gimpbase.h", not + just gimputils.h + +2004-10-25 Michael Natterer <mitch@gimp.org> + + * menus/toolbox-menu.xml.in: commented out the "Debug" submenu. + Should do this via an xsltproc --param actually... + +2004-10-25 DindinX <dindinx@gimp.org> + + * plug-ins/common/newsprint.c: removed debugging g_print and + remove my memory fix, since it was buggy and shouldn't be done. + My fix just broke this plug-in (reported by Joao S. O. Bueno + Calligaris) + +2004-10-25 Simon Budig <simon@gimp.org> + + * app/tools/gimpvectortool.c: Switch to design mode when + Escape gets pressed. Untabbified. + +2004-10-25 Michael Natterer <mitch@gimp.org> + + * app/actions/gradient-editor-commands.c + * app/display/gimpdisplayshell-preview.c: irrelevant coding style + and spacing cleanups. + + * app/widgets/gimpimageeditor.c: removed utility function + gimp_image_editor_context_changed() and connect + gimp_image_editor_set_image() directly using + g_signal_connect_swapped(). + +2004-10-25 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_circle.c + * plug-ins/imagemap/imap_cmd_gimp_guides.c + * plug-ins/imagemap/imap_cmd_guides.c + * plug-ins/imagemap/imap_default_dialog.[ch] + * plug-ins/imagemap/imap_edit_area_info.c + * plug-ins/imagemap/imap_grid.c + * plug-ins/imagemap/imap_main.c + * plug-ins/imagemap/imap_misc.c + * plug-ins/imagemap/imap_polygon.c + * plug-ins/imagemap/imap_preferences.c + * plug-ins/imagemap/imap_rectangle.c + * plug-ins/imagemap/imap_selection.c + * plug-ins/imagemap/imap_source.c + * plug-ins/imagemap/imap_toolbar.c + * plug-ins/imagemap/imap_tools.c: reviewed for HIG + compliance. Various other minor fixes. Closes bug #150004. + +2004-10-25 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/test-sphere.scm: Added parameter + missing from argument list. + +2004-10-25 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/enumcode.pl + * libgimp/Makefile.am: register all enums in libgimp/gimpenums.h + with the type system. + + * libgimp/gimpenums.h: regenerated. + + * libgimp/gimp.def: updated. + +2004-10-25 Sven Neumann <sven@gimp.org> + + * configure.in: gimp_user_version should be 2.2. + + * libgimpmodule/Makefile.am (AM_CPPFLAGS): cleanup. + +2004-10-25 Sven Neumann <sven@gimp.org> + + * configure.in: + * app/Makefile.am + * tools/Makefile.am: bumped version to 2.2.0-pre1, set app version + to 2.2, reset other versions to 2.0. Changed library versioning so + we install with the same soname as gimp-2.0 again. + +2004-10-25 Sven Neumann <sven@gimp.org> + + * app/core/gimpimagefile.c (gimp_imagefile_get_desc_string): say + "Click to create preview" if no preview is available. + +2004-10-25 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpwidgets-utils.[ch]: added gimp_text_buffer_save() + which saves a GtkTextBuffer's contents to a file. + + * app/widgets/gimperrorconsole.c: use + gimp_editor_add_action_button() and removed all "clicked" + callbacks, including all file saving code. + + * app/actions/error-console-actions.c + * app/actions/error-console-commands.[ch]: added the code removed + above to the action callbacks. Use gimp_text_buffer_save(). + +2004-10-24 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpgradienteditor.[ch] + * app/widgets/gimppaletteeditor.[ch]: added public APIs for + zooming the editors. Use gimp_editor_add_action_button() to create + all buttons. Removed all button callbacks and all duplicated + button sensitivity logic. + + * app/widgets/gimpdataeditor.c (gimp_data_editor_set_data): update + the editor's UI manager if it exists. + + * app/actions/gradient-editor-actions.c + * app/actions/gradient-editor-commands.[ch]: added zoom actions + and callback and call gimp_gradient_editor_zoom(). Fixed + gradient_editor_actions_update() to actually set all items' + sensitivity (it was possible to modify read-only gradients and + even to crash GIMP). + + * app/actions/palette-editor-actions.c + * app/actions/palette-editor-commands.[ch]: changed "new" and + "zoom" actions to actually do their job instead of calling + gtk_button_clicked(editor->foo_button). + +2004-10-24 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcolormapeditor.c: removed the "Edit Color" + dialog callbacks and use gimp_editor_add_action_button() for + the edit button. Removed button sensitivity logic. Hide the + color dialog when the image's mode changes. + + * app/actions/colormap-editor-actions.c: added missing tooltip + for the edit action. + + * app/actions/colormap-editor-commands.c: implement the dialog + here. + +2004-10-24 DindinX <dindinx@gimp.org> + + * app/core/gimpdrawable-desaturate.c: only return early if there's + nothing to desaturate. + +2004-10-24 Michael Natterer <mitch@gimp.org> + + * app/actions/vectors-commands.c: don't leak the filenames of the + import and export dialogs. + +2004-10-24 Michael Natterer <mitch@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/vectors-export-dialog.[ch] + * app/dialogs/vectors-import-dialog.[ch]: new files. + + * app/actions/vectors-commands.c: use the new dialogs and remember + their last values. + +2004-10-23 Sven Neumann <sven@gimp.org> + + * app/actions/vectors-commands.c: added missing controls to the + path import and export dialogs. + +2004-10-23 DindinX <dindinx@gimp.org> + + * plug-ins/common/newsprint.c: cleaned it up, fixed a (documented) + memory leak and the weird behaviour of the resolution scales. + +2004-10-23 DindinX <dindinx@gimp.org> + + * plug-ins/common/newsprint.c: added a preview. + +2004-10-23 Michael Natterer <mitch@gimp.org> + + * libgimp/gimpaspectpreview.h + * libgimp/gimpdrawablepreview.h + * libgimp/gimpprogressbar.h + * libgimpwidgets/gimpcellrenderercolor.h + * libgimpwidgets/gimpcellrenderertoggle.h + * libgimpwidgets/gimpframe.h + * libgimpwidgets/gimpintcombobox.h + * libgimpwidgets/gimpintstore.h + * libgimpwidgets/gimppreview.h + * libgimpwidgets/gimppreviewarea.h + * libgimpwidgets/gimpscrolledpreview.h: added padding to all class + structs which have been added since 2.0. + +2004-10-23 Michael Natterer <mitch@gimp.org> + + * app/actions/file-commands.c (file_save_cmd_callback): don't + g_return_if_fail() if there is no active drawable, just silently + return. + + * app/actions/image-commands.c: remember the last merge_type of + the "Merge Visible Layers" dialog. + + * app/actions/layers-commands.c: remeber the last values of the + "Add Layer Mask" dialog. + + * app/actions/select-commands.c: renamed a bunch of static + variables to be consistent with other variables used to remember + dialog values. + + * app/actions/view-commands.c (view_fullscreen_cmd_callback): it's + useless to update the "view-fullscreen" actions here because the + "fullscreen" state of the shell changes asynchronously + +2004-10-23 Michael Natterer <mitch@gimp.org> + + * app/dialogs/image-merge-layers-dialog.c + * app/dialogs/layer-add-mask-dialog.c: made them not resizable. + + * app/dialogs/convert-dialog.c + * app/dialogs/offset-dialog.c: renamed ugly variables. + + * app/dialogs/image-new-dialog.c + * app/dialogs/stroke-dialog.c: irrelevant pedantic code reordering. + +2004-10-23 Michael Natterer <mitch@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/image-merge-layers-dialog.[ch]: one more dialog split + out of actions/. + + * app/actions/image-commands.c: removed it here. Some cleanup. + +2004-10-23 Sven Neumann <sven@gimp.org> + + * libgimpthumb/gimpthumb-utils.[ch] + * libgimpthumb/gimpthumbnail.[ch] + * libgimpthumb/gimpthumb.def: added missing API, mainly for deleting + thumbnails. + + * app/core/gimpimagefile.[ch]: when saving a thumbnail, delete a + failure thumbnail if one exists. Unless the thumbnail was created + explicitely, remove all other thumbnails for this image. + + * app/actions/documents-commands.c: changed accordingly. + + * app/file/file-open.c: only save a thumbnail if there isn't a + valid thumbnail already. + + * app/widgets/gimpthumbbox.c: before attempting to create a new + thumbnail, check if there's an uptodate failure thumbnail. + +2004-10-23 Michael Natterer <mitch@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/layer-add-mask-dialog.[ch]: one more dialog split + out of actions/. + + * app/actions/layers-commands.c: removed it here. Some cleanup. + +2004-10-23 Michael Natterer <mitch@gimp.org> + + * autogen.sh: don't tell nonsense by printing "I am going to run + ./configure with no arguments", because we always pass at least + --enable-maintainer-mode. Instead, simply always print all + arguments. Also removed --copy from the calls to glib-gettextize + and intltoolize. + +2004-10-23 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpstock.c: added labels ("_Stroke") to the + SLEECTION_STROKE and PATH_STROKE stock items so they can be used + in action areas. + + * app/widgets/gimpstrokeeditor.c: changed mnemonic to no clash + with "_Stroke" and reordered some code. + + * app/dialogs/stroke-dialog.[ch]: use the passed stock_id instead + of GTK_STOCK_OK. Added parameters to specify the dialog's title + so it doesn't say "Stroke Options". + + * app/actions/select-commands.c + * app/actions/vectors-commands.c + * app/tools/gimpvectortool.c: pass "Stroke Selection" and "Stroke + Path" as dialog titles. + +2004-10-23 Michael Natterer <mitch@gimp.org> + + When there are variants of actions with and without dialog, let + the dialog-less actions try to use the values from the last dialog + invocation: + + * app/actions/channels-actions.c + * app/actions/channels-commands.[ch] + * app/actions/layers-actions.c + * app/actions/layers-commands.[ch] + * app/actions/vectors-actions.c + * app/actions/vectors-commands.[ch]: renamed the foo-new-defaults + actions to foo-new-last-values and use the last values entered in + the dialogs. + + * app/widgets/gimpchanneltreeview.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimpvectorstreeview.c: changed accordingly. Show + the dialog on clicking "New" and call the last-values action on + <shift>+click. + + * app/actions/select-actions.c + * app/actions/vectors-commands.c: renamed the foo-stroke-last-vals + to -last-values. + + * app/widgets/gimpselectioneditor.c + * app/widgets/gimpvectorstreeview.c: stroke with last values on + <shift> clicking the stroke buttons. + +2004-10-23 Sven Neumann <sven@gimp.org> + + * libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save): save to a + temporary file to avoid problems with concurrent thumbnail + creation. + +2004-10-23 Michael Natterer <mitch@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/layer-options-dialog.[ch]: the new/edit layer dialog. + + * app/actions/layers-commands.c: use it here. + +2004-10-22 Sven Neumann <sven@gimp.org> + + * app/tools/gimpimagemaptool.[ch] + * app/tools/gimpcurvestool.c + * app/tools/gimplevelstool.c: allow to Shift-click the Load and + Save buttons to skip the file chooser dialog and reuse the last + used filename. Fixes bug #75558. + +2004-10-22 Michael Natterer <mitch@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/template-options-dialog.[ch]: the new/edit template + dialog. + + * app/actions/templates-commands.c: removed the code here and use + template_options_dialog_new(). Removed utility functions. Some + cleanup. + +2004-10-22 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpeditor.c (gimp_editor_ensure_button_box): make + sure the button_box is always interted at the very bottom of the + editor. + + * app/widgets/gimpviewabledialog.c: changed the "description" + property from CONSTRUCT_ONLY to CONSTRUCT. + + * app/widgets/gimpcolormapeditor.c: show the index of the edited + color in the color dialog and use the correct icon. Replaced label + "Hex triplet" by "HTML notation" to be consistent with the color + dialog. Removed wrong 2 pixel border around the table below the + preview. + +2004-10-22 Sven Neumann <sven@gimp.org> + + * plug-ins/common/wmf.c: fixed non-interactive call with default + values. + +2004-10-22 Sven Neumann <sven@gimp.org> + + * app/actions/colormap-editor-actions.c + * app/actions/dialogs-actions.c + * app/core/gimpimage-colormap.c + * app/dialogs/convert-dialog.c + * app/dialogs/dialogs.c + * app/widgets/gimpcolormapeditor.c: use the term "Colormap" + instead of "Indexed Palette". Fixes bug #155829. + +2004-10-22 Sven Neumann <sven@gimp.org> + + * plug-ins/common/wmf.c: applied a patch by Karine Proot that adds + a preview to the load dialog and a similar UI as the SVG loader. + Fixes bug #133519 and bug #133521. + +2004-10-22 Michael Natterer <mitch@gimp.org> + + * app/core/core-enums.[ch]: added new enum GimpStrokeMethod which + can be one of { LIBART, PAINT_CORE }. + + * app/core/Makefile.am + * app/core/core-types.h + * app/core/gimpstrokedesc.[ch]: new object which encapsulates + the params and setup logic for the different stroke methods. + + * app/core/gimpitem.[ch]: use it in GimpItem::stroke() and + in the gimp_item_stroke() wrapper. + + * app/core/gimpchannel.c (gimp_channel_stroke) + * app/core/gimpselection.c (gimp_selection_stroke) + * app/vectors/gimpvectors.c (gimp_vectors_stroke): changed accprdingly. + + * app/actions/select-commands.c + * app/actions/vectors-commands.c + * app/dialogs/stroke-dialog.c + * tools/pdbgen/pdb/edit.pdb + * tools/pdbgen/pdb/paths.pdb: use GimpStrokeDesc. Simplifies the + code quite a bit. + + * app/pdb/edit_cmds.c + * app/pdb/paths_cmds.c: regenerated. + +2004-10-22 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimppropwidgets.c: remember the param_spec with each + radio button instead of with the box/frame around them. + +2004-10-21 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/script-fu.c: Removed _() tag from two strings + that should not have been marked for translation. + +2004-10-21 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts-fu.c: Fixed spelling error. + +2004-10-21 Michael Natterer <mitch@gimp.org> + + * app/actions/select-actions.c + * app/actions/select-commands.[ch] + * app/actions/vectors-actions.c + * app/actions/vectors-commands.[ch]: added actions and callbacks + to stroke with the last values used without showing the stroke + dialog. The actions have no menu entries but can be called via + shortcuts. Fixes bug #135746. + + (Disclaimer: the uglyness of the callbacks shows the need for a + stroke API overhaul). + +2004-10-20 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable-stroke.c + (gimp_drawable_stroke_scan_convert): Replacing the call to + gimp_channel_is_empty() by a simple gimp_drawable_mask_intersect() + was wrong because gimp_channel_is_empty() makes sure that the + selection doesn't mask itself while being stroked. + +2004-10-20 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/raw.c: ported to GimpPreviewArea. + +2004-10-20 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/raw.c: new plug-in from Tim Copperfield, made + work with the GIMP 2.1 API by Philipp Gühring, then heavily + cleaned up and undeprecated by myself. Fixes bug #144943. + + (still uses GtkPreview, but i wanted a sane state in cvs to diff + against before replacing it) + + * plug-ins/common/plugin-defs.pl: changed accordingly. + + * plug-ins/common/Makefile.am: regenerated. + +2004-10-20 Michael Natterer <mitch@gimp.org> + + Fixed bug #155733 for libgimp: + + * tools/pdbgen/pdb/drawable.pdb: export drawable_mask_intersect() + to the PDB and improved documentation for drawable_mask_bounds(). + + * app/pdb/drawable_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpdrawable_pdb.[ch]: regenerated. + + * libgimp/gimp.def: changed accordingly. + +2004-10-20 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable.[ch]: added gimp_drawable_mask_intersect() + which returns the same bounding box as gimp_drawable_mask_bounds(), + but returns TRUE only if there is a non-empty intersection between + the drawable and the selection, or no selection at all. It also + returns the intersection as x,y,width,height instead of the + eeky x1,y1,x2,y2. + + * app/core/gimp-edit.c + * app/core/gimpdrawable-blend.c + * app/core/gimpdrawable-bucket-fill.c + * app/core/gimpdrawable-desaturate.c + * app/core/gimpdrawable-equalize.c + * app/core/gimpdrawable-histogram.c + * app/core/gimpdrawable-invert.c + * app/core/gimpdrawable-stroke.c + * app/core/gimpimagemap.c + * app/core/gimpselection.c + * tools/pdbgen/pdb/color.pdb + * tools/pdbgen/pdb/transform_tools.pdb: either switch from + gimp_drawable_mask_bounds() to _intersect() or check the return + values of _mask_bounds() manually to avoid operations on empty + areas. Return successfully because it's a nop, not a failure. + Fixes bug #155733 for the core. + + * app/pdb/color_cmds.c + * app/pdb/transform_tools_cmds.c: regenerated. + +2004-10-19 Michael Natterer <mitch@gimp.org> + + * app/tools/gimptextoptions.c (gimp_text_options_gui): removed + 3 mnemonics. No other tool options label has a mnemonic. + Addresses bug #155861. + +2004-10-19 Michael Natterer <mitch@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/vectors-options-dialog.[ch]: one more dialog split + out of actions/. + + * app/actions/vectors-commands.c: removed it here. Merged more + utility functions into their only callers. + + * app/actions/dockable-commands.c + * app/actions/edit-commands.c + * app/actions/file-commands.c + * app/actions/palettes-commands.c + * app/actions/tool-options-commands.c + * app/actions/view-commands.c: renamed "qbox" and "query_box" + variables to "dialog". + +2004-10-19 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/screenshot.c (shoot_dialog): don't forget to set + the mnemonic widgets for the labels. Fixes bug #155811. + +2004-10-19 Michael Natterer <mitch@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/channel-options-dialog.[ch]: new files implementing + the channel options dialog with a horrid number of 13 construction + parameters. Still better than having the same code twice, only + differing in strings used... + + * app/actions/channels-commands.c + * app/actions/qmask-commands.c: removed the dialog code here and + use channel_options_dialog_new(). + +2004-10-19 Jay Cox <jaycox@gimp.org> + + * plug-ins/common/psd_save.c: don't try to save psd files that are + larger than 30000 pixels in either direction. Fixed the rle code + to compress more compactly. Fixed a memmory leak in + save_channel_data. + +2004-10-18 Michael Natterer <mitch@gimp.org> + + Action code review and pre-release consistency cleanup: + + * app/actions/*-actions.c: added some missing and resolved + conflicting mnemonics, added missing help IDs. Cleaned up the + *_actions_update() functions. + + * app/actions/channels-actions.c + * app/actions/layers-actions.c + * app/actions/vectors-actions.c (*_actions_update): simplified + the code that figures the prev and next channel,layer,vectors. + + * app/actions/qmask-actions.c: use the same accelerator for + "qmask-active" and "qmask-toggle". Fixed action sensitivity. + + * app/actions/channels-commands.c + * app/actions/dockable-commands.c + * app/actions/documents-commands.c + * app/actions/gradients-commands.c + * app/actions/layers-commands.c + * app/actions/palettes-commands.c + * app/actions/image-commands.c + * app/actions/select-commands.c + * app/actions/vectors-commands.c: folded tons of private utility + functions into their only callers (they used to be public and + called from outside before the switch to action based menus). + Renamed functions and variables saying "query" or "qbox" to + "dialog". Moved static functions to the end of the files. Misc + minor cleanups. + + * app/actions/drawable-actions.c + * app/actions/drawable-commands.c: made the "drawable-visible" and + "drawable-linked" actions affect the layer if the active drawable + is a layer mask. + + * app/actions/select-commands.c: added action to stroke with the + last values used in an attempt to address bug #135746 but #if 0'ed + it because the approach is too ugly. + + * app/tools/gimpiscissorstool.c: changed mnemonic from I to S. + + * menus/image-menu-xml.in: added more stuff to the (commented out) + "context" menu. + +2004-10-17 DindinX <dindinx@gimp.org> + + * libgimp/gimppixelrgn.c: some more clues in the documentation + (suggested by nomis) + +2004-10-17 DindinX <dindinx@gimp.org> + + * libgimp/gimppixelrgn.c: clarify some usecases for + gimp_pixel_rgn_init(). + +2004-10-17 DindinX <dindinx@gimp.org> + + * plug-ins/common/colortoalpha.c: Added a preview. + +2004-10-17 DindinX <dindinx@gimp.org> + + * plug-ins/common/glasstile.c: use a GimpDrawablePreview. + +2004-10-17 DindinX <dindinx@gimp.org> + + * plug-ins/common/borderaverage.c: smallish cleanups. + +2004-10-17 DindinX <dindinx@gimp.org> + + * plug-ins/common/displace.c: Added a preview and minor cleanups. + Can someone provide useful testcases for this plug-in? + +2004-10-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpitemtreeview.[ch]: moved "item_type" and + "signal_name" from GimpItemTreeView to GimpItemTreeViewClass. + Removed them from gimp_item_tree_view_new(). Require the view_type + instead of item_type in gimp_item_tree_view_new(). + + * app/widgets/gimpitemtreeview.c + * app/widgets/gimpdrawabletreeview.c (get_type): made them + abstract base classes. + + * app/widgets/gimpchanneltreeview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimpvectorstreeview.c (class_init): set the + item_type and signal_name members if GimpItemTreeViewClass. + + * app/dialogs/dialogs-constructors.c: changed accordingly. + +2004-10-16 Manish Singh <yosh@gimp.org> + + * autogen.sh: Add support for automake 1.9. Also rm autom4te.cache, + since it might interfere with differing autoconf versions. + +2004-10-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpuimanager.[ch]: added utility function + gimp_ui_manager_get_action() which takes "group_name" and + "action_name". + + * app/display/gimpdisplayshell-close.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimptoolbox.c + * app/widgets/gimptooloptionseditor.c: use it. + +2004-10-16 Michael Natterer <mitch@gimp.org> + + * app/actions/channels-actions.c + * app/actions/colormap-editor-actions.c + * app/actions/documents-actions.c + * app/actions/tool-options-actions.c + * app/actions/vectors-actions.c: added more tooltips for actions + which are used as extended dialog button callbacks. + + * app/widgets/gimpeditor.c (gimp_editor_add_action_button): keep + the list of extended actions in reverse order. + + * app/widgets/gimpchanneltreeview.c + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimpdocumentview.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimpselectioneditor.c + * app/widgets/gimptooloptionseditor.c + * app/widgets/gimpvectorstreeview.c: don't set the tooltips + manually. Removes another bunch of insane translatable multiline + format strings. Pass the extended actions in the right order + to gimp_editor_add_action_button(). + +2004-10-16 Michael Natterer <mitch@gimp.org> + + * app/actions/vectors-commands.c (vectors_linked_cmd_callback): + call gimp_item_set_linked(), not gimp_item_set_visible(). + Fixes bug #155578 + +2004-10-16 Michael Natterer <mitch@gimp.org> + + Ported the layers, channels and paths dialogs from + gimp_editor_add_button() to gimp_editor_add_action_button(), + removing a massive amount of duplicated code, sensitivity logic + and confusing utility functions. + + * app/actions/channels-actions.c + * app/actions/channels-commands.[ch] + * app/actions/layers-actions.c + * app/actions/layers-commands.[ch] + * app/actions/vectors-actions.c + * app/actions/vectors-commands.[ch]: added "foo-new-default" + actions and callbacks which create items without a dialog, + optionally using default values from a passed template. Removed + all public utility function that were passed as function pointers + to widget construtors. Added tooltips to all actions which are now + used for dialog buttons. + + * app/widgets/gimpeditor.c (gimp_editor_add_action_button): + automatically create multi-line tooltips showing the modifiers for + extended action buttons. Removes the need for lots of insane + format strings that need to be translated correctly. + + * app/widgets/gimpitemtreeview.[ch] (struct GimpItemTreeViewClass): + replaced tooltip and help_id strings by action names. + + (struct GimpItemTreeView) + (gimp_item_tree_view_new): removed "edit", "new" and "activate" + function pointers. + + (gimp_item_tree_view_constructor): create all buttons + with gimp_editor_add_action_button(), using the action names + from GimpItemTreeViewClass. + + Removed tons of "clicked" callbacks and all code which sets the + buttons' sensitivity. They are not needed any longer. + + Require all subclasses to implement GimpItemTreeView::new_item(), + a new virtual function which creates a plain new item without + showing a dialog. + + * app/widgets/gimpdrawabletreeview.c + * app/widgets/gimpchanneltreeview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimpvectorstreeview.c: fill in the action names and + implement GimpItemTreeView::new_item(). Removed all button + sensitivity logic. + + * app/dialogs/dialogs-constructors.c: changed accordingly. Doesn't + include anything from actions/ any more. + +2004-10-15 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/layer.pdb: fixed parameter descriptions for + layer_add_mask() and layer_remove_mask(). + + * app/pdb/layer_cmds.c + * libgimp/gimplayer_pdb.c: regenerated. + +2004-10-15 Michael Natterer <mitch@gimp.org> + + * app/actions/images-commands.[ch] + * app/actions/templates-commands.[ch]: made some public functions + private or removed them entirely by folding their code into their + callers. They used to be passed as function pointers to widgets in + the pre action-based dialog buttons era. + +2004-10-15 Michael Natterer <mitch@gimp.org> + + * app/dialogs/quit-dialog.c: raise the image's displays on + double-click in the dirty image list. + +2004-10-15 Michael Natterer <mitch@gimp.org> + + Fixed bug #155328: + + * app/actions/vectors-actions.c (vectors_actions_update): don't + set the "selection to path" actions sensitive if there is no + image. + + * app/widgets/gimpitemtreeview.c: update the UI manager after + setting the view's image. Connect to GimpImage::flush() and + update the UI manager in the callback, too. + +2004-10-15 Michael Natterer <mitch@gimp.org> + + * app/actions/view-actions.c (view_zoom_actions): removed + duplicate "view-zoom-in" action (cut'n'paste error) and fixed the + swapped "zoom in/out a lot" actions. Fixes bug #155446. + +2004-10-15 Sven Neumann <sven@gimp.org> + + * Made 2.1.7 release. + +2004-10-15 Sven Neumann <sven@gimp.org> + + * app/tools/gimptransformoptions.c: removed the "Density" label. + It wasn't helpful and caused the transform options to be wider than + necessary. + + * app/tools/gimpblendoptions.c + * app/tools/gimppaintoptions-gui.c + * app/tools/gimptransformoptions.c: let combo boxes expand + horizontally like we do in other (all?) dialogs. + + * app/widgets/gimptemplateeditor.c + (gimp_template_editor_aspect_callback): update the pixel size label. + +2004-10-15 Sven Neumann <sven@gimp.org> + + * data/images/gimp-splash.png: new splash by Jimmac. + +2004-10-15 DindinX <dindinx@gimp.org> + + * plug-ins/common/scatter_hsv.c: ported to GimpDrawablePreview, and + removed many lines of codes. + +2004-10-14 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/neon.scm: Fixed minor error in script. + (Related to bug #153900 and compatability with Tiny-Fu) + +2004-10-14 DindinX <dindinx@gimp.org> + + * plug-ins/common/neon.c: fixed the handling of drawable with alpha. + +2004-10-14 DindinX <dindinx@gimp.org> + + * plug-ins/common/nlfilt.c: Ported to GimpDrawablePreview, the + previous preview was absolutely useless. Done some cleanups, too. + + * plug-ins/common/spread.c: remember the preview state between + invocations. + +2004-10-14 DindinX <dindinx@gimp.org> + + * plug-ins/common/emboss.c: use a GimpDrawablePreview instead of a + GimpAspectPreview, since this plug-in is somewhat edge-oriented and + this makes the code simpler ;) + +2004-10-14 Michael Natterer <mitch@gimp.org> + + * themes/Default/images/stock-gradient-bilinear-16.png + * themes/Default/images/stock-gradient-linear-16.png: rotate them + by 90 degrees. All our gradient previews and icons go left->right, + not top->bottom. + +2004-10-14 Manish Singh <yosh@gimp.org> + + * plug-ins/common/bmpread.c: Make sure we have a bpp value we can + handle, and fail gracefully if not. Fixes bug #155401. + +2004-10-14 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpwidgets.c + * app/widgets/gimpenumwidgets.[ch] + * app/widgets/gimppropwidgets.c + * app/actions/layers-commands.c + * app/dialogs/convert-dialog.c + * app/tools/gimpblendoptions.c + * app/tools/gimpbucketfilloptions.c + * app/tools/gimpcolorbalancetool.c + * app/tools/gimpcolorizetool.c + * app/tools/gimpcoloroptions.c + * app/tools/gimpcurvestool.c + * app/tools/gimphuesaturationtool.c + * app/tools/gimpinkoptions-gui.c + * app/tools/gimplevelstool.c + * app/tools/gimppaintoptions-gui.c + * app/tools/gimpselectionoptions.c + * app/tools/gimptransformoptions.c: the child of a GimpFrame must + not have any border width. Fixes many subtle misalignments. + +2004-10-14 Sven Neumann <sven@gimp.org> + + * app/core/gimpprogress.[ch]: added "message" function to the + GimpProgress interface. Call gimp_message() if it is unimplemented. + + * app/plug-in/plug-in-progress.[ch]: added new function + plug_in_progress_message() that passes the message to the current + proc_frame's progress. + + * app/widgets/gimpthumbbox.c: implement GimpProgress::message. + Just do nothing in the implementation. We don't want to see + messages from file plug-ins that we use to create the thumbnails. + + * tools/pdbgen/pdb/message.pdb + * app/pdb/message_cmds.c: if there's a current plug-in, dispatch + the message by calling plug_in_progress_message(). + + * app/display/gimpdisplayshell-close.c: fixed wrong types in + function calls. + +2004-10-14 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcolordialog.c (gimp_color_dialog_new): use + GIMP_HELP_COLOR_DIALOG as help_id. + +2004-10-14 Michael Natterer <mitch@gimp.org> + + * app/actions/dialogs-commands.c: purely cosmetic. + +2004-10-14 Michael Natterer <mitch@gimp.org> + + * app/core/core-enums.[ch]: register GimpConvertPaletteType with + the type system. + + * tools/pdbgen/enums.pl: regenerated. + + * app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add): + fixed to insert the widget at the right place in the radio box. + + * app/dialogs/convert-dialog.c: use enum widgets and + gimp_enum_radio_frame_add(), resulting in a much better looking + dialog with much less lines of code. + +2004-10-14 Sven Neumann <sven@gimp.org> + + * plug-ins/helpbrowser/dialog.c: changed "Home" button to "Index". + "Home" is misleading and leads to problems in some locales (see + bug #148120). + +2004-10-14 Michael Natterer <mitch@gimp.org> + + * tools/authorsgen/contributors: correct UTF-8 spelling of + João S. O. Bueno Calligaris. + + * AUTHORS + * app/dialogs/authors.h: regenerated. + +2004-10-14 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/circuit.scm: Fixed to allow use of + script on original layer. (bug #155358) Fixed spelling error. + +2004-10-13 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/Makefile.am: Remove stamp files during + maintainer-clean. Addresses bug #155357. Also flesh out the + dependencies some so rebuilds get triggered when all their + dependent files change. + +2004-10-14 Sven Neumann <sven@gimp.org> + + * app/actions/file-commands.c (file_revert_cmd_callback): creata + an UTF-8 filename from the image URI and display that instead of + the URI. + + * app/dialogs/convert-dialog.c (convert_dialog_new): removed the + palette size warning for transparent images. The number of colors + is already adjusted to 255. This text was IMO more frightening + than helpful. + +2004-10-13 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/add-bevel.scm: two variables were + not defined before first use (bug #153900). + +2004-10-13 Kevin Cozens <kcozens@cvs.gimp.org> + + * app/widgets/gimpactionview.c: Fixed a spelling error. + +2004-10-13 DindinX <dindinx@gimp.org> + + * plug-ins/common/colorify.c: Added a preview. + +2004-10-13 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.c: removed trailing whitespace. + + * libgimpwidgets/gimpwidgets.def: added + gimp_preview_set_default_cursor. + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpmessagedialog.c: improved handling of parent + widget; probably just being paranoid here. + + * app/actions/image-commands.c + * app/dialogs/image-new-dialog.c: ported memory size confirmation + dialogs to GimpMessageDialog. + +2004-10-13 DindinX <dindinx@gimp.org> + + * libgimpwidgets/gimppreview.[ch]: added a new function to set the + default cursor on preview: gimp_preview_set_default_cursor(). + + * libgimpwidgets/gimpscrolledpreview.c: changed accordlingly. + + * plug-ins/common/flarefx.c: + * plug-ins/common/nova.c: use this function. + + This addresses bug #90519. + +2004-10-13 DindinX <dindinx@gimp.org> + + * plug-ins/common/cubism.c: Added a preview and done some cleanups. + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/actions/plug-in-commands.c + * app/actions/templates-commands.c + * app/actions/tool-options-commands.c: ported more boolean queries + to GimpMessageDialog. + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpmessagedialog.c: handle parent widget not being + a GtkWindow by calling gtk_widget_get_toplevel(). + + * app/actions/data-commands.c + * app/actions/edit-commands.c + * app/actions/file-commands.c: ported more boolean queries to + GimpMessageDialog. + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpmessagedialog.[ch]: added a simple message + dialog to avoid code duplication. + + * app/widgets/gimpmessagebox.c: set the border width to 12 pixels. + + * app/dialogs/file-save-dialog.c + * app/dialogs/quit-dialog.c + * app/display/gimpdisplayshell-close.c + * app/widgets/gimperrordialog.c + * app/widgets/gimphelp.c + * app/widgets/gimpactionview.c: use the new GimpMessageDialog. + +2004-10-13 Michael Natterer <mitch@gimp.org> + + * app/actions/image-actions.c + * menus/image-menu.xml.in: added menu branch "<Image>/Image/Guides". + + * plug-ins/script-fu/scripts/Makefile.am + * plug-ins/script-fu/scripts/guides-from-selection.scm + * plug-ins/script-fu/scripts/guides-new-percent.scm + * plug-ins/script-fu/scripts/guides-new.scm + * plug-ins/script-fu/scripts/guides-remove-all.scm: added new + scripts from Alan Horkan. Fixes bug #119667. + +2004-10-13 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/flarefx.c: cleaned up and simplified the + FlareCenter code even more. + + * plug-ins/common/nova.c: did the same changes for the NovaCenter + stuff. + + Also added code which sets an appropriate cursor on "realize" to + fix bug #90519, but GimpPreview currently prevents this from + working correctly... + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/widgets/widgets-enums.[ch]: changed the description for + GIMP_HELP_BROWSER_GIMP. + + * app/dialogs/file-save-dialog.c: + * app/widgets/gimphelp.c: use a GimpDialog embedding a + GimpMessageBox instead of gimp_query_boolean_box which looks + somewhat old fashioned. + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphelp.c: improved error messages on missing help + browser plug-in. + + * libgimpthumb/gimpthumb-utils.c + * libgimpthumb/gimpthumbnail.c: improved documentation. + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-close.c + (gimp_display_shell_close_dialog): changed button label. + +2004-10-12 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/asc2img.scm: Fixed error in name of + script used in second register line. + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-close.c: changed rounding. + +2004-10-13 Michael Natterer <mitch@gimp.org> + + * app/dialogs/image-new-dialog.c (image_new_response): don't + forget to reset the template combo on RESPONSE_RESET. + +2004-10-13 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplay-foreach.c: keep the container of dirty + images up to date. + + * app/dialogs/quit-dialog.c: fixed model/view behavior here, too. + + (both are still far from perfect) + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-close.c + (gimp_display_shell_close_dialog): keep the time uptodate. + +2004-10-13 Sven Neumann <sven@gimp.org> + + * app/core/gimpimagefile.c (gimp_imagefile_create_thumbnail): ref + the imagefile while creating the thumbnail. + + * app/core/gimpimagefile.[ch] + * app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): moved + the tricky part about thumbnail creation into the new function + gimp_imagefile_create_thumbnail_weak(). + +2004-10-13 Michael Natterer <mitch@gimp.org> + + * plug-ins/pagecurl/pagecurl.c: forgot to remove N_() from + gimp_plugin_menu_register(). + +2004-10-13 Michael Natterer <mitch@gimp.org> + + * app/dialogs/preferences-dialog.c (prefs_dialog_new): added + missing and resolved conflicting mnemonics. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/selection-round.scm: moved out of the + "Modify" placeholder. Using placeholders from Script-Fu breaks + i18n. We will need to change menu registration for scripts but + this will have to wait.. + +2004-10-12 Michael Natterer <mitch@gimp.org> + + * plug-ins/*/*.c: all plug-ins except script-fu: removed the + translation marks from the menu paths passed to + gimp_plugin_menu_register(). All default menu branches used by + included plug-ins are created and translated by the core now. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * app/core/gimpimage.[ch]: renamed struct member "unit" to + "resolution_unit". + + * app/actions/image-commands.c + * app/core/gimp-edit.c + * app/core/gimpimage-duplicate.c + * app/core/gimpimage-undo-push.c + * app/dialogs/info-window.c + * app/vectors/gimpvectors-export.c + * app/widgets/gimptoolbox-dnd.c: + * app/xcf/xcf-load.c + * app/xcf/xcf-save.c: changed accordingly. Use gimp_image_get_unit() + where appropriate. + + * app/core/gimptemplate.c (gimp_template_set_from_image): fixed + unit handling. Don't touch the template unit, it is used as the + initial display unit. This will need further changes... + +2004-10-12 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpwidgets-utils.c (gimp_enum_radio_frame_add): + need to pack the widget expanding. Fixes pattern container + entries. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * app/dialogs/info-window.[ch]: fixed unit handling. Right-align + the labels displaying the cursor position. Renamed the "Extended" + tab to "Cursor". Renamed the API accordingly. + + * app/display/gimpdisplayshell-cursor.c: changed accordingly. + +2004-10-12 Michael Natterer <mitch@gimp.org> + + * app/actions/drawable-commands.c (drawable_rotate_cmd_callback): + if the drawable is a channel, pass clip_result as FALSE. Need to + do this here for rotating only because it can't be decided + generically in GimpChannel. Fixes crash when rotating channels + or layer masks. + + Use the undo_desc from GimpItemClass instead of passing "Flip + Layer" and "Rotate Layer". + +2004-10-12 Sven Neumann <sven@gimp.org> + + * app/file/file-open.c: minor cleanup. + + * app/file/file-save.c (file_save_as): no need to fiddle with the + image name, the URI is taken from the imagefile anyway. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * app/actions/layers-actions.c (layers_actions_update): set + "layers-crop" insensitive if the selection is empty. + + * plug-ins/script-fu/scripts/alien-glow-button.scm + * plug-ins/script-fu/scripts/alien-glow-logo.scm + * plug-ins/script-fu/scripts/basic2-logo.scm + * plug-ins/script-fu/scripts/gradient-bevel-logo.scm: use "Sans + Bold" instead of "Futura_Poster". The underscore in the font name + used to confuse intltool (bug #137029) and the freefont package + isn't that widely used any longer anyway. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpsizebox.[ch]: added new widget GimpSizeBox. + + * app/widgets/gimppropwidgets.c: the order of setting the X and Y + properties does matter. + + * app/dialogs/Makefile.am + * app/dialogs/scale-dialog.[ch]: added first version of a new + Scale dialog in an attempt to address bug #151022. + + * app/actions/layers-commands.c: use the new scale dialog. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * app/widgets/gimptemplateeditor.c: added mnemonics for the size + entries. + +2004-10-12 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned): + instead of simply using the passed widget as mnemonic_widget for + the GtkLabel, call the new utility function find_mnemonic_widget() + which recursively searches the passed widget until it finds one + that actually can be mnemonic-activated. Fixes lots of mnemonics + where the attached widget is e.g. a GtkEventBox or GtkComboBox. + +2004-10-12 Michael Natterer <mitch@gimp.org> + + * app/tools/gimptooloptions-gui.[ch]: removed the recently added + utility functions again. + + * app/widgets/Makefile.am + * app/widgets/gimpviewablebox.[ch] + * app/widgets/gimpwidgets-utils.[ch]: and added cleaned up + versions here. + + * app/tools/gimpbucketfilloptions.c + * app/tools/gimpclonetool.c + * app/tools/gimppaintoptions-gui.c + * app/tools/gimptextoptions.c: changed accordingly. + + * app/dialogs/convert-dialog.c: use gimp_palette_box_new() instead + of reinventing the wheel. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpaction.c (gimp_action_set_proxy): use a larger + icon size for GimpImagefile views. + + * themes/Default/images/stock-frame-64.png: removed the 1 pixel + wide empty border around the frame. + + * app/widgets/gimpviewrenderer-frame.c: adjusted the hardcoded values. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * Makefile.am: defined DISTCHECK_CONFIGURE_FLAGS with the + configure options that are needed to run 'make dist'. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * app/widgets/gimptemplateeditor.c: tweaked table spacings to get + the Height label aligned with the entry again. + +2004-10-12 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpprogressdialog.c (gimp_progress_dialog_new): set + the "skip_taskbar_hint" and "skip_pager_hint" properties on the + progress window. + +2004-10-11 Manish Singh <yosh@gimp.org> + + * plug-ins/fp/fp.c: Moved from here... + + * plug-ins/common/fp.c: ... to here. + + * plug-ins/common/plugin-defs.pl: changed accordingly. + + * plug-ins/common/.cvsignore + * plug-ins/common/Makefile.am: regenerated. + + * configure.in + * plug-ins/Makefile.am + * plug-ins/fp: Removed directory. + +2004-10-11 DindinX <dindinx@gimp.org> + + * plug-ins/common/jigsaw.c: ported to GimpAspectPreview. + +2004-10-11 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/flarefx.c: use a GimpSizeEntry for specifying + the flare center. Fixed flare center dragging. Lots of cleanup. + +2004-10-11 Michael Natterer <mitch@gimp.org> + + * app/dialogs/dialogs-types.h: removed ColorDialog typedef. + +2004-10-11 Michael Natterer <mitch@gimp.org> + + * app/tools/gimptooloptions-gui.[ch]: added utility functions + which create a GimpViewableButton+GimpContainerEntry combo for + brushes, patterns, gradients and fonts and a very ugly utility + function which packs one of these combos into a GtkFrame returned + by gimp_prop_enum_radio_frame_new(). This stuff does not really + belong here but is too ugly to be moved to a more general place. + + * app/tools/gimpbucketfilloptions.c + * app/tools/gimppaintoptions-gui.c + * app/tools/gimptextoptions.c: use the new utility functions. Moved + the pattern previews into the radio frame where using the pattern + is selected. Make them insensitive if using the pattern is not + selected. + +2004-10-11 Sven Neumann <sven@gimp.org> + + * app/config/gimprc-blurbs.h: tweaked the thumbnail related blurbs. + + * app/dialogs/preferences-dialog.c: group the thumbnail related + controls together. Could probably still be improved... + +2004-10-11 Sven Neumann <sven@gimp.org> + + * app/actions/documents-commands.c + (documents_recreate_preview_cmd_callback): when recreating the + thumbnail, delete old thumbnails and create it in the configured + thumbnail size instead of the container view preview size. + + * libgimpthumb/gimpthumbnail.c (gimp_thumbnail_update_thumb): + reset the image info when the thumbnail state changes. + +2004-10-11 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c: construct a case-insensitive glob + pattern to use when filtering for file extensions. + +2004-10-11 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails): + user-visible counting starts at 1, not 0. + +2004-10-11 Michael Natterer <mitch@gimp.org> + + * tools/authorsgen/contributors: added missing contributors. + Thanks to Kevin Cozens for going through ChangeLog and making a list. + + * AUTHORS + * app/dialogs/authors.h: regenerated. + +2004-10-11 Sven Neumann <sven@gimp.org> + + * libgimpthumb/gimpthumbnail.c: ooops, forgot to disable the debug + output again. + +2004-10-11 Sven Neumann <sven@gimp.org> + + * app/batch.c: clarified. + +2004-10-08 Kevin Cozens <kcozens@cvs.gimp.org> + + * configure.in: removed duplicate GETTEXT_PACKAGE line. + +2004-10-11 Sven Neumann <sven@gimp.org> + + * libgimpthumb/gimpthumb-utils.[ch] + * libgimpthumb/gimpthumb.def: added an API to delete thumbnails. + + * app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnail): + when recreating a thumbnail on user request, delete all existing + thumbnails for it. + + * plug-ins/common/AlienMap2.c: removed unused variable. + +2004-10-10 Sven Neumann <sven@gimp.org> + + * libgimpthumb/gimpthumb-utils.[ch] + * libgimpthumb/gimpthumb.def + * libgimpthumb/gimpthumbnail.c: added support for local thumbnails + as introduced by version 0.7 of the thumbnail spec. Untested, but + at least the API is there. + +2004-10-10 DindinX <dindinx@gimp.org> + + * plug-ins/common/AlienMap2.c: ported to GimpAspectPreview, and some + minor cleanups. + +2004-10-10 DindinX <dindinx@gimp.org> + + * plug-ins/common/vpropagate.c: added a preview. + +2004-10-10 DindinX <dindinx@gimp.org> + + * plug-ins/common/flarefx.c + * plug-ins/common/waves.c: cleanups and ported to GimpAspectPreview. + +2004-10-10 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcontainerview.c (gimp_container_view_lookup): + handle NULL as viewable parameter as a workaround for bug #149906. + + * app/widgets/gimpthumbbox.c (gimp_thumb_box_auto_thumbnail): made + the code more robust. + + * app/xcf/xcf-private.h + * app/xcf/xcf.c: added a const qualifier. + +2004-10-09 DindinX <dindinx@gimp.org> + + * app/dialogs/dialogs.h: fixed a typo in the double-inclusion guard. + +2004-10-09 Sven Neumann <sven@gimp.org> + + * AUTHORS + * app/dialogs/authors.h: regenerated. Someone should look into + updating the list of contributors for the 2.2 release ... + +2004-10-08 Kevin Cozens <kcozens@cvs.gimp.org> + + * tools/authorsgen/contributors: Added my name to the + list of contributors. + +2004-10-08 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpthumbbox.c: tweaked the text shown while + updating the preview so that the dialog doesn't need to resize. + +2004-10-08 Sven Neumann <sven@gimp.org> + + * app/config/gimpcoreconfig.[ch] + * app/config/gimprc-blurbs.h: added new gimprc option + "thumbnail-filesize-limit" that allows to control the maximum + filesize for automatic thumbnail creation. + + * app/dialogs/preferences-dialog.c: added a GUI for it, needs + review. + + * app/core/gimpimagefile.[ch]: minor cleanups. Moved call to + gimp_thumbnail_peek_image() from gimp_imagefile_save_thumb() to + gimp_imagefile_save_thumbnail() to avoid it being called twice. + + * app/file/file-utils.[ch]: export utility function + file_utils_find_proc_by_extension() that allows to check for a + file plug-in by looking at the filename extension only. + + * app/widgets/gimpthumbbox.[ch]: automatically create or update + thumbnails for image files with a known extension that are smaller + than "thumbnail-filesize-limit". Fixes bug #137176. + +2004-10-08 Sven Neumann <sven@gimp.org> + + * plug-ins/common/ripple.c: handle the tile parameter identically + for preview and final result. Set Edges options insensitive when + "Retain tileability" is checked. Reported by Olivier. + +2004-10-08 Sven Neumann <sven@gimp.org> + + * plug-ins/common/apply_lens.c (lens_dialog): invalidate the + preview when the toggle buttons are used. Reported by Olivier. + + * app/widgets/gimpview.c: minor cleanup. + +2004-10-08 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpmeasuretool.c: implement GimpTool::key_press() and + cancel the tool on GDK_Escape. Come cleanup. + +2004-10-08 Michael Natterer <mitch@gimp.org> + + Made the text options about two toolbox grid columns smaller. + Addresses bug #122862. + + * app/widgets/gimppropwidgets.c (gimp_prop_size_entry_new): use + the number of digits of the property's max_val plus two as number + of chars for the sizeentry'y spinbutton (instead of always 10 as + before). + + * app/tools/gimptextoptions.c (gimp_text_options_gui): GtkEntry + has a minimal width of 150 pixels (eek). Set a silly small minimal + width instead (the entry expands to the available width anyway). + +2004-10-08 Sven Neumann <sven@gimp.org> + + * app/file/file-utils.c: added lots of const qualifiers. + +2004-10-08 Michael Natterer <mitch@gimp.org> + + * app/tools/gimppaintoptions-gui.c: the gradient button in blend + options got lost, added it back. Also moved creation of the brush, + pattern and gradient buttons to utility functions and cleaned up + the whole file a bit. + +2004-10-08 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell.c (gimp_display_shell_real_scaled) + (gimp_display_shell_flush) + * app/gui/gui-vtable.c (gui_display_create): always pass a + GimpDisplay, not a GimpDisplayShell as "data" to + gimp_ui_manager_update(). + + * app/actions/actions.c (action_data_get_*): removed checks if the + passed data is a GimpDisplayShell and temporarily added g_assert() + to be sure. The assertions will be removed before 2.2. + +2004-10-07 Sven Neumann <sven@gimp.org> + + * libgimpthumb/gimpthumbnail.c: added some (disabled) debug output. + + * app/widgets/gimpviewrenderer-frame.[ch]: added a way to retrieve + the size of the frame borders. + + * app/widgets/gimpthumbbox.c: don't set an arbitrary padding but + exactly the size of the frame borders. Otherwise we get large + thumbnails (scaled down) if we request normal sized ones. + +2004-10-07 Kevin Cozens <kcozens@cvs.gimp.org> + + * plug-ins/script-fu/scripts/selection-round.scm: Changed deprecated + constant ADD to CHANNEL-OP-ADD. + +2004-10-07 Michael Natterer <mitch@gimp.org> + + Merged the gz and bz2 plug-ins into one generic compression + handler that can be extended by adding entries to a table of + compressor definitions: + + * configure.in: removed bz2 special casing for win32. + + * plug-ins/common/bz2.c + * plug-ins/common/gz.c: removed. + + * plug-ins/common/compressor.c: new plug-in. + + * plug-ins/common/plugin-defs.pl: changed accordingly. + + * plug-ins/common/.cvsignore + * plug-ins/common/Makefile.am: regenerated. + +2004-10-07 Simon Budig <simon@gimp.org> + + * app/actions/view-commands.c: fill in the formula... :-) + untabbified. + + * app/display/gimpdisplayshell-scale.c: Micro-Cleanup, untabbified. + +2004-10-07 Michael Natterer <mitch@gimp.org> + + * app/actions/view-actions.c: changed zoom actions to be + GimpEnumActions using the GimpActionSelectType enum. Enables + keyboard shortcuts for useless stuff like "zoom out a lot", and + makes them better accessible for external controllers. + + * app/actions/view-commands.[ch]: renamed view_zoom_cmd_callback() + to view_zoom_explicit_cmd_callback(), removed the zoom_in and + zoom_out callbacks and added a new view_zoom_cmd_callback() for + the new GimpActionSelectType-based actions. The implementation of + the new zoom types is questionable but now there is a place where + nomis can fill in nice formulas... + +2004-10-06 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpeditselectiontool.[ch]: added new parameter + "gboolean propagate_release" to gimp_edit_slection_tool_start() + and remember it in the GimpEditSelectionTool struct. If requested, + propagate GimpTool::button_release() to the tool below in the tool + stack. + + * app/tools/gimpselectiontool.c (gimp_selection_tool_start_edit): + pass FALSE so we don't get the button_release(). + + * app/tools/gimpmovetool.[ch]: pass TRUE so we get + button_release(). If moving a layer or path in "pick active" mode, + remember the old active layer/path and switch back to it in + button_release(). Fixes bug #97734. + + Unrelated: + + * app/tools/gimpeditselectiontool.c + (gimp_edit_selection_tool_motion): set "first_move" to FALSE only + if a move actually happened. Fixes un-undoable moves at high zoom + factors. + +2004-10-06 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdnd.c (gimp_dnd_data_drag_begin): remember for + which GdkDragContext the icon_widget was made. + + (gimp_dnd_data_drag_end): destroy the icon_widget only if it was + created for this GdkDragContext. Fixes broken DND icon_widgets + when dragging the same source again while the old icon_widget is + still floating back from an unsuccessful drop. Fixes bug #139337. + +2004-10-05 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/lib.pl: Slight cleanup of doc generating code. + +2004-10-06 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/lib.pl: for deprecated procedures, create a gtk-doc + comment that contains a link to the replacement procedure and + doesn't contain redundant information. + + * tools/pdbgen/pdb/text_tool.pdb: fixed names of replacement + procedures. + + * libgimp/gimpbrushes.c + * libgimp/gimpgradients.c + * libgimp/gimppalettes.c + * libgimp/gimppatterns.c: made the handwritten gtk-doc comments of + deprecated procedures look like the generated ones. + + * app/pdb/text_tool_cmds.c + * libgimp/gimpbrushes_pdb.c + * libgimp/gimpgradients_pdb.c + * libgimp/gimppalettes_pdb.c + * libgimp/gimppatterns_pdb.c + * libgimp/gimptexttool_pdb.c: regenerated. + +2004-10-06 Michael Natterer <mitch@gimp.org> + + * app/tools/gimp-tools.c (gimp_tools_restore): reset the tool + options before deserializing so they have the correct default + values. Fixes bug #120832. + + * app/tools/gimpbucketfilloptions.c + * app/tools/gimpmagnifyoptions.c + * app/tools/gimpselectionoptions.c + * app/tools/gimptransformoptions.c: removed all set_defaults() + utility functions and moved their code to reset(). The change + above calls them automatically so there is no need to call them + from the GUI constructors any more. + +2004-10-06 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/scripts/selection-round.scm: use a + scale_entry instead of a spinbutton, changed mnemonic from "R" to + "E", indentation. + + * plug-ins/script-fu/scripts/test-sphere.scm: s/SF_BRUSH/SF-BRUSH/ + in a comment. + +2004-10-06 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/selection-round.scm: applied patch by + Alan Horkan that improves usability and usefulness of this script. + Did some code cleanup and added the old procedure for backward + compatibility. Fixes bug #145147. + + * menus/image-menu.xml.in: renamed placeholder in Image->Select + from "Outline" to "Modify". + +2004-10-06 Sven Neumann <sven@gimp.org> + + * plug-ins/common/postscript.c (ps_open): tweaked error message. + +2004-10-06 Michael Natterer <mitch@gimp.org> + + * app/pdb/procedural_db.h (struct ProcRecord): changed new member + "deprecated" from "gboolean" to a "gchar*" which holds the name of + the replacement procedure. + + * tools/pdbgen/app.pl: changed accordingly. + + * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): show + the name of the replacement procedure in the warning message. + + * tools/pdbgen/stddefs.pdb: added utility function + std_pdb_deprecated() which takes the name of the replacement + procedure and fills the blurb, help, author, copyright, date and + deprecated fields of the procedure definition. + + * tools/pdbgen/pdb/brushes.pdb + * tools/pdbgen/pdb/gradients.pdb + * tools/pdbgen/pdb/image.pdb + * tools/pdbgen/pdb/palettes.pdb + * tools/pdbgen/pdb/patterns.pdb + * tools/pdbgen/pdb/text_tool.pdb: use it instead of duplicating + the same code and strings for all deprecated procedures. + + * app/pdb/*_cmds.c + * libgimp/gimppatterns_pdb.c + * libgimp/gimptexttool_pdb.c: regenerated. + +2004-10-06 Michael Natterer <mitch@gimp.org> + + Fixed the scale constraints radio buttons: + + * app/tools/gimptransformoptions.c (gimp_transform_options_gui): + initialize the radio group with the correct value instead of + resetting the model before creating the group. + + (gimp_scale_options_constrain_callback): change the model + only if the radio button became active. + + (gimp_scale_options_constrain_notify): new callback which makes + the radio buttons a real view on the model again (fixes GUI + updates on modifier press/release). + +2004-10-06 Sven Neumann <sven@gimp.org> + + * app/actions/plug-in-actions.c (plug_in_actions_update): an image + doesn't necessarily have a drawable. Handle the case when it doesn't. + +2004-10-06 Sven Neumann <sven@gimp.org> + + * app/app_procs.[ch] + * app/batch.[ch] + * app/main.c: added new command-line option "--batch-interpreter" + that allows to specify the procedure to use to process batch + commands. Removed the perl-server hack but kept Script-Fu as the + default for backward compatibility. + + * docs/gimp.1.in: documented the new option. + +2004-10-06 Michael Natterer <mitch@gimp.org> + + * app/actions/file-commands.c (file_revert_confirm_callback): + removed the code which sets the new image on all contexts where + the old image was set... + + * app/display/gimpdisplay-foreach.c (gimp_displays_reconnect): + ...and added it here so it happens for all calls of this function, + also from the PDB. Fixes bug #154638. + +2004-10-06 Sven Neumann <sven@gimp.org> + + * libgimp/gimp.def: updated. + +2004-10-06 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/brush.pdb: return the mask's bpp and the + brush's pixmap data if it has one. + + * tools/pdbgen/pdb/pattern.pdb: cleaned up. + + * tools/pdbgen/pdb/image.pdb: added $deprecated = 1 to deprecated + functions even if they are not exported to libgimp any more. + + * app/pdb/procedural_db.h (struct ProcRecord): added member + "gboolean deprecated". + + * tools/pdbgen/app.pl + * app/xcf/xcf.c: fill it accordingly. + + * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): warn + not only for deprecated procedured which are in the compat hach + table, but also for procedures with deprecated flag set to TRUE. + + * app/pdb/*_cmds.c + * libgimp/gimpbrush_pdb.[ch] + * libgimp/gimppattern_pdb.[ch]: regenerated. + + * libgimp/gimpbrushmenu.c + * plug-ins/gfig/gfig-style.c: changed accordingly. + +2004-10-05 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/lib.pl: Fix array return value generation when there + are more args after it. + +2004-10-06 Sven Neumann <sven@gimp.org> + + * configure.in: bumped version number to 2.1.7. + +2004-10-06 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/lib.pl: put subsequent deprecated prototypes into + a single #ifndef ... #endif pair. + + * libgimp/gimpbrushes_pdb.h + * libgimp/gimpgradients_pdb.h + * libgimp/gimppalettes_pdb.h + * libgimp/gimppatterns_pdb.h + * libgimp/gimptexttool_pdb.h: regenerated. + +2004-10-06 Sven Neumann <sven@gimp.org> + + * app/core/gimpimage.[ch]: store the time when the image is first + dirtied. + + * app/display/gimpdisplayshell-close.c: tell the user what time + period of changes will be lost when the image is not saved. + +2004-10-06 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/brushes.pdb (brushes_get_brush_data) + * tools/pdbgen/pdb/gradients.pdb (gradients_sample_uniform) + (gradients_sample_custom) (gradients_get_gradient_data) + * tools/pdbgen/pdb/patterns.pdb (patterns_get_pattern_data): + deprecated. + + * tools/pdbgen/pdb/brush.pdb + * tools/pdbgen/pdb/gradient.pdb + * tools/pdbgen/pdb/palette.pdb + * tools/pdbgen/pdb/pattern.pdb: added replacements for the + deprecated functions. Removed the silly feature that passing NULL + as name operates on the current brush, pattern etc. + + * app/pdb/brush_cmds.c + * app/pdb/brushes_cmds.c + * app/pdb/gradient_cmds.c + * app/pdb/gradients_cmds.c + * app/pdb/internal_procs.c + * app/pdb/palette_cmds.c + * app/pdb/pattern_cmds.c + * app/pdb/patterns_cmds.c + * libgimp/gimpbrush_pdb.[ch] + * libgimp/gimpbrushes_pdb.[ch] + * libgimp/gimpgradient_pdb.[ch] + * libgimp/gimpgradients_pdb.[ch] + * libgimp/gimppalette_pdb.c + * libgimp/gimppattern_pdb.[ch] + * libgimp/gimppatterns_pdb.[ch]: regenerated. + + * libgimp/gimpbrushmenu.c + * libgimp/gimpgradientmenu.c + * libgimp/gimppatternmenu.c + * plug-ins/FractalExplorer/Dialogs.c + * plug-ins/common/gradmap.c + * plug-ins/common/sample_colorize.c + * plug-ins/flame/flame.c + * plug-ins/gfig/gfig-style.c + * plug-ins/gflare/gflare.c + * plug-ins/pagecurl/pagecurl.c + * plug-ins/script-fu/scripts/spyrogimp.scm: changed accordingly. + +2004-10-06 Sven Neumann <sven@gimp.org> + + * plug-ins/common/spheredesigner.c: improved the dialog a bit, + needs more work. + +2004-10-05 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/addborder.scm: simple change to make + the script work on all image types, not only RGB. + +2004-10-05 Sven Neumann <sven@gimp.org> + + * Made 2.1.6 release. + +2004-10-05 Sven Neumann <sven@gimp.org> + + * plug-ins/helpbrowser/dialog.c: added a close button. Launch the + browser with the HTML focused. + +2004-10-05 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpwidgets.c (gimp_table_attach_aligned): + left-justify the label. + + * libgimpwidgets/gimpdialog.c: if a button with GTK_RESPONSE_HELP + is being added, hide the automatically added help button. + + * plug-ins/script-fu/script-fu-interface.c: five buttons are too + much for the action area. Renamed the About button to Help and + resurrected the help button in the about dialog as a way to get to + the actual help pages (pressing F1 will get you there as well). + +2004-10-05 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c: added a help button. + +2004-10-05 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/siod-wrapper.c (marshall_proc_db_call): + - check the number of elements of array parameters against + the actually passed array and spit a proper error message + instead of trashing the wire. Fixes bug #154266. + - g_strdup()/g_free() the proc_name so it doesn't get mungled + by convert_string(). + - added missing implementation of INT16ARRAY return values. + - cleaned up STRINGARRAY value implementations to work like + all other array values. + +2004-10-04 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c (script_fu_reset): + fixed reset for SF_TEXT values. + +2004-10-04 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c (script_fu_interface): + oops, didn't meant to remove that line. + +2004-10-04 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/Makefile.am (imagemap_SOURCES): removed pix-data.h. + +2004-10-04 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_area): + take drawable offsets into account when masking the preview with + the selection mask. + +2004-10-04 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/gimprc.pdb (gimprc_query, gimprc_set): disallow + the empty string as token. Spotted by Kevin Cozens. + + * app/pdb/gimprc_cmds.c: regenerated. + +2004-10-04 Sven Neumann <sven@gimp.org> + + * libgimp/gimpaspectpreview.c (gimp_aspect_preview_draw_buffer): + no need to set bpp before calling gimp_drawable_get_thumbnail_data(). + +2004-10-04 DindinX <dindinx@gimp.org> + + * libgimp/gimpaspectpreview.c: (gimp_aspect_preview_draw_buffer): + only apply the effect inside the current selection. This, together + with my previous commit fixes bug #132194. + +2004-10-04 DindinX <dindinx@gimp.org> + + * plug-ins/common/channel_mixer.c: Ported to GimpAspectPreview. This + addresses but not totally fixes bug #132194. + +2004-10-04 Sven Neumann <sven@gimp.org> + + * app/config/gimpguiconfig.[ch] + * app/config/gimprc-blurbs.h: added gimprc option "show-help-button". + + * app/dialogs/preferences-dialog.c: added a GUI for it. + + * app/dialogs/file-save-dialog.c + * app/dialogs/image-new-dialog.c + * app/dialogs/quit-dialog.c + * app/display/gimpdisplayshell-close.c + * app/widgets/gimphelp-ids.h: don't set help-ids on confirmation + dialogs. + + * libgimpbase/gimpprotocol.[ch] + * libgimp/gimp.[ch]: added boolean "show_help_button" to the + config message. + + * app/plug-in/plug-in-run.c: pass the new preference to the plug-in. + + * libgimpwidgets/gimpdialog.[ch]: added new function that allows to + set whether new dialogs should get a help button added. + + * app/gui/gui.c + * libgimp/gimpui.c: call gimp_dialogs_show_help_button() according + to the gimprc settings. + +2004-10-04 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c (script_fu_about): set + the help_func again (but not the help_id). + +2004-10-04 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c (script_fu_about): + enabled line wrapping on labels. + (script_fu_interface): substitute underscores by hyphens to + generate the help-id from the procedure name. + +2004-10-04 Michael Natterer <mitch@gimp.org> + + * libgimpbase/gimpwire.c: added assertions to make sure "count" is + always >= 0. Turns the crash described in bug #154266 into a + warning plus corrupted wire state :) Real fix (in script-fu) will + follow. Untabified. + +2004-10-04 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimphelpui.c: untabified. + + (gimp_help_callback): use GIMP_HELP_ID instead of "gimp-help-id". + +2004-10-04 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c (script_fu_interface): + set a minimum width for the color button again. + (script_fu_about): don't set help_func and help_id on the about + dialog. + +2004-10-04 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/brush.pdb + * tools/pdbgen/pdb/gradient.pdb + * tools/pdbgen/pdb/palette.pdb: disallow the empty string for + new brushes, gradients and palettes and check the return value + of gimp_data_factory_data_new(). Cleanup. + + * app/core/gimpbrushgenerated.c (gimp_brush_generated_new) + * app/core/gimpgradient.c (gimp_gradient_new) + * app/core/gimpdatafactory.c (gimp_data_factory_data_new): same + here. Fixes bug #154264. + + * app/core/gimpdata.[ch] (gimp_data_set_filename): added boolean + "deletable" parameter because it's not derivable from "writable". + + * app/core/gimpdatafactory.c (gimp_data_factory_load_data): need + to figure "deletable" separately from "writable" to be able to + delete unsavable stuff in the user-writable data directories. + Fixes bug #154410. + + (gimp_data_factory_data_save_single): cleaned up. + + * app/pdb/brush_cmds.c + * app/pdb/gradient_cmds.c + * app/pdb/palette_cmds.c + * libgimp/gimpbrush_pdb.c + * libgimp/gimpgradient_pdb.c + * libgimp/gimppalette_pdb.c: regenerated. + +2004-10-04 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/asc2img.scm: a cleaned up version of + the script contributed by Kevin Cozens (see bug #153900). + + * plug-ins/script-fu/scripts/predator.scm: applied patch by Kevin + Cozens that fixes use of the script on original layer (bug #152678). + +2004-10-04 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/3d-outline.scm + * plug-ins/script-fu/scripts/blended-logo.scm + * plug-ins/script-fu/scripts/camo.scm + * plug-ins/script-fu/scripts/clothify.scm + * plug-ins/script-fu/scripts/flatland.scm + * plug-ins/script-fu/scripts/glossy.scm + * plug-ins/script-fu/scripts/land.scm + * plug-ins/script-fu/scripts/predator.scm + * plug-ins/script-fu/scripts/rendermap.scm + * plug-ins/script-fu/scripts/ripply-anim.scm + * plug-ins/script-fu/scripts/speed-text.scm + * plug-ins/script-fu/scripts/spinning-globe.scm: applied patches + from Kevin Cozens that define variables before first use (bug + #153900). + +2004-10-04 Sven Neumann <sven@gimp.org> + + * libgimp/gimpgradientmenu.c: handle allocation > requisition for + the gradient preview. + + * plug-ins/script-fu/script-fu-interface.c: added a horizontal + size group for the left-aligned controls. + +2004-10-03 DindinX <dindinx@gimp.org> + + * plug-ins/common/destripe.c: ported to GimpDrawablePreview. + +2004-10-03 DindinX <dindinx@gimp.org> + + * plug-ins/common/nova.c: ported to GimpAspectPreview. + +2004-10-03 DindinX <dindinx@gimp.org> + + * plug-ins/common/max_rgb.c: ported to GimpAspectPreview. + +2004-10-03 Michael Schumacher <schumaml@gmx.de> + + * plug-ins/dbbrowser/Makefile.am + * plug-ins/script-fu/Makefile.am: moved the libgimpprocbrowser to + the beginning of LDADD + +2004-10-03 DindinX <dindinx@gimp.org> + + * libgimp/gimpaspectpreview.c: limit the size of the preview to 512 + pixels. This prevents plug-ins using gimp_drawable_get_thumbnail_data + to crash. + +2004-10-03 DindinX <dindinx@gimp.org> + + * plug-ins/common/emboss.c: ported to GimpAspectPreview and made some + cleanups so this plug-in now use the same naming scheme as other + plug-ins do. + +2004-10-03 DindinX <dindinx@gimp.org> + + * plug-ins/common/whirlpinch.c: ported to GimpAspectPreview. + +2004-10-03 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/color.pdb: export the Colorize tool to the PDB. + Fixes bug #154368. + + * app/pdb/color_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpcolor_pdb.[ch]: regenerated. + +2004-10-03 DindinX <dindinx@gimp.org> + + * plug-ins/common/blinds.c: use a GimpAspectPreview to make the + preview resizable. + +2004-10-03 DindinX <dindinx@gimp.org> + + * plug-ins/common/ripple.c: Added a preview. + +2004-10-02 DindinX <dindinx@gimp.org> + + * plug-ins/common/polar.c: use a GimpAspectPreview. + +2004-10-02 DindinX <dindinx@gimp.org> + + * plug-ins/common/mapcolor.c: use a GimpAspectPreview and made the + code much simpler. + +2004-10-02 DindinX <dindinx@gimp.org> + + * plug-ins/common/illusion.c: use a GimpAspectPreview so the preview + is now resizable. + +2004-10-02 DindinX <dindinx@gimp.org> + + * plug-ins/common/apply_lens.c: added a preview. This plug-in still + need some work. + +2004-10-01 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-callbacks.c + (gimp_display_shell_tool_events): dispatch GDK_Escape to + GimpTool::key_press(). + + * app/tools/gimpcroptool.c (gimp_crop_tool_key_press) + * app/tools/gimpimagemaptool.c (gimp_image_map_tool_key_press): + * app/tools/gimptransformtool.c (gimp_transform_tool_key_press): + cancel the tool on <Escape>. + +2004-10-01 Sven Neumann <sven@gimp.org> + + * plug-ins/dbbrowser/plugin-browser.c: it's Plug-In, not Plugin. + +2004-10-01 Sven Neumann <sven@gimp.org> + + * app/tools/gimpcroptool.c (crop_response): destroy the info + dialog instead of hiding it. Fixes session management. + +2004-10-01 Sven Neumann <sven@gimp.org> + + * app/tools/gimpcroptool.c: unset the highlight from + crop_response() so it gets called when cropping is cancelled. + + * app/dialogs/info-dialog.c (info_dialog_show): do what the + function name says, show the window, but don't present it. + Fixes bugs #128833 and #138816. + +2004-10-01 Sven Neumann <sven@gimp.org> + + * themes/Default/images/stock-frame-64.png: replaced the obtrusive + drop-shadow by a thin white frame with a subtle shadow. Taken from + a mockup done by Jimmac. + + * app/widgets/gimpviewrenderer-frame.c: changed the hardcoded + offsets for the new frame image :( + +2004-10-01 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-callbacks.c: no need to include + gimpdisplayshell-render.h here. + + * app/display/gimpdisplayshell-draw.c + * app/display/gimpdisplayshell-render.[ch] + + * app/display/gimpdisplayshell.[ch]: added an API to highlight a + rectangle (specified in image coordinates). Actually it doesn't + highlight but dims the area outside the rectangle. + + * app/tools/gimpcroptool.c: use the new functionality to show the + area to be cropped. Fixes bug #93360. + +2004-09-30 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/script-fu-types.h (struct SFScript): renamed + member "decription" to "menu_path". + + * plug-ins/script-fu/script-fu-interface.c: changed accordingly. + + * plug-ins/script-fu/script-fu-scripts.c: ditto. Don't pass the + menu_path as "blurb" to gimp_install_temp_proc(). Instead, + pass "help" as "blurb" and nothing as "help". + + * plug-ins/script-fu/scripts/test-sphere.scm: shortened overly + long and useless help text. + +2004-09-30 Michael Natterer <mitch@gimp.org> + + * plug-ins/dbbrowser/gimpprocbox.c: don't include + "libgimp/stdplugins-intl.h". + + * plug-ins/dbbrowser/gimpprocbrowser.c + * plug-ins/dbbrowser/plugin-browser.c: use gimp_destroy_paramdefs() + so we don't leak all param names and descriptions. + + * plug-ins/dbbrowser/gimpprocview.c: don't show empty rows or + redundant information (help == blurb for deprecated procedures). + +2004-09-30 Michael Natterer <mitch@gimp.org> + + * plug-ins/dbbrowser/Makefile.am + * plug-ins/dbbrowser/gimpprocbox.c: new files holding more common + code from the two browsers. + + * plug-ins/dbbrowser/gimpprocbrowser.c: use it. + + * plug-ins/dbbrowser/plugin-browser.c: ditto. Re-enabled sorting + by all columns in both views. More cleanup. + +2004-09-30 Sven Neumann <sven@gimp.org> + + * README: added missing linebreak. + + * plug-ins/imagemap/imap_about.c (do_about_dialog): should not + mark email address for translation. + +2004-09-30 Daniel Egger <degger@fhm.edu> + + * README: Applied proofreading patch from Jonathan Levi + <drjlevi@netonecom.net>. + +2004-09-30 Michael Natterer <mitch@gimp.org> + + Cleaned up the DB Browser and Plugin Details code and GUI. It's + not perfect yet but at least they don't look like crap any more. + Fixes bug #131490. + + * plug-ins/common/plugin-defs.pl + * plug-ins/common/plugindetails.c: removed this plugin. + + * plug-ins/common/.cvsignore + * plug-ins/common/Makefile.am: regenerated. + + * plug-ins/dbbrowser/Makefile.am + * plug-ins/dbbrowser/dbbrowser.c + * plug-ins/dbbrowser/dbbrowser_utils.[ch]: removed these files. + + * plug-ins/dbbrowser/gimpprocbrowser.[ch] + * plug-ins/dbbrowser/gimpprocview.[ch]: new cleaned up files. + + * plug-ins/dbbrowser/plugin-browser.c: the former plugindetails. + * plug-ins/dbbrowser/procedure-browser.c: the former dbbrowser. + + * plug-ins/script-fu/Makefile.am: link against the new library + libgimpprocbrowser.a + + * plug-ins/script-fu/script-fu-console.c: changed #includes + accordingly. Minor cleanup. + + * tools/pdbgen/pdb/plug_in.pdb (plugins_query): fixed menu_path + return value. Was broken since the plug-in menu registering + changes. + + * app/pdb/plug_in_cmds.c: regenerated. + +2004-09-30 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphelp.c (gimp_help_get_locales): fixed brokeness + I introduced with my last cleanup. + +2004-09-29 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/plug-ins/gimpfu.py: applied slightly tweaked patch + from Joao S. O. Bueno, which adds a mutliline text field (PF_TEXT) and + untabbifies things. Closes bug #153921. + + * plug-ins/pygimp/plug-ins/gimpplugin.py + * plug-ins/pygimp/plug-ins/gimpshelf.py + * plug-ins/pygimp/plug-ins/gimpui.py: Untabbify. + +2004-09-29 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/plug-ins/gtkcons.py: minor tweak to history + behavior. + + * plug-ins/pygimp/plug-ins/clothify.py + * plug-ins/pygimp/plug-ins/foggify.py + * plug-ins/pygimp/plug-ins/gimpcons.py + * plug-ins/pygimp/plug-ins/gtkcons.py + * plug-ins/pygimp/plug-ins/pdbbrowse.py + * plug-ins/pygimp/plug-ins/shadow_bevel.py + * plug-ins/pygimp/plug-ins/sphere.py + * plug-ins/pygimp/plug-ins/whirlpinch.py: Untabbify. + +2004-09-29 Sven Neumann <sven@gimp.org> + + * app/tools/gimpcropoptions.c (gimp_crop_options_gui): plugged a + tiny memleak spotted by Olivier. + +2004-09-29 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.[ch] + * libgimpwidgets/gimpwidgets.def: added gimp_preview_draw_buffer(). + + * libgimp/gimpaspectpreview.[ch] + * libgimp/gimpdrawablepreview.[ch] + * libgimp/gimpui.def: removed the public draw_buffer API. + Implement the virtual GimpPreview::draw_buffer method instead. + + * plug-ins/common/cartoon.c + * plug-ins/common/deinterlace.c + * plug-ins/common/despeckle.c + * plug-ins/common/dog.c + * plug-ins/common/edge.c + * plug-ins/common/engrave.c + * plug-ins/common/exchange.c + * plug-ins/common/gauss.c + * plug-ins/common/grid.c + * plug-ins/common/neon.c + * plug-ins/common/noisify.c + * plug-ins/common/oilify.c + * plug-ins/common/photocopy.c + * plug-ins/common/plasma.c + * plug-ins/common/sel_gauss.c + * plug-ins/common/sharpen.c + * plug-ins/common/shift.c + * plug-ins/common/snoise.c + * plug-ins/common/sobel.c + * plug-ins/common/spread.c + * plug-ins/common/struc.c: changed accordingly. Don't pass the + preview around as GimpDrawablePreview or GimpAspectPreview. It + should whenever possible be accessed as GimpPreview. + +2004-09-29 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.[ch] + * libgimpwidgets/gimpscrolledpreview.[ch] + * libgimpwidgets/gimpwidgets.def: moved the offsets and the + draw_thumb method back to the GimpPreview class. + + * libgimp/gimpdrawablepreview.c: changed accordingly. + + * plug-ins/common/bumpmap.c + * plug-ins/common/cartoon.c + * plug-ins/common/deinterlace.c + * plug-ins/common/despeckle.c + * plug-ins/common/dog.c + * plug-ins/common/edge.c + * plug-ins/common/engrave.c + * plug-ins/common/exchange.c + * plug-ins/common/gauss.c + * plug-ins/common/grid.c + * plug-ins/common/mblur.c + * plug-ins/common/neon.c + * plug-ins/common/noisify.c + * plug-ins/common/oilify.c + * plug-ins/common/photocopy.c + * plug-ins/common/sel_gauss.c + * plug-ins/common/sharpen.c + * plug-ins/common/shift.c + * plug-ins/common/sobel.c + * plug-ins/common/softglow.c + * plug-ins/common/spread.c + * plug-ins/common/struc.c + * plug-ins/common/unsharp.c + * plug-ins/common/wind.c: back to using gimp_preview_get_position(). + + * libgimp/gimpregioniterator.c (gimp_rgn_iterator_new): corrected + gtk-doc comment. + +2004-09-29 DindinX <dindinx@gimp.org> + + * plug-ins/common/snoise.c: Use a GimpAspectPreview here, so the + preview is resizable. + +2004-09-29 Sven Neumann <sven@gimp.org> + + * libgimp/gimpui.def + * libgimpwidgets/gimpwidgets.def: updated. + +2004-09-29 DindinX <dindinx@gimp.org> + + * libgimpwidgets/gimppreview.c + * libgimpwidgets/gimppreview.h: split this widget into itself (more + abstract now) and ... + + * libgimpwidgets/gimpscrolledpreview.c + * libgimpwidgets/gimpscrolledpreview.h: this widget which also have + some scrollbars and a nagivation preview. + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgetstypes.h: changed accordingly. + + * libgimp/gimpaspectpreview.c + * libgimp/gimpaspectpreview.h: Added this widget, derived from + GimpPreview, which has always the same ratio has the given drawable. + This widget has almost the same api as GimpDrawablePreview, and is + useful for plug-ins that show the whole (scaled) drawable in their + preview. + + * libgimp/gimpdrawablepreview.c + * libgimp/gimpdrawablepreview.h: GimpDrawablePreview is now derived + from GimpScrolledPreview. + + * libgimp/Makefile.am + * libgimp/gimpui.h + * libgimp/gimpuitypes.h: changed accordingly. + + * plug-ins/common/plasma.c: use a GimpAspectPreview. + + * plug-ins/common/bumpmap.c + * plug-ins/common/cartoon.c + * plug-ins/common/deinterlace.c + * plug-ins/common/despeckle.c + * plug-ins/common/dog.c + * plug-ins/common/edge.c + * plug-ins/common/engrave.c + * plug-ins/common/exchange.c + * plug-ins/common/gauss.c + * plug-ins/common/grid.c + * plug-ins/common/mblur.c + * plug-ins/common/neon.c + * plug-ins/common/noisify.c + * plug-ins/common/oilify.c + * plug-ins/common/photocopy.c + * plug-ins/common/sel_gauss.c + * plug-ins/common/sharpen.c + * plug-ins/common/shift.c + * plug-ins/common/sobel.c + * plug-ins/common/softglow.c + * plug-ins/common/spread.c + * plug-ins/common/struc.c + * plug-ins/common/unsharp.c + * plug-ins/common/wind.c: use gimp_scrolled_preview_get_position + instead of gimp_preview_get_position. + +2004-09-29 Michael Natterer <mitch@gimp.org> + + * libgimp/gimpregioniterator.[ch]: renamed the "run_mode" + parameters to "unused" and remode the rum_mode member from the + private GimpRgbIterator struct. + + * plug-ins/common/AlienMap2.c + * plug-ins/common/autostretch_hsv.c + * plug-ins/common/c_astretch.c + * plug-ins/common/color_enhance.c + * plug-ins/common/colorify.c + * plug-ins/common/colortoalpha.c + * plug-ins/common/gradmap.c + * plug-ins/common/mapcolor.c + * plug-ins/common/max_rgb.c + * plug-ins/common/noisify.c + * plug-ins/common/normalize.c + * plug-ins/common/sample_colorize.c + * plug-ins/common/scatter_hsv.c + * plug-ins/common/semiflatten.c + * plug-ins/common/threshold_alpha.c + * plug-ins/common/vinvert.c + * plug-ins/fp/fp.c: made "run_mode" a private variable of run() + and pass 0 to gimp_rgn_iterate*(). Minor cleanups. + +2004-09-29 Sven Neumann <sven@gimp.org> + + * libgimp/gimp.def + * libgimp/gimpui.def + * libgimpwidgets/gimpwidgets.def: updated. + +2004-09-29 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/Makefile.am + * tools/pdbgen/groups.pl: renamed group "gradient_edit" to + "gradient" and added "brush", "palette" and "pattern" groups. + + * tools/pdbgen/pdb/gradient_edit.pdb: removed. + + * tools/pdbgen/pdb/brush.pdb + * tools/pdbgen/pdb/gradient.pdb + * tools/pdbgen/pdb/palette.pdb + * tools/pdbgen/pdb/pattern.pdb: new files containing functions + which create, duplicate, rename, delete, query and manipulate + a single brush, pattern etc. + + * tools/pdbgen/pdb/brushes.pdb + * tools/pdbgen/pdb/gradients.pdb + * tools/pdbgen/pdb/palettes.pdb + * tools/pdbgen/pdb/patterns.pdb: deprecated stuff that is obsolete + now and simply removed the procedures that were added after 2.0. + + * app/pdb/gradient_edit_cmds.c + * libgimp/gimpgradientedit_pdb.[ch]: removed. + + * app/pdb/brush_cmds.c + * app/pdb/gradient_cmds.c + * app/pdb/palette_cmds.c + * app/pdb/pattern_cmds.c + * libgimp/gimpbrush_pdb.[ch] + * libgimp/gimpgradient_pdb.[ch] + * libgimp/gimppalette_pdb.[ch] + * libgimp/gimppattern_pdb.[ch]: new files. + + * app/pdb/brushes_cmds.c + * app/pdb/gradients_cmds.c + * app/pdb/internal_procs.c + * app/pdb/palettes_cmds.c + * app/pdb/patterns_cmds.c + * libgimp/gimp_pdb.h + * libgimp/gimpbrushes_pdb.[ch] + * libgimp/gimpgradients_pdb.[ch] + * libgimp/gimppalettes_pdb.[ch] + * libgimp/gimppatterns_pdb.[ch]: regenerated. + + * app/pdb/Makefile.am + * libgimp/Makefile.am + * plug-ins/gfig/gfig-style.c: changed accordingly. + +2004-09-28 Sven Neumann <sven@gimp.org> + + * app/file/gimprecentlist.c (gimp_recent_list_write): don't write + empty groups. + + * app/file/gimprecentlist.c: disabled the code for the win32 + platform. It doesn't make much sense there anyway. If someone + wants to contribute a win32 specific implementation, we'd welcome + that. A Mac OS X implementation would be nice to have as well. + +2004-09-28 Sven Neumann <sven@gimp.org> + + * etc/ps-menurc: updated for GIMP 2.1 by Eric Pierce. + +2004-09-28 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/imagemap/imap_circle.c: + * plug-ins/imagemap/imap_cmd_gimp_guides.c + * plug-ins/imagemap/imap_edit_area_info.c + * plug-ins/imagemap/imap_grid.c + * plug-ins/imagemap/imap_polygon.c + * plug-ins/imagemap/imap_rectangle.c + * plug-ins/imagemap/imap_settings.c: first set of changes to make + imagemap fully HIG compliant. More to come. + +2004-09-28 Sven Neumann <sven@gimp.org> + + * app/file/gimprecentlist.c: seek to the start of the file before + calling lockf(). + +2004-09-28 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/common/borderaverage.c: added size entry. Fixes #143156 + (Use size entry widget in Borderaverage plug-in) + +2004-09-28 Sven Neumann <sven@gimp.org> + + * docs/gimp.1.in: updated name of the splash image. + +2004-09-28 Michael Natterer <mitch@gimp.org> + + * app/core/gimppalette.c: code review / cleanup. + + (gimp_palette_delete_entry): don't add "Black" when the last color + gets removed, a palette can easily live with zero colors. + + * app/widgets/gimppaletteeditor.c + (palette_editor_invalidate_preview): also update the entry which + shows the palette_entry's name. + +2004-09-28 Sven Neumann <sven@gimp.org> + + * app/file/gimprecentlist.c (gimp_recent_list_write_raw): handle + EINTR while writing. + +2004-09-28 Sven Neumann <sven@gimp.org> + + * app/config/gimpxmlparser.[ch]: added new convenience function + gimp_xml_parser_parse_fd(). + + * app/file/Makefile.am + * app/file/gimprecentitem.[ch] + * app/file/gimprecentlist.[ch]: added an implementation of the + recent-files spec as found on freedesktop.org. This code is taken + from libegg and has been edited to fit the GIMP needs. + + * app/file/file-open.c + * app/file/file-save.c: update the ~/.recently-used file. Fixes + bug #131206. + +2004-09-28 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainerbox.c (gimp_container_box_get_preview): + removed hack which strcmp()s the property name to figure the + preview's border_width and use the container view's + preview_border_width instead. + +2004-09-28 Sven Neumann <sven@gimp.org> + + * app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog): + simplified code and removed a compiler warning. + +2004-09-28 Carol Spears <carol@gimp.org> + + * data/images/gimp-splash.png there was a white spot that was making + me crazy. It is gone now. + +2004-09-28 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpaction.c (gimp_action_set_proxy): added a hack + to get rid of the border drawn around thumbnails in the "Open Recent" + menu. + +2004-09-28 Sven Neumann <sven@gimp.org> + + * app/tools/gimpimagemaptool.c (gimp_image_map_tool_settings_dialog): + add a shortcut to the filechooser that points to the user's folder. + + * app/actions/vectors-commands.c: added a file filter to the SVG + import dialog. + +2004-09-27 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpthumbbox.c (gimp_thumb_box_new): added some + padding for the shadow frame to avoid scaling the thumbnail. + +2004-09-27 Sven Neumann <sven@gimp.org> + + * themes/Default/images/Makefile.am + * themes/Default/images/stock-frame-64.png: added a stock icon + that shows a simple drop shadow but could be exchanged for other + image decorations. + + * libgimpwidgets/gimpstock.[ch]: register the new icon. + + * app/widgets/Makefile.am + * app/widgets/gimpviewrenderer-frame.[ch]: new file that holds some + ugly code to draw a frame around a preview pixbuf. + + * app/widgets/gimpviewrenderer.[ch]: the frame pixbuf is attached + to the GimpViewRenderer class so it can be shared by all renderers. + + * app/widgets/gimpviewrendererimagefile.c: use the new functionality + to draw a nice frame around imagefile previews. + + * app/widgets/gimpcontainerbox.c: draw imagefile preview w/o a border. + +2004-09-27 Michael Natterer <mitch@gimp.org> + + * app/actions/data-commands.c: cleanup. + + * app/actions/vectors-commands.c + * app/display/gimpdisplayshell.c + * tools/pdbgen/pdb/paint_tools.pdb: removed unused #includes. + + * app/text/gimptext-bitmap.c + * app/text/gimptext-parasite.c + * app/text/gimptext-vectors.c + * app/text/gimptext-xlfd.c + * app/text/gimptext.c + * app/text/gimptextlayer-xcf.c: include "text-types.h" instead + of "text/text-types.h". + + * app/widgets/gimppatternselect.c: create a GimpPatternFactoryView + instead of GimpDataFactoryView. + + * app/pdb/paint_tools_cmds.c: regenerated. + +2004-09-27 Michael Natterer <mitch@gimp.org> + + * app/actions/brushes-actions.c + * app/actions/gradients-actions.c + * app/actions/palettes-actions.c + * app/actions/patterns-actions.c: made the "foo-edit" actions + GimpStringActions and pass the identifier of the editor dialog + to the callback. + + * app/actions/data-commands.[ch] (data_edit_data_cmd_callback): + show the editor dialog here instead of calling view->edit_func(). + + * app/dialogs/dialogs-constructors.[ch]: removed the brush, + gradient and palette edit_funcs. + + * app/widgets/widgets-types.h: removed typedef GimpDataEditFunc. + + * app/widgets/gimpdatafactoryview.[ch]: removed the edit_func + member and parameters and create the edit button unconditionally. + + * app/widgets/gimpbrushfactoryview.[ch] + * app/widgets/gimppatternfactoryview.[ch]: changed accordingly. + + * app/widgets/Makefile.am + * app/widgets/gimpdataselect.[ch]: removed this class, it's not + needed any longer. + + * app/widgets/gimpbrushselect.[ch] + * app/widgets/gimpgradientselect.[ch] + * app/widgets/gimppaletteselect.[ch] + * app/widgets/gimppatternselect.[ch]: derive them from GimpPdbDialog + and follow the edit_func removal. + + * app/gui/gui-vtable.c (gui_pdb_dialog_new): removed edit_func + stuff. + + * app/widgets/gimpcontainereditor.c: minor unrelated cleanup. + +2004-09-27 Michael Natterer <mitch@gimp.org> + + * app/dialogs/dialogs-constrcutors.[ch]: renamed some constructors + for consistency and added a (useless) template grid. + + * app/dialogs/dialogs.c: make the arrays of GimpDialogFactoryEntries + more readable by using macros to define them. + +2004-09-27 Sven Neumann <sven@gimp.org> + + * app/core/gimpimagefile.c: removed conversion to TempBuf. + Instead implement GimpViewable::get_new_pixbuf by compositing the + thumbnail on a checkerboard. + + * app/widgets/gimpviewrenderer.[ch]: renamed the no_view_pixbuf + struct member to pixbuf. + (gimp_view_renderer_real_render): try gimp_viewable_get_pixbuf() + and render the pixbuf before falling back to the TempBuf preview. + (gimp_view_renderer_render_pixbuf): new function that sets a + pixbuf for the renderer and flushes the render_buffer. + + * app/widgets/gimpviewrendererimagefile.c + (gimp_view_renderer_imagefile_render): render the pixbuf. + + * app/dialogs/dialogs-constructors.c: create the document history + dockable with a zero borderwidth. + +2004-09-27 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail_invoker): use + the GIMP_CHECK_SIZE_SM define, not the enum value + GIMP_CHECK_SIZE_SMALL_CHECKS which is 0 (eeek!). + + * app/pdb/fileops_cmds.c: regenerated. + + * app/widgets/gimphelp.c (gimp_help_get_locales): minor cleanup. + +2004-09-26 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdataeditor.[ch]: added "data" property. + + * app/widgets/gimpbrusheditor.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimppaletteeditor.c: pass the current data to + g_object_new() so we never end up with initially empty editors. + +2004-09-26 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdataeditor.[ch]: added CONSTRUCT_ONLY + "data-factory" property. Removed gimp_data_editor_construct(). + + * app/widgets/gimpbrusheditor.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimppaletteeditor.c: pass the construct parameters + to g_object_new(). + +2004-09-26 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcolorframe.c: changed label alignment to be more + HIG conformant and consistent with the rest of the user interface. + +2004-09-26 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdialogfactory.[ch]: added "name", "blurb", + "stock_id" and "help_id" to struct GimpDialogFactoryEntry and to + gimp_dialog_factory_dialog_register(). Added typedef + GimpDialogConstructor which takes a GimpDialogFactoryEntry in + addition to the parameters GimpDialogNewFunc takes. Added a + constructor function pointer to GimpDialogFactory which defaults + to a function that just returns entry->new_func(). Use that + constructor instead of entry->new_func() for creating + dialogs. Added public API gimp_dialog_factory_set_constructor(). + + * app/dialogs/dialogs.c: register name, blurb, stock_id and + help_id for all dockables so all the dialog info lives in one huge + ugly table now. For the global_toolbox_factory and the + global_dock_factory, set a constructor which creates a dockable + around the widget returned by entry->new_func(). + + * app/dialogs/dialogs-constructors.[ch]: don't create the dockable + in each dialog constructor. Removes tons of code and reduces most + constructors to a "return gimp_foo_new(...)" one-liner. Got rid of + all static variables, they were from a time when GimpDialogFactory + was unable to manage singletons. + + * app/widgets/gimpbrusheditor.[ch] + * app/widgets/gimpgradienteditor.[ch] + * app/widgets/gimppaletteeditor.[ch]: return GtkWidget, not + GimpDataEditor from gimp_foo_editor_new(). + + * app/widgets/gimpdataeditor.c: minor cleanups. + +2004-09-26 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcolordialog.c: moved stuff from new() to init(). + +2004-09-26 Michael Natterer <mitch@gimp.org> + + Ported GimpNavigationView to use actions for its buttons: + + * app/menus/menus.c (menus_init): register a <GimpNavigationEditor> + UI manager containing the "view" action group. + + * app/actions/actions.c (action_data_get_foo): handle "data" being + a GimpNavigationEditor. + + * app/actions/view-actions.c (view_actions): added tooltips for + the actions used in the editor. + + (view_actions_update): use action_data_get_display() instead of + checking the type of "data" manually. + + * app/widgets/gimpeditor.c (gimp_editor_add_action_button): use + a GtkToggleButton instead of GimpButton for GtkToggleActions. + + * app/display/gimpnavigationeditor.[ch]: added a GimpMenuFactory + parameter to the public constructor and removed all other + parameters. Simplified gimp_navigation_editor_new_private() and + use gimp_editor_add_action_button() instead of just add_button() + for creating the buttons. Made gimp_navigation_view_set_shell() + private. Update the UI manager when the shell zooms or scrolls. + + * app/dialogs/dialogs-constructors.c (dialogs_navigation_view_new): + pass the menu_factory to gimp_navigation_editor_new(). + + Removed #includes which are not needed any more. + +2004-09-26 DindinX <dindinx@gimp.org> + + * plug-ins/common/exchange.c: use the same preview as in all other + plug-ins. + +2004-09-25 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_stock.c: removed C++ style comment. + +2004-09-25 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/imagemap/imap_stock.[ch] + * plug-ins/imagemap/Makefile.am + * plug-ins/imagemap/*.xpm: get rid of all .xpm images + + * configure.in + * plug-ins/imagemap/images/*: and add them as .png here + + * plug-ins/imagemap/imap_browse.c: remove unused include. + +2004-09-25 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpviewrenderer.h: removed trailing whitespace. + +2004-09-25 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-close.c: changed mnemonic so that + you can close an image w/o saving it by using Ctrl-W Alt-W. + +2004-09-25 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage-qmask.h: added comment about not changing the + silly "Qmask" string because it is used to identify the Quick Mask + in the XCF. + + * app/core/gimpchannel.c: implement GimpViewable::get_description() + and return "Quick Mask" if it's the Quick Mask. + + * app/actions/qmask-actions.c + * app/actions/qmask-commands.c + * app/core/core-enums.[ch] + * app/core/gimpimage-qmask.c + * app/display/gimpdisplayshell.c: s/QuickMask/Quick Mask/. + +2004-09-25 DindinX <dindinx@gimp.org> + + * plug-ins/common/engrave.c: Added a preview and #if'ed out some + unreachable code. + +2004-09-25 Michael Natterer <mitch@gimp.org> + + * app/core/gimppickable.[ch]: added new vitrual function + GimpPickableInterface::get_image() + + * app/core/gimpdrawable.c + * app/core/gimpimagemap.c + * app/core/gimpprojection.[ch]: implement it. + +2004-09-25 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcolormapeditor.[ch] + * app/widgets/gimphistogrameditor.[ch] + * app/widgets/gimpselectioneditor.[ch]: removed redundant "gimage" + parameters from public constructors. They are all GimpImageEditor + widgets which get their image via gimp_docked_set_context() and + gimp_image_editor_set_image() later anyway. Fixes uglyness as well + as problems where the editors had an image but no context, causing + strange behavior in their foo_actions_update() functions. + + * app/dialogs/dialogs-constructors.c: changed accordingly. Removed + redundant calls to gimp_dockable_set_context() on newly created + dockables because they will get a context when added to their + containers. + +2004-09-25 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcolormapeditor.c: moved stuff from + gimp_colormap_editor_new() to + gimp_colormap_editor_init(). Untabified. + +2004-09-25 DindinX <dindinx@gimp.org> + + * plug-ins/common/dog.c: made the preview behave like in all other + plug-ins by using a GimpDrawablePreview. This allowed to remove a + bunch of complicated code. + +2004-09-25 Sven Neumann <sven@gimp.org> + + * app/widgets/gimptemplateeditor.[ch]: added resolution and image + type information which is usually hidden in the Advanced Options. + +2004-09-25 DindinX <dindinx@gimp.org> + + * plug-ins/common/oilify.c: Added a preview and made some small + cleanups. + +2004-09-24 Sven Neumann <sven@gimp.org> + + * app/config/gimprc-blurbs.h (LAYER_PREVIEW_SIZE_BLURB): try to + improve the tooltip for the layer-preview-size gimprc setting. + Addresses bug #153603. + +2004-09-24 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage-undo-push.c (undo_pop_fs_to_layer): factored + common code out of the UNDO amd REDO cases. Use gimp_drawable_update() + instead of gimp_viewable_invalidate_preview() so the projection + gets updated correctly. Fixes bug #149558. + + * app/core/gimplayer-floating-sel.c (floating_sel_to_layer): + removed unused variables and their assignments. + +2004-09-24 Sven Neumann <sven@gimp.org> + + * app/widgets/gimptemplateeditor.[ch]: added a label that shows + the pixel size (as in the initial mockup done by Jimmac). + +2004-09-24 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpimagemaptool.c + (gimp_image_map_tool_settings_dialog): set the folder using + gtk_file_chooser_set_current_folder(), not set_filename(). + +2004-09-24 Sven Neumann <sven@gimp.org> + + * app/base/curves.[ch] + * app/tools/gimpcurvestool.c: defined CURVES_NUM_POINTS and use it. + + * tools/pdbgen/pdb/color.pdb (curves_spline_invoker): unset the + last control point which got initialized to (255,255) by + curves_init(). Fixes bug #153635. + + * app/pdb/color_cmds.c: regenerated. + +2004-09-24 Sven Neumann <sven@gimp.org> + + * app/plug-in/plug-in-message.c: removed a linebreak from a + warning message. + +2004-09-24 Michael Natterer <mitch@gimp.org> + + * app/paint/gimpairbrushoptions.c + * app/paint/gimpcloneoptions.c + * app/paint/gimpconvolveoptions.c + * app/paint/gimpdodgeburnoptions.c + * app/paint/gimperaseroptions.c + * app/paint/gimpinkoptions.c + * app/paint/gimppaintoptions.c + * app/paint/gimppenciloptions.c + * app/paint/gimpsmudgeoptions.c + * app/tools/gimpblendoptions.c + * app/tools/gimpbucketfilloptions.c + * app/tools/gimpcoloroptions.c + * app/tools/gimpcolorpickeroptions.c + * app/tools/gimpcropoptions.c + * app/tools/gimpflipoptions.c + * app/tools/gimphistogramoptions.c + * app/tools/gimpimagemapoptions.c + * app/tools/gimpmagnifyoptions.c + * app/tools/gimpmeasureoptions.c + * app/tools/gimpmoveoptions.c + * app/tools/gimppaintoptions-gui.c + * app/tools/gimpselectionoptions.c + * app/tools/gimptextoptions.c + * app/tools/gimptransformoptions.c + * app/tools/gimpvectoroptions.c: code cleanup: untabified and + trailing whitespace removal, removed empty instance_init() + funcions, cleaned up variable declarations/initializations. + +2004-09-23 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpairbrushtool.c (gimp_airbrush_tool_register) + * app/tools/gimppenciltool.c (gimp_pencil_tool_register): + add GIMP_CONTEXT_GRADIENT_MASK to the tools' context_props because + these tools use the current gradient. Fixes bug #153584. + +2004-09-23 Michael Natterer <mitch@gimp.org> + + * app/dialogs/Makefile.am + * app/dialogs/color-dialog.[ch]: removed... + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcolordialog.[ch]: ...and added as widget. + + * app/core/gimpmarshal.list: new marshaller VOID__BOXED_ENUM. + + * app/widgets/widgets-enums.[ch]: new enum GimpColorDialogState. + + * app/widgets/gimpcolormapeditor.[ch] + * app/widgets/gimpcolorpanel.[ch] + * app/widgets/gimpgradienteditor.[ch] + * app/widgets/gimppaletteeditor.[ch] + * app/widgets/gimptoolbox-color-area.c + * app/actions/gradient-editor-commands.c + * app/actions/view-commands.c: ported to GimpColorDialog. Removes + a whole bunch of ugly widgets/ -> dialogs/ dependencies. + +2004-09-23 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c: put the text view into + a scrolled window. Removed "changed" callbacks for GtkEntry and + GtkTextView. Instead retrieve the final string when the dialog is + confirmed. + + * plug-ins/script-fu/scripts/carved-logo.scm + * plug-ins/script-fu/scripts/chrome-it.scm + * plug-ins/script-fu/scripts/crystal-logo.scm + * plug-ins/script-fu/scripts/sota-chrome-logo.scm: use + gimp-data-directory instead of the deprecated constant + gimp-data-dir. + + * plug-ins/script-fu/scripts/mkbrush.scm: unmarked strings for + translation that I marked yesterday. Won't work unfortunately. + +2004-09-23 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/blended-logo.scm: fixed context + push/pop. + +2004-09-23 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-enums.h + * plug-ins/script-fu/script-fu-interface.c + * plug-ins/script-fu/script-fu-scripts.c + * plug-ins/script-fu/siod-wrapper.c: applied a patch by Kevin + Cozens, based on a patch by Dov Grobgeld. Implements multi-line + text input in Script-Fu (bug #124394). + + * plug-ins/script-fu/scripts/test-sphere.scm: test the new SF-TEXT + parameter. + +2004-09-23 Sven Neumann <sven@gimp.org> + + * libgimp/gimppixbuf.c (gimp_drawable_get_thumbnail, + gimp_image_get_thumbnail): use the exported symbols from + libgimp, not the private _gimp_drawable_thumbnail() + and _gimp_image_thumbnail() functions. + + * libgimp/gimp.def: added new symbols, removed + _gimp_image_thumbnail and _gimp_drawable_thumbnail. + +2004-09-23 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/brushes.pdb + * tools/pdbgen/pdb/gradients.pdb + * tools/pdbgen/pdb/palettes.pdb + * tools/pdbgen/pdb/patterns.pdb: removed the foos_set_foo() + procedures and marked the foos_get_foo() ones as deprecated. For + brushes, patterns and palettes, added foos_get_foo_info() + procedures which work like foos_get_foo_data() but return just the + properties, not the actual data. Allow NULL or "" to be passed + as name to all functions (use the current brush, pattern etc. + in this case). + + * tools/pdbgen/pdb/fonts.pdb: cleanup. + + * app/pdb/procedural_db.c: added the removed ones to the compat + hash table. + + * libgimp/Makefile.am + * libgimp/gimpbrushes.[ch] + * libgimp/gimpgradients.[ch] + * libgimp/gimppalettes.[ch] + * libgimp/gimppatterns.[ch]: new files with compat functions + wich call the resp. gimp_context_*() functions. + + * libgimp/gimp.h: changed accordingly. + + * app/pdb/brushes_cmds.c + * app/pdb/gradients_cmds.c + * app/pdb/internal_procs.c + * app/pdb/palettes_cmds.c + * app/pdb/patterns_cmds.c + * libgimp/gimpbrushes_pdb.[ch] + * libgimp/gimpgradients_pdb.[ch] + * libgimp/gimppalettes_pdb.[ch] + * libgimp/gimppatterns_pdb.[ch]: regenerated. + + * plug-ins/FractalExplorer/Dialogs.c + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-style.[ch] + * plug-ins/gflare/gflare.c: changed accordingly. + +2004-09-23 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/bumpmap.c (bumpmap_dialog): added a GtkPaned for + packing preview and controls so the controls are resizable again. + +2004-09-23 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/scripts/3d-outline.scm + * plug-ins/script-fu/scripts/beveled-pattern-arrow.scm + * plug-ins/script-fu/scripts/beveled-pattern-bullet.scm + * plug-ins/script-fu/scripts/beveled-pattern-button.scm + * plug-ins/script-fu/scripts/beveled-pattern-heading.scm + * plug-ins/script-fu/scripts/beveled-pattern-hrule.scm + * plug-ins/script-fu/scripts/blended-logo.scm + * plug-ins/script-fu/scripts/carve-it.scm + * plug-ins/script-fu/scripts/carved-logo.scm + * plug-ins/script-fu/scripts/chip-away.scm + * plug-ins/script-fu/scripts/chrome-it.scm + * plug-ins/script-fu/scripts/coffee.scm + * plug-ins/script-fu/scripts/comic-logo.scm + * plug-ins/script-fu/scripts/coolmetal-logo.scm + * plug-ins/script-fu/scripts/crystal-logo.scm + * plug-ins/script-fu/scripts/frosty-logo.scm + * plug-ins/script-fu/scripts/glossy.scm + * plug-ins/script-fu/scripts/hsv-graph.scm + * plug-ins/script-fu/scripts/land.scm + * plug-ins/script-fu/scripts/lava.scm + * plug-ins/script-fu/scripts/mkbrush.scm + * plug-ins/script-fu/scripts/rendermap.scm + * plug-ins/script-fu/scripts/select-to-brush.scm + * plug-ins/script-fu/scripts/select-to-pattern.scm + * plug-ins/script-fu/scripts/sota-chrome-logo.scm + * plug-ins/script-fu/scripts/spyrogimp.scm + * plug-ins/script-fu/scripts/starburst-logo.scm + * plug-ins/script-fu/scripts/starscape-logo.scm + * plug-ins/script-fu/scripts/t-o-p-logo.scm + * plug-ins/script-fu/scripts/test-sphere.scm + * plug-ins/script-fu/scripts/textured-logo.scm: use the new + opacity, paint_mode, brush, pattern, gradient, palette and font + accessors. + +2004-09-23 Sven Neumann <sven@gimp.org> + + Converted the last bunch of scripts to the new context API: + + * plug-ins/script-fu/scripts/[s-z]*.scm + +2004-09-23 Sven Neumann <sven@gimp.org> + + Converted more scripts to the new context API: + + * plug-ins/script-fu/scripts/glossy.scm + * plug-ins/script-fu/scripts/hsv-graph.scm + * plug-ins/script-fu/scripts/image-structure.scm + * plug-ins/script-fu/scripts/perspective-shadow.scm + * plug-ins/script-fu/scripts/pupi-button.scm + * plug-ins/script-fu/scripts/rendermap.scm + * plug-ins/script-fu/scripts/ripply-anim.scm + +2004-09-23 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/hsv-graph.scm: + + * tools/pdbgen/pdb/context.pdb: oops, should probably pop, not + push a context in gimp_context_pop(). + + * app/pdb/context_cmds.c: regenerated. + + * plug-ins/script-fu/scripts/mkbrush.scm: don't fiddle with the + brush description, simply use the name choosen by the user. + +2004-09-23 Sven Neumann <sven@gimp.org> + + Converted the next bunch of scripts to the new context API: + + * plug-ins/script-fu/scripts/[d-n]*.scm: push and pop a context. + Removed code that used to restore the context values changed by + the scripts. + +2004-09-23 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-message.c (plug_in_handle_proc_return_priv): + removed warning about entering a dead code path. That path is not + dead at all :) + +2004-09-23 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/context.pdb: added accessors for the context's + brush, pattern, gradient, palette and brush. Deprecation of old + functions will follow. Fixes gimp-context-set-background wrapper. + Cleanup. + + * tools/pdbgen/pdb/patterns.pdb + * libgimp/gimpbrushes.h: minor fixes. + + * app/pdb/context_cmds.c + * app/pdb/internal_procs.c + * app/pdb/patterns_cmds.c + * libgimp/gimpcontext_pdb.[ch]: regenerated. + +2004-09-23 Sven Neumann <sven@gimp.org> + + * plug-ins/common/bumpmap.c (bumpmap_dialog): cosmetics. + +2004-09-22 Kevin Turner <acapnotic@twistedmatrix.com> + + * plug-ins/pygimp/gimpfu.py (register): clean up errors in + parameter checking. + +2004-09-22 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/brushes.pdb: removed the opacity and paint_mode + functions... + + * tools/pdbgen/pdb/context.pdb: ...and added them here. + + * app/pdb/procedural_db.c: added them to the pdb_compat hash table. + + * libgimp/Makefile.am + * libgimp/gimpbrushes.[ch]: new files with compat functions + which call the gimp_context_*() functions. + + * libgimp/gimp.h: changed accordingly. + + * app/pdb/brushes_cmds.c + * app/pdb/context_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpbrushes_pdb.[ch] + * libgimp/gimpcontext_pdb.[ch]: regenerated. + +2004-09-22 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/Makefile.am + * tools/pdbgen/groups.pl + * tools/pdbgen/pdb/palette.pdb: removed the "Palette" pdb group... + + * tools/pdbgen/pdb/context.pdb: and added its functions to the + "Context" namespace instead. + + * app/pdb/Makefile.am + * app/pdb/palette_cmds.c: removed. + + * app/pdb/procedural_db.c: added them to the pdb_compat hash table. + + * libgimp/Makefile.am + * libgimp/gimppalette_pdb.[ch]: removed. + + * libgimp/gimppalette.[ch]: new files holding compat functions + which call gimp_context_*() functions. + + * libgimp/gimp.h + * libgimp/gimpui.c: changed accordingly. + + * app/pdb/context_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimp_pdb.h + * libgimp/gimpcontext_pdb.[ch]: regenerated. + + * plug-ins/MapObject/mapobject_image.c + * plug-ins/MapObject/mapobject_preview.c + * plug-ins/common/apply_lens.c + * plug-ins/common/blinds.c + * plug-ins/common/borderaverage.c + * plug-ins/common/checkerboard.c + * plug-ins/common/colortoalpha.c + * plug-ins/common/cubism.c + * plug-ins/common/exchange.c + * plug-ins/common/film.c + * plug-ins/common/gif.c + * plug-ins/common/grid.c + * plug-ins/common/mapcolor.c + * plug-ins/common/mblur.c + * plug-ins/common/mng.c + * plug-ins/common/mosaic.c + * plug-ins/common/papertile.c + * plug-ins/common/png.c + * plug-ins/common/polar.c + * plug-ins/common/semiflatten.c + * plug-ins/common/sinus.c + * plug-ins/common/sparkle.c + * plug-ins/common/vpropagate.c + * plug-ins/common/warp.c + * plug-ins/common/whirlpinch.c + * plug-ins/gfig/gfig-style.c + * plug-ins/gfli/gfli.c + * plug-ins/ifscompose/ifscompose.c + * plug-ins/maze/handy.c + * plug-ins/pagecurl/pagecurl.c + * plug-ins/pygimp/gimpmodule.c + * plug-ins/script-fu/scripts/*.scm: changed accordingly. + +2004-09-22 Sven Neumann <sven@gimp.org> + + * app/actions/view-actions.c (view_zoom_actions): mark menu label + as translatable (bug #153456). + +2004-09-22 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/siod-wrapper.c + * plug-ins/script-fu/scripts/mkbrush.scm + * plug-ins/script-fu/scripts/select-to-brush.scm + * plug-ins/script-fu/scripts/select-to-pattern.scm: applied a + patch from Kevin Cozens that adds constants for the directory + names exposed by libgimpbase. Fixes bug #153327. + +2004-09-22 Sven Neumann <sven@gimp.org> + + Converted the first bunch of Script-Fu to the new context API: + + * plug-ins/script-fu/scripts/[3a-c]*.scm: push and pop a context. + Removed code that used to restore the context values changed by + the scripts. + +2004-09-22 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-proc-frame.[ch] (plug_in_proc_frame_init): + removed assertion about proc_rec != NULL because that happens + when query()ing and init()int plug-ins. + + Replaced "context" by "main_context" plus "context_stack". + + * app/plug-in/plug-in-context.c: implement plug_in_context_push() + and plug_in_context_pop(). + + * app/plug-in/plug-in-message.c + * app/plug-in/plug-in-progress.c: changed accordingly. + + * tools/pdbgen/pdb/context.pdb: use the return values of + plug_in_context_push() and _pop(). + + * app/pdb/context_cmds.c: regenerated. + + * plug-ins/script-fu/scripts/test-sphere.scm: use + gimp-context-push and gimp-context-pop instead of remembering the + old values for FG, BG etc. + +2004-09-22 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/Makefile.am + * tools/pdbgen/pdb/context.pdb: new files that will hold context + related PDB functions. + + * tools/pdbgen/groups.pl + * app/pdb/Makefile.am + * app/pdb/context_cmds.c + * app/pdb/internal_procs.c + * app/pdb/progress_cmds.c + * libgimp/gimp_pdb.h + * libgimp/gimpcontext_pdb.[ch]: (re)generated. + + * app/plug-in/Makefile.am + * app/plug-in/plug-in-context.[ch]: new files that will hold code + that implements a context stack in the plug-in's proc-frame. + + * app/plug-in/plug-in.[ch]: new function plug_in_get_proc_frame(). + + * app/plug-in/plug-in-message.c + * app/plug-in/plug-in-progress.c: use the new function instead of + duplicating it all over the place. + +2004-09-22 Michael Natterer <mitch@gimp.org> + + * app/plug-in/Makefile.am + * app/plug-in/plug-in-proc.[ch]: removed... + * app/plug-in/plug-in-proc-def.[ch]: ...and added with a new name. + + * app/plug-in/plug-in-def.[ch] + * app/plug-in/plug-in-message.[ch] + * app/plug-in/plug-in-progress.[ch] + * app/plug-in/plug-in-rc.[ch] + * app/plug-in/plug-in-run.[ch] + * app/plug-in/plug-in.[ch] + * app/plug-in/plug-ins.[ch] + * app/actions/plug-in-actions.c + * app/actions/plug-in-commands.c + * app/file/file-open.[ch] + * app/file/file-save.[ch] + * app/file/file-utils.[ch] + * app/gui/gui-vtable.c + * app/menus/plug-in-menus.c + * app/widgets/gimpfiledialog.c + * app/widgets/gimpfileprocview.c + * app/widgets/gimppluginaction.c + * app/xcf/xcf.c + * tools/pdbgen/pdb/fileops.pdb + * tools/pdbgen/pdb/plug_in.pdb: changed accordingly plus some + minor cosmetic cleanups. + + * app/pdb/fileops_cmds.c + * app/pdb/plug_in_cmds.c: regenerated. + +2004-09-22 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimplayertreeview.c + (gimp_layer_tree_view_floating_selection_changed): removed the + hack that was displaying "Floating Selection" instead of the + floating layer's real name. + + * app/core/gimplayer.c: implement GimpViewable::get_description() + instead and special case floating selections with a two-line + text that contains "Floating Selection". + + * app/core/gimplayer-floating-sel.c + * app/core/gimpimage-undo-push.c: emit "name_changed" on the layer + when it changes its state from floating to normal or vice versa + so the views can update accordingly. + + * app/core/gimpselection.c: s/"Selection"/"Floated Layer"/. + + * app/tools/gimpeditselectiontool.c: + s/"Floating Layer"/"Floating Selection"/. + +2004-09-22 Michael Natterer <mitch@gimp.org> + + * app/plug-in/Makefile.am + * app/plug-in/plug-in-proc-frame.[ch]: new files containing + utility functions for initializing/freeing PlugInProcFrames. + Added the progress stuff to the proc_frame. + + * app/plug-in/plug-in.[ch]: removed the progress stuff from the + PlugIn struct and use the new proc_frame utility functions. + + * app/plug-in/plug-in-message.c + * app/plug-in/plug-in-progress.c + * app/plug-in/plug-in-run.c: changed accordingly. + +2004-09-22 Michael Natterer <mitch@gimp.org> + + Prepare for enabling private contexts for plug-ins and scripts: + + * app/plug-in/plug-in.[ch]: removed the "context" member from + the PlugIn struct and added it to PlugInProcFrame instead. + + * app/plug-in/plug-in-message.c + * app/plug-in/plug-in-progress.c + * app/plug-in/plug-in-run.c: changed accordingly. + +2004-09-22 Sven Neumann <sven@gimp.org> + + * plug-ins/common/bumpmap.c: moved the preview to the left. + +2004-09-22 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-types.h + * app/plug-in/plug-in.[ch]: added struct PlugInProcFrame which + contains the ProcRecord, the proc's GMainLoop and its return + values. + + Use the same struct for the plug-in's main proc and its + temp_procs, so we finally have one set of return values per call + frame, and not just one per plug-in. + + Added plug_in_proc_frame_push()/pop() and changed + plug_in_main_loop[_quit]() accordingly. + + * app/plug-in/plug-in-message.c + * app/plug-in/plug-in-progress.c + * app/plug-in/plug-in-run.c: changed accordingly. + +2004-09-22 Sven Neumann <sven@gimp.org> + + * app/text/gimptextlayout.c (gimp_text_get_pango_context): + workaround Pango bug #143542 (PangoFT2Fontmap leak, see also bug + #148997). Based on a patch by Robert Ögren. + +2004-09-22 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpviewabledialog.c: removed the prelit event box + from the header frame, use a smaller font for the subtitle, + removed the separator. + + * app/dialogs/preferences-dialog.c: removed the prelit event box + from the header frame. Perhaps we should have subtitles here with + a more verbose description of the settings page? + +2004-09-21 Michael Natterer <mitch@gimp.org> + + * app/actions/file-actions.c (file_actions): resolved conflicting + mnemonics. + +2004-09-21 Sven Neumann <sven@gimp.org> + + * data/images/Makefile.am (imagedata_DATA): renamed gimp_splash.png + to gimp-splash.png. + + * data/images/gimp-splash.png: new splash, courtesy of Dave Neary. + + * app/gui/splash.c: look for gimp-splash.png in the users + directory, then in the systemwide images directory. + +2004-09-21 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-server.c: got rid of two the global + file descriptor sets. Use the client hash-table instead. + +2004-09-21 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-server.c: enabled build of the + Script-Fu server for the Win32 platform using the winsock API. + + * plug-ins/script-fu/Makefile.am: link with -lwsock32 on Win32. + + * plug-ins/script-fu/script-fu-console.c + * plug-ins/script-fu/script-fu.c + * plug-ins/script-fu/siod-wrapper.c: removed Win32 specific code + that isn't needed any longer. + +2004-09-21 Michael Natterer <mitch@gimp.org> + + For the sake of completeness, added a GUI for the hidden + "Open as Layer" feature: + + * app/actions/file-actions.c + * app/actions/file-commands.[ch]: added "file-open-as-layer" + action and callback. Abuse the "gimage" field of GimpFileDialog to + indicate layer opening (it's otherwise unused for file-open). + + * app/dialogs/file-open-dialog.c: if dialog->gimage is non-NULL, + open the selected files as layers for that image. + + * app/widgets/gimphelp-ids.h: added GIMP_HELP_FILE_OPEN_AS_LAYER. + + * menus/image-menu.xml.in: added it to the menu. + +2004-09-21 Sven Neumann <sven@gimp.org> + + * plug-ins/common/jpeg.c (save_dialog): let the dialog collapse + with the expander by making it not resizable. + +2004-09-21 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-close.c + (gimp_display_shell_close_dialog): resolved a mnemonics collision. + +2004-09-21 Dave Neary <bolsh@gimp.org> + + * plug-ins/common/psd.c: Correctly set overlay, hard light and + soft light modes from .psd files. Fixes bug #153229. + +2004-09-21 Sven Neumann <sven@gimp.org> + + * plug-ins/common/svg.c (SVG_DEFAULT_RESOLUTION): set to 90dpi as + a workaround for bug #143300. + +2004-09-20 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/imagemap/imap_cmd_guides.c + * plug-ins/imagemap/imap_default_dialog.c + * plug-ins/imagemap/imap_menu.c + * plug-ins/imagemap/imap_preferences.c + * plug-ins/imagemap/imap_tools.c: disabled functionality that doesn't + fully work yet. Bug #136713 now becomes an enhancement request. + +2004-09-20 Sven Neumann <sven@gimp.org> + + * plug-ins/common/bumpmap.c: added tooltips, enabled "Compensate + for darkening" by default, some minor cleanups. + +2004-09-20 Michael Natterer <mitch@gimp.org> + + * app/dialogs/dialogs-constructors.c: removed useless #includes. + +2004-09-20 Michael Natterer <mitch@gimp.org> + + * app/actions/buffers-commands.c + * app/actions/file-commands.c + * app/actions/layers-commands.c + * app/actions/plug-in-actions.c + * app/actions/tools-actions.c: removed useless #includes, cleanup. + +2004-09-20 Michael Natterer <mitch@gimp.org> + + * app/dialogs/dialogs.[ch] (dialogs_init): added GimpMenuFactory + parameter and removed inclusion on "menus/menus.h". + + * app/menus/menus.[ch] (menus_init): added GimpActionFactory + parameter and removed inclusion of "actions/actions.h". + + * app/gui/gui.c (gui_restore_callback): pass the factories to the + above functions. + +2004-09-20 Sven Neumann <sven@gimp.org> + + * configure.in: bumped version number to 2.1.6. + +2004-09-20 DindinX <dindinx@gimp.org> + + * plug-ins/common/deinterlace.c: added a preview. Not sure if it is + really useful... + +2004-09-20 DindinX <dindinx@gimp.org> + + * plug-ins/common/shift.c: added a preview. + +2004-09-20 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcolorselect.c (gimp_color_select_xy_events): + removed "case GDK_CONFIGURE" because it's not needed and did + "break" instead of "return FALSE", causing random color changes + when resizing and initially showing the widget. + +2004-09-20 Sven Neumann <sven@gimp.org> + + * Made 2.1.5 release. + +2004-09-20 Michael Natterer <mitch@gimp.org> + + * app/Makefile.am (gimp_2_1_LDFLAGS): removed all -u hacks. + + (gimp_2_1_LDADD) + (gimp_console_2_1_LDADD): reordered .a files correctly. The core + seems to be cleaned up enough to have proper dependencies now. + +2004-09-20 Michael Natterer <mitch@gimp.org> + + * app/actions/channels-commands.c + * app/actions/vectors-commands.c: removed massive code duplication + by factoring out the code that creates the "New Channel/Path" and + "Edit Channel/Path Attributes" dialogs out to utility functions. + GUI spacing and Code cleanup. + + * app/actions/layers-commands.c: minor GUI spacing and code + cleanup. + +2004-09-19 Sven Neumann <sven@gimp.org> + + * app/base/tile-manager.c (tile_manager_get_memsize): count valid + tiles, not dirty ones. + +2004-09-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/bumpmap.c: some tweaks to the dialog layout. + +2004-09-19 Michael Natterer <mitch@gimp.org> + + * app/actions/qmask-commands.c (qmask_invert_cmd_callback): is a + GtkRadioAction callback but behaved like a GtkToggleAction + callback. Fixes bug #152948. + +2004-09-19 DindinX <dindinx@gimp.org> + + * plug-ins/common/bumpmap.c: use a GimpDrawablePreview instead of a + very complicated homemade preview. Many small changes in the code + too, and some cleanups. I hope I didn't break anything. + +2004-09-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimppaintoptions-gui.c: clean up ugliness introduced + by my previous commit -- no functional change. + +2004-09-19 Sven Neumann <sven@gimp.org> + + Improved undo memory calculation for paint operations (bug #153035): + + * app/base/tile-manager.[ch] (tile_manager_get_memsize): added a + "gboolean sparse" parameter to get more accurate results for + sparse tile-managers. + + * app/core/gimpbuffer.c + * app/core/gimpdrawable.c + * app/core/gimpimage-undo-push.c + * app/core/gimpimage.c + * app/core/gimplayer.c + * app/core/gimpprojection.c: changed accordingly. + +2004-09-19 Sven Neumann <sven@gimp.org> + + * app/dialogs/Makefile.am (libappdialogs_a_SOURCES): added authors.h. + +2004-09-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimppaintoptions-gui.c: rearrange tool options as + described in bug #153014. + +2004-09-19 Sven Neumann <sven@gimp.org> + + * app/widgets/gimperrordialog.c (gimp_error_dialog_add): fixed + handling of too many error messages. + +2004-09-19 Sven Neumann <sven@gimp.org> + + Try to make floating selections more obvious: + + * app/widgets/gimplayertreeview.c + (gimp_layer_tree_view_floating_selection_changed): always display + "Floating Selection" as the name for a floating selection. + + * app/core/gimpselection.c (gimp_selection_float): call the new + layer "Selection" instead of "Floating Selection". This is what + will be displayed if the FS is turned into a layer. + + * app/actions/layers-commands.c (layers_edit_layer_query): don't + special case floating selections here. + + * app/core/gimplayer-floating-sel.c: cosmetics. + +2004-09-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/postscript.c (ps_open): applied a patch by Peter + Kirchgessner that solves a problem with the recognition of the + bounding box. Fixes bug #152829. + +2004-09-19 Sven Neumann <sven@gimp.org> + + * libgimpcolor/gimprgb-parse.c (gimp_rgb_parse_hex): fixed gtk-doc + comment. + +2004-09-18 Simon Budig <simon@gimp.org> + + * libgimpwidgets/gimpcolorhexentry.c: Removed check for len % 3 == 0, + so that the entry accepts hex colors starting with "#" again. + Untabbified. + +2004-09-18 Manish Singh <yosh@gimp.org> + + * app/Makefile.am: remove LDFLAGS references to now private + file_open_dialog_show, file_open_location_dialog_show, and + file_save_dialog_show. + +2004-09-18 Sven Neumann <sven@gimp.org> + + * app/actions/qmask-commands.c + * libgimpcolor/gimprgb.c (gimp_rgba_distance): just some cleanup. + + * app/core/gimpimage-qmask.c (gimp_image_set_qmask_color): always + set gimage->qmask_color regardless of the qmask state. + + * libgimpwidgets/gimpcolorbutton.c (gimp_color_button_new): set + the type before setting the color. + +2004-09-17 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcomponenteditor.c + (gimp_component_editor_renderer_update): use + gimp_component_editor_get_iter() instead of duplicating its code. + +2004-09-17 Simon Budig <simon@gimp.org> + + * app/widgets/gimpbrusheditor.[ch]: Added a slider for the + brush spacing to the brush editor. Should make it more obvious + how to change it. + +2004-09-17 Sven Neumann <sven@gimp.org> + + * app/core/gimp-edit.c (gimp_edit_paste): based on a patch from + Joao S. O. Bueno: Ensure that the pasted layer is always within + the image, if it fits and aligned at top left if it doesn't. + Fixes bug #142944. + +2004-09-16 Sven Neumann <sven@gimp.org> + + * INSTALL: updated. + +2004-09-16 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpwidgets.c (gimp_scale_entry_set_logarithmic): + applied a patch by Joao S. O. Bueno that fixes bug #152820. + +2004-09-16 Dave Neary <bolsh@gimp.org> + + * plug-ins/script-fu/scripts/burn-in-anim.scm: patch from Kevin + Cozens which reinstates corona. Fixes bug #142282. + +2004-09-16 Michael Natterer <mitch@gimp.org> + + * configure.in: depend on GLib >= 2.4.5 and GTK+ >= 2.4.4. + + * app/gui/gui.c: changed accordingly. + + * app/sanity.c: ditto. Added check for GLib and put each check + into its own utility function. Enabled #if 0'ed check for + FreeType >= 6.2.7. + + * app/widgets/gimpactiongroup.c + * app/widgets/gimpcursor.c + * app/widgets/gimpselectiondata.c + * app/widgets/gimpuimanager.c + * app/widgets/gimpwidgets-utils.c: removed workarounds for library + versions we refuse to start with. + +2004-09-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdnd.c (gimp_dnd_uri_list_dest_add): reverse + order of DND dests so "text/uri-list" is preferred again after my + DND change of 2004-06-29. Fixes dropping of multiple files. + +2004-09-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcomponenteditor.[ch]: set the viewable + renderer's "renderer" property to NULL when clearing the + view to work around bug #149906. + +2004-09-16 Sven Neumann <sven@gimp.org> + + * app/core/gimpscanconvert.c (VALUE_TO_PIXEL): replaced a bitshift + with a binary and. Should be unnoticeably faster ;) + +2004-09-16 Michael Natterer <mitch@gimp.org> + + * app/pdb/procedural_db.c: removed #if 0'ed code, took assignments + out of if()-conditions, minor cleanup. + +2004-09-16 Simon Budig <simon@gimp.org> + + * app/core/gimpscanconvert.c: Implemented an own rendering + callback for libart and use it instead of art_gray_svp_aa(). + This now handles non-antialiased scan conversions itself. It + also basically shows the way to implement a LUT for the + scan conversion. + +2004-09-16 Sven Neumann <sven@gimp.org> + + * app/dialogs/quit-dialog.c: removed code that isn't needed any + longer now that the dialog is a singleton. + +2004-09-15 DindinX <david@dindinx.org> + + * plug-ins/common/mblur.c: fix the preview for the zoom blur mode. + +2004-09-15 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.c + (gimp_preview_area_[draw|blend|mask]): fixed code that handles + drawing outside of the preview area. + + * plug-ins/common/unsharp.c (preview_update): draw the preview + directly from the pixel region. + +2004-09-15 Manish Singh <yosh@gimp.org> + + * modules/controller_linux_input.c: use guint16 instead of __u16. + Should fix bug #152746. + +2004-09-15 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablepreview.[ch] + * libgimp/gimpui.def: renamed gimp_drawable_preview_draw() to + gimp_drawable_preview_draw_buffer() and added a rowstride + parameter. Added new functions gimp_drawable_preview_get_drawable() + and gimp_drawable_preview_draw_region(). + + * plug-ins/common/mblur.c: added a preview that uses the + shadow tiles as the preview buffer and draws using the new + gimp_drawable_preview_draw_region() API. + + * plug-ins/common/photocopy.c + * plug-ins/common/softglow.c: use gimp_drawable_preview_draw_region(). + + * plug-ins/common/cartoon.c + * plug-ins/common/despeckle.c + * plug-ins/common/edge.c + * plug-ins/common/gauss.c + * plug-ins/common/grid.c + * plug-ins/common/neon.c + * plug-ins/common/noisify.c + * plug-ins/common/sel_gauss.c + * plug-ins/common/sharpen.c + * plug-ins/common/sobel.c + * plug-ins/common/spread.c + * plug-ins/common/struc.c + * plug-ins/common/unsharp.c + * plug-ins/common/wind.c: use gimp_drawable_preview_draw_buffer(). + +2004-09-15 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimphelp-ids.h: added help IDs for the drawable- and + vectors-visible and -liked actions as well as for the layer mask + property action. + + * app/actions/drawable-actions.c + * app/actions/vectors-actions.c: use them. + + * app/actions/layers-actions.c + * app/actions/layers-commands.[ch]: ditto. Use + GIMP_STOCK_TRANSPARENCY for all layer opacity actions. Replaced + "paint_mode" by "mode" in all action and function/variable names + because this is the layer mode, not a paint mode. + + * app/actions/channels-commands.c + * app/actions/layers-commands.c + * app/actions/vectors-commands.c: set the "activates-default" + property on the name entry in all "New Foo" and "Edit Foo + Attributes" dialogs except in the "New Layer" dialog. + Addresses bug #148026. + + * menus/image-menu.xml.in: added a (commented out) layer + properties menu containing all the new actions. + +2004-09-15 Michael Natterer <mitch@gimp.org> + + * app/actions/layers-actions.c + * app/actions/layers-commands.[ch]: added actions and callbacks + "layers-preserve-transparency" and + "layers-paint-mode-first,last,previous,next". Update the "active" + state of the recently added layer mask property actions in + layers_actions_update(). + + * app/actions/drawable-actions.c + * app/actions/drawable-commands.[ch]: added actions and callbacks + for "drawable-visible" and "drawable-linked". Fixes bug #152597. + + * app/actions/vectors-actions.c + * app/actions/vectors-commands.[ch]: same here ("vectors-visible" + and "vectors-linked"). + + * app/widgets/gimplayertreeview.c + (gimp_layer_tree_view_preserve_button_toggled): flush the image + so the new actions are updated. Compress preserve_trans undos. + + * menus/image-menu.xml.in: added the layer mask property actions + to the Layers/Mask submenu. + + * menus/layers-menu.xml: reordered the mask property actions + to have the same order as in the image menu. + +2004-09-15 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcontainertreeview.c + (gimp_container_tree_view_menu_position): improved the fix for bug + #152662 and removed trailing whitespace. + +2004-09-15 Nathan Summers <rock@gimp.org> + + * app/widgets/gimpcontainertreeview.c + (gimp_container_tree_view_menu_position): clamp the popup menu's Y + position to the visible area of the GtkTreeView. Fixes #152662. + +2004-09-14 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpquerybox.c: set the "activates-default" + property on the entries in all query boxes so hitting "return" + confirms them. Addresses bug #148026. + +2004-09-14 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpbufferview.c: simplified the code which deals + with the global_buffer's preview. The new buffer view renderer + does the aspect ratio magic all by itself now. + + * app/actions/image-commands.h: removed trailing whitespace. + +2004-09-14 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpviewrendererbuffer.[ch]: added a view renderer + which knows how to preserve a GimpBuffer's aspect ratio if the + view's aspect ratio is different. + + * app/widgets/gimpviewrenderer-utils.c + (gimp_view_renderer_type_from_viewable_type): use it for viewables + of type GimpBuffer. Fixes bug #152531 + +2004-09-14 Sven Neumann <sven@gimp.org> + + * plug-ins/common/flarefx.c + * plug-ins/common/nova.c: embed the preview into a sunken frame + and put it into the upper left corner of the dialog. + +2004-09-14 Sven Neumann <sven@gimp.org> + + * app/dialogs/dialogs-constructors.[ch] + * app/dialogs/dialogs.c + * app/gui/gui.c: let the dialog factory handle the quit dialog + as singleton. Fixes bug #151914. + + * app/dialogs/quit-dialog.c: added a warning here. We need a + container of dirty images for the above change to work correctly. + +2004-09-13 Sven Neumann <sven@gimp.org> + + * plug-ins/common/jpeg.c (save_dialog): make the "Save EXIF data" + toggle insensitive when no EXIF data is present (bug #140042). + + * app/display/gimpdisplayshell-close.c: as suggested by the HIG, + ask the user to save the image when the last display is being + closed. Addresses some issues raised in bug #106726. + +2004-09-13 Michael Natterer <mitch@gimp.org> + + * app/app_procs.c (app_run): install the message handler for the + "Gimp-Dialogs" domain. + +2004-09-13 Michael Natterer <mitch@gimp.org> + + * app/actions/file-commands.c: resurrected file_open_dialog_show() + and file_save_dialog_show() as private utility functions to get + rid of code duplication. + +2004-09-13 Michael Natterer <mitch@gimp.org> + + Manage the file-save dialog using the dialog factory and stop + making menu items insensitive while it is open. Fixes bug #81407. + + * app/dialogs/Makefile.am + * app/dialogs/file-dialog-utils.[ch]: removed these files. + + * app/dialogs/file-save-dialog.[ch]: removed functions + file_save_dialog_show() and file_save_a_copy_dialog_show() and + changed internal function file_save_dialog_create() to + file_save_dialog_new(). + + * app/dialogs/dialogs.c + * app/dialogs/dialogs-constructors.[ch]: made it completely + managed by the dialog factory. + + * app/actions/file-commands.c: create it using the dialog + factory. Attach it to the image so we open only one save + dialog per image. + + * app/dialogs/file-open-dialog.c: added precondition checks + to file_open_dialog_new(). + +2004-09-13 Sven Neumann <sven@gimp.org> + + * plug-ins/common/jpeg.c: some code cleanup. + +2004-09-13 Michael Natterer <mitch@gimp.org> + + * app/dialogs/file-open-dialog.[ch]: removed function + file_open_dialog_show() and changed internal function + file_open_dialog_create() to file_open_dialog_new(). + + * app/dialogs/dialogs.c + * app/dialogs/dialogs-constructors.[ch]: made it completely + managed by the dialog factory. + + * app/actions/file-commands.c: create it using the dialog factory. + +2004-09-13 Michael Natterer <mitch@gimp.org> + + * configure.in + * app/Makefile.am: added new directory app/dialogs and link + libappdialogs.c into the gimp binary. + + * app/gui/Makefile.am + * app/gui/gui-types.h + * app/gui/gui-vtable.c + * app/gui/gui.c + + * app/gui/about-dialog.[ch] + * app/gui/authors.h + * app/gui/color-notebook.[ch] + * app/gui/convert-dialog.[ch] + * app/gui/dialogs-constructors.[ch] + * app/gui/dialogs.[ch] + * app/gui/file-dialog-utils.[ch] + * app/gui/file-new-dialog.[ch] + * app/gui/file-open-dialog.[ch] + * app/gui/file-open-location-dialog.[ch] + * app/gui/file-save-dialog.[ch] + * app/gui/grid-dialog.[ch] + * app/gui/info-dialog.[ch] + * app/gui/info-window.[ch] + * app/gui/module-browser.[ch] + * app/gui/offset-dialog.[ch] + * app/gui/palette-import-dialog.[ch] + * app/gui/preferences-dialog.[ch] + * app/gui/quit-dialog.[ch] + * app/gui/resize-dialog.[ch] + * app/gui/resolution-calibrate-dialog.[ch] + * app/gui/stroke-dialog.[ch] + * app/gui/tips-dialog.[ch] + * app/gui/tips-parser.[ch] + * app/gui/user-install-dialog.[ch]: removed these files... + + * app/dialogs/Makefile.am + * app/dialogs/dialogs-types.h + + * app/dialogs/*.[ch]: ...and added them here. Changed some + filenames like module-browser -> module-dialog. + + * app/app_procs.c + * app/actions/actions-types.h + * app/actions/actions.c + * app/actions/dialogs-actions.c + * app/actions/dialogs-commands.c + * app/actions/dockable-commands.c + * app/actions/drawable-commands.c + * app/actions/edit-commands.c + * app/actions/file-commands.c + * app/actions/gradient-editor-commands.c + * app/actions/image-commands.c + * app/actions/layers-commands.c + * app/actions/palettes-commands.c + * app/actions/select-commands.c + * app/actions/templates-commands.c + * app/actions/templates-commands.h + * app/actions/vectors-commands.c + * app/actions/view-commands.c + * app/display/gimpdisplayshell-cursor.c + * app/display/gimpdisplayshell-title.c + * app/display/gimpdisplayshell.[ch] + * app/tools/gimpcroptool.c + * app/tools/gimpperspectivetool.c + * app/tools/gimprotatetool.c + * app/tools/gimpscaletool.c + * app/tools/gimpsheartool.c + * app/tools/gimptransformtool.[ch] + * app/tools/gimpvectortool.c + * app/widgets/gimpcolormapeditor.[ch] + * app/widgets/gimpcolorpanel.c + * app/widgets/gimpgradienteditor.[ch] + * app/widgets/gimppaletteeditor.[ch] + * app/widgets/gimptoolbox-color-area.c + * menus/toolbox-menu.xml.in + * tools/authorsgen/authorsgen.pl: changed accordingly. + +2004-09-13 Michael Natterer <mitch@gimp.org> + + Restore binary compatibility of the wire protocol that was + broken by the recent GPConfig changes: + + * libgimpbase/gimpprotocol.[ch] (struct _GPConfig) + (_gp_config_read) + (_gp_config_write): argh, we can't use the two bytes padding + because that's just a binary compatible struct change, but inserts + two bytes into the byte stream that goes over the wire. Use the + first two bytes of the former "gdouble gamma" instead. + + * app/plug-in/plug-in-run.c (plug_in_run) + * libgimp/gimp.c (gimp_config): changed accordingly. + +2004-09-13 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphelp.c: simulate the behaviour of GNU gettext and + look at the LANGUAGE environment variable if the locale is not "C". + +2004-09-13 Simon Budig <simon@gimp.org> + + * app/tools/gimpcroptool.c: Fix trailing whitespace introduced by me. + /me hides embarrassed in a corner... :) + +2004-09-13 Simon Budig <simon@gimp.org> + + * app/tools/gimpcroptool.c: Fix warnings and coding style. + +2004-09-12 Nathan Summers <rock@gimp.org> + + * app/tools/gimpcroptool.c: disable crop and resize buttons while the + operation is being processed. Fixes #152372. + +2004-09-12 Sven Neumann <sven@gimp.org> + + * plug-ins/common/aa.c (aa_dialog): use a combo box for format + selection. + +2004-09-12 Sven Neumann <sven@gimp.org> + + * libgimp/gimppixelrgn.c: fixed gtk-doc comments, removed trailing + whitespace. + +2004-09-12 DindinX <david@dindinx.org> + + * libgimp/gimppixelrgn.c: some more fixes by nomis. + +2004-09-12 DindinX <david@dindinx.org> + + * libgimp/gimppixelrgn.c: nomis helped me to make some correction to + the documentation. + +2004-09-12 DindinX <david@dindinx.org> + + * libgimp/gimppixelrgn.c: more documentation. + +2004-09-11 DindinX <david@dindinx.org> + + * plug-ins/common/edge.c: added a default value (TRUE) for the + update_preview toggle. + + * plug-ins/common/wind.c: ported to GimpPreviewArea, so the preview is + much more useful now. + +2004-09-11 DindinX <david@dindinx.org> + + * libgimp/gimppixelrgn.c: added some gtk-doc documentation to pixel + region related functions. (work in progress) + +2004-09-11 Simon Budig <simon@gimp.org> + + * app/widgets/gimpdialogfactory.[ch]: Added boolean parameter to + gimp_dialog_factories_toggle to make it possible to ensure a visible + toolbox. + + * app/actions/dialogs-commands.c: Use the new parameter to ensure + toolbox visibility after the last image window closes. + + * app/display/gimpdisplayshell-callbacks.c: Changed accordingly. + + Fixes bug #137057 (the discussion is in bug #152285) + +2004-09-11 DindinX <david@dindinx.org> + + * plug-ins/common/edge.c: ported to GimpPreviewArea. 100 less lines of + code and much more features! + +2004-09-11 DindinX <david@dindinx.org> + + * plug-ins/common/oilify.c: some code cleanup and small optimisations. + +2004-09-10 Sven Neumann <sven@gimp.org> + + * plug-ins/common/xpm.c (query): fixed spelling. + +2004-09-10 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/widgets/gimperrorconsole.c: fix typo + +2004-09-10 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcolorselect.c: untabified, removed useless + inclusion of <gdk/gdkkeysyms.h>. + +2004-09-10 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpcolorselect.c: ported to GimpPreviewArea. + Destroy the GdkGC in unrealize() instead of in finalize(). + +2004-09-10 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainertreeview-dnd.c + (gimp_container_tree_view_drop_status): always call + gdk_drag_status() before returning FALSE. + + (gimp_container_tree_view_drag_motion): never return FALSE, an + impossible drop location is now reported by calling + gdk_drag_status() above. Always returning TRUE makes sure + gimp_container_tree_view_drag_leave() is called unconditionally + and can remove the scroll_timeout set in drag_motion(). + + Fixes bug #152193 and many other obscure DND crashes caused by the + scroll_timeout being invoked after the widget is destroyed. + +2004-09-10 Sven Neumann <sven@gimp.org> + + * plug-ins/common/xpm.c: improved PDB blurb and help. Very loosely + based on a patch attached to bug #151912. + +2004-09-10 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_thumb): + also handle GRAY and GRAYA thumbnails. + + * tools/pdbgen/pdb/drawable.pdb + * tools/pdbgen/pdb/image.pdb: corrected documentation for + _gimp_drawable_thumbnail() and _gimp_image_thumbnail(). + + * app/pdb/drawable_cmds.c + * app/pdb/image_cmds.c + * libgimp/gimpdrawable_pdb.c + * libgimp/gimpimage_pdb.c: regenerated. + +2004-09-10 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.c: fixed positioning of the + navigation marker and handling of motion events. + +2004-09-10 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.c + * libgimpwidgets/gimppreviewarea.c: documented new functions. + +2004-09-09 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablepreview.c + * libgimpwidgets/gimppreview.[ch]: added a navigation popup + similar to the one in the image window. Needs some more work. + +2004-09-09 DindinX <david@dindinx.org> + + * libgimpwidgets/gimppreviewarea.c: added a utility function + gimp_preview_area_queue_draw(), which queue the right part of the + preview to be redrawn. And use it in all the drawing functions. This + fix a problem where the preview wasn't updated correctly after a + resize. + +2004-09-09 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/cartoon.c + * plug-ins/common/despeckle.c + * plug-ins/common/gauss.c + * plug-ins/common/grid.c + * plug-ins/common/neon.c + * plug-ins/common/noisify.c + * plug-ins/common/photocopy.c + * plug-ins/common/sel_gauss.c + * plug-ins/common/sharpen.c + * plug-ins/common/sobel.c + * plug-ins/common/softglow.c + * plug-ins/common/spread.c + * plug-ins/common/struc.c + * plug-ins/common/unsharp.c: pack all drawable previews expanding. + Also did some general cleanups like consistently naming the dialog + variable "dialog" and the main vbox "main_vbox". + +2004-09-09 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.[ch]: right-align the preview for RTL + layouts. + +2004-09-09 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.[ch]: allow to set a maximum size + and center the preview area if its allocation extends the maximum. + + * libgimpwidgets/gimppreview.[ch]: derive from GtkVBox, moved the + toggle button out of the table and put the table into an aspect + frame. Added an API to set the preview boundaries. Set the maximum + size of the GimpPreviewArea from that function. + + * libgimpwidgets/gimpwidgets.def: added new entries. + + * libgimp/gimpdrawablepreview.c: use gimp_preview_set_bounds(). + + * plug-ins/common/gauss.c: pack the preview widget so that it + resizes with the dialog. + +2004-09-09 DindinX <david@dindinx.org> + + * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_blend) + (gimp_preview_area_mask): optimized the case where both buffers have + the same alpha for a given pixel. + +2004-09-09 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpviewrendererbrush.c + * app/widgets/gimpviewrendererdrawable.c + * app/widgets/gimpviewrenderergradient.c + * app/widgets/gimpviewrendererimage.c + * app/widgets/gimpviewrendererimagefile.c + * app/widgets/gimpviewrendererlayer.c + * app/widgets/gimpviewrenderervectors.c: purely cosmetic cleanup. + +2004-09-09 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimppdbdialog.c (gimp_pdb_dialog_constructor): use + g_type_name(dialog_type) instead of just "pdb dialog" as name for + the dialog's private context. + +2004-09-09 Michael Natterer <mitch@gimp.org> + + * app/gui/convert-dialog.[ch] (convert_dialog_new): changed + GimpDisplay* parameter to GimpProgress* because that's what it's + used for. + + * app/actions/image-commands.c (image_convert_cmd_callback): + changed accordingly. + + * app/gui/convert-dialog.c: massively cleaned up internals. Use a + GimpViewableButton + GimpContainerEntry combo as in text options + for selecting the custom palette. Use a filtered container which + contains only palettes with a maximum of 256 colors. + Fixes bug #136574 + +2004-09-09 Michael Natterer <mitch@gimp.org> + + * app/gui/file-open-location-dialog.[ch]: changed + file_open_location_dialog_show() to + file_open_location_dialog_new() and return the dialog. + + * app/gui/dialogs.c + * app/gui/dialogs-constructors.[ch]: added a constructor for it + and let the dialog factory manage it entirely. + + * app/actions/file-commands.c + (file_open_location_dialog_cmd_callback): use the dialog factory + to create it. + +2004-09-09 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdialogfactory.c + (gimp_dialog_factory_dialog_new_internal): renamed parameter + "gboolean raise_if_found" to "return_existing" and added + additional parameter "gboolean present". + + (gimp_dialog_factory_dialog_new) + (gimp_dialog_factory_dialog_raise) + (gimp_dialog_factory_dockable_new): pass both parameters (passing + "present" as "raise_if_found" was not quite correct). + +2004-09-08 DindinX <david@dindinx.org> + + * libgimpwidgets/gimppreviewarea.c: fixed a stupid typo. + +2004-09-08 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_fill): + optimized solid color fills. + +2004-09-08 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.c: factored out common code. + Reduced indentation level by closing a switch earlier. + +2004-09-08 DindinX <david@dindinx.org> + + * libgimpwidgets/gimppreviewarea.c: (gimp_preview_area_blend) + use gimp_preview_area_draw when the opacity is 0 or 255, instead of + duplicating code. + +2004-09-07 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpwidgets.def: added new entries. + + * libgimpwidgets/test-preview-area.c: fit output into 80 columns. + + * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw): some + code cleanup. + +2004-09-07 DindinX <david@dindinx.org> + + * libgimpwidgets/test-preview-area.c: added some tests for + gimp_preview_area_blend() and gimp_preview_area_mask(). + +2004-09-07 DindinX <david@dindinx.org> + + * libgimpwidgets/gimppreviewarea.c + * libgimpwidgets/gimppreviewarea.h: added two functions: + gimp_preview_area_blend() to draw the blending of two buffers with + an opacity parameter, and gimp_preview_area_mask() to draw the + blending of two buffers, with a mask buffer. The code still needs some + polish, though. + + * libgimp/gimpdrawablepreview.c + * libgimp/gimpdrawablepreview.h: use gimp_preview_area_mask() in + gimp_drawable_preview_draw(), so the previews are now much more + accurate (respecting the selection, if any). + + Also made the buf parameter of gimp_drawable_preview_draw() a pointer + to constants. + +2004-09-07 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-draw.c + (gimp_display_shell_draw_grid): #define the constant crosshair + size for the INTERSECTION grid style instead of using an eeky + "const gint". + +2004-09-07 Michael Natterer <mitch@gimp.org> + + * app/gui/dialogs.c (toplevel_entries): added a foreign entry + "gimp-file-open-loaction-dialog". + + * app/gui/file-open-location-dialog.c: register the dialog + with the toplevel dialog factory so it remembers its position. + +2004-09-07 Michael Natterer <mitch@gimp.org> + + * app/actions/context-actions.c + * app/actions/context-commands.[ch]: applied a heavily modified + patch from David Gowers which adds actions to modify the context's + paint_mode. Fixes bug #151471. + + * menus/image-menu.xml.in: added them to the (commentd out) + "Context" submenu. + +2004-09-07 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/edge.c: indentation and whitespace cleanup. + + * plug-ins/common/struc.c: minor coding style issues. + +2004-09-07 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/xwd.c (query): applied patch from Alan Horkan + which improves the blurb and help texts. Fixes bug #151912. + + Unrelated: did coding style / indentation cleanup in the whole file. + +2004-09-07 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): + simplified the code that selects an image file by its URI. + +2004-09-07 Simon Budig <simon@gimp.org> + + * app/widgets/gimpviewrendererbrush.c: Added an indicator for + generated brushes. Pretty straightforward, suggestions for + improvements are welcome. + +2004-09-06 DindinX <david@dindinx.org> + + * plug-ins/common/struc.c: added a preview. + +2004-09-06 Simon Budig <simon@gimp.org> + + * app/tools/gimpcroptool.c: reordered info_dialog_hide() and + crop_tool_crop_image(), which avoids the repeated popping up + of the info dialog and avoids a crash. + + Fixes bug #151712 + +2004-09-05 DindinX <david@dindinx.org> + + * plug-ins/common/cartoon.c: use gimp_preview_invalidate() where + appropriate. + + * plug-ins/common/photocopy.c: Added a preview. + +2004-09-05 Sven Neumann <sven@gimp.org> + + * configure.in: bumped version number to 2.1.5. + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): select + the image file, not only the folder it lives in. Fixes bug #151638. + +2004-09-05 DindinX <david@dindinx.org> + + * plug-ins/common/cartoon.c: Added a preview. + +2004-09-05 Simon Budig <simon@gimp.org> + + * plug-ins/common/autocrop.c: fix handling of layers with an + offset. Resize the image before cropping when the covered area + of a layer is partially outside the image area. Make math more + comprehensible. + +2004-09-05 Sven Neumann <sven@gimp.org> + + * plug-ins/common/convmatrix.c + * plug-ins/common/smooth_palette.c + * plug-ins/flame/flame.c: renamed functions from doit() to + something less silly. + +2004-09-05 Sven Neumann <sven@gimp.org> + + * Made 2.1.4 release. + +2004-09-05 Simon Budig <simon@gimp.org> + + * tools/pdbgen/pdb/image.pdb: improved documentation for + gimp_image_resize_to_layers + + * libgimp/gimp.def: added gimp_image_resize_to_layers + + * app/pdb/image_cmds.c + * libgimp/gimpimage_pdb.c: regenerated + +2004-09-05 Simon Budig <simon@gimp.org> + + * app/core/gimpimage-resize.[ch]: Implement function to resize + the image to contain all layers completely. Untabified. + + * app/actions/image-actions.c + * app/actions/image-commands.[ch] + * app/widgets/gimphelp-ids.h + * menus/image-menu.xml.in: Make it available in the GUI. + + * tools/pdbgen/pdb/image.pdb: Make it available in the PDB. + + * app/pdb/image_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpimage_pdb.[ch]: regenerated. + +2004-09-04 DindinX <david@dindinx.org> + + * plug-ins/common/noisify.c: ported to GimpDrawablePreview. + +2004-09-04 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimp/gimp.def + * libgimpbase/gimpbase.def + * libgimpwidgets/gimpwidgets.def: added the check(erboard) related + entries + +2004-09-04 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.[ch]: pass a GdkEventButton to + gimp_preview_area_menu_popup(). + + * libgimpwidgets/gimppreview.c: implement GtkWidget::popup_menu(). + +2004-09-04 DindinX <david@dindinx.org> + + * libgimpwidgets/gimppreview.c: Changed the way we attach the preview + area frame to the table so very small drawables don't cause a + malicious bug. + +2004-09-04 DindinX <david@dindinx.org> + + * plug-ins/common/sel_gauss.c: ported to GimpDrawablePreview. + +2004-09-04 DindinX <david@dindinx.org> + + * plug-ins/common/sharpen.c: ported to GimpDrawablePreview. + +2004-09-03 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.[ch]: added + gimp_preview_area_menu_popup(). Not completely finished yet... + + * libgimpwidgets/gimppreview.c: use the new function. + +2004-09-03 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_set_drawable): + take care of setting the colormap for indexed drawables. + + * libgimpwidgets/gimppreview.c (gimp_preview_area_event): pan with + the first mouse button only. We will need the other buttons. + +2004-09-03 Sven Neumann <sven@gimp.org> + + * plug-ins/common/grid.c: ported to GimpDrawablePreview. + +2004-09-03 Sven Neumann <sven@gimp.org> + + * plug-ins/common/plasma.c (plasma_dialog): left-align the preview. + + * plug-ins/common/grid.c (dialog): pack the preview as in other + plug-in dialogs and embed it into a GtkFrame. + +2004-09-03 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdevicestatus.c: removed "Configure input + devices" button. Fixes bug #150177. + +2004-09-03 Simon Budig <simon@gimp.org> + + * app/gui/info-window.c: Applied modified patch by Kevin Cozens + that implements a "Comments" tab in the image info dialog. + + Fixes bug #151719. + +2004-09-03 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): swapped light + and gray checks to get a checkerboard that matches the image window. + +2004-09-03 Michael Natterer <mitch@gimp.org> + + * libgimpbase/gimpprotocol.h (struct _GPConfig): replaced the + never used "gdouble gamma" with 8 reserved gint8 and stuffed two + gint8 behind "gint8 show_tool_tips" where they fit in in a binary + compatible way due to 32bit aligning of the following "gint32 + min_colors". Use the latter ones for "check_size" and + "check_type". + + * libgimpbase/gimpprotocol.c (_gp_config_read,write): changed + accordingly to pass the new stuff over the wire. + + * app/plug-in/plug-in-run.c: ditto. Pass the transpareny values + from GimpDisplayConfig to plug-ins. + + * libgimp/gimp.[ch] (gimp_config): remember the new config values. + (gimp_check_size,type): new functions returning the new config values. + + * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_init): + use the new values to configure preview->area accordingly. + +2004-09-03 Sven Neumann <sven@gimp.org> + + * libgimpbase/gimpchecks.h + * libgimpbase/gimplimits.h: moved check size and check color + defines. It makes a lot more sense to keep them in gimpchecks.h. + + * libgimpbase/gimpchecks.c (gimp_checks_get_shades): documented. + + * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw): + added a sanity check so we don't crash if the drawable pointer + should ever be NULL here. + +2004-09-02 Helvetix Victorinox <helvetix@gimp.org> + + * app/composite/gimp-composite-*test.c: a regression test now + iterates over 8388625 pixels per pass. + + * app/composite/gimp-composite-mmx.c + * app/composite/gimp-composite-sse.c + * app/composite/gimp-composite-sse2.c: + Ensured that a clobbered condition code register is reflected in + the clobbered register list for each asm() statement. + This should FIX bug #147013. + +2004-09-03 Sven Neumann <sven@gimp.org> + + * libgimpbase/Makefile.am + * libgimpbase/gimpchecks.[ch] added gimp_checks_get_shades(). + + * app/base/temp-buf.c + * app/display/gimpdisplayshell-render.c + * libgimpwidgets/gimppreviewarea.c: use the new function instead + of replicating these numbers in three different places. + +2004-09-03 DindinX <david@dindinx.org> + + * plug-ins/gimpressionist/*.c: made the code much more readable by + applying the gimp's coding standard (intentation, space, etc.), and + remove the GTK_DISABLE_DEPRECATED warnings, since these files don't use + any deprecated stuff anymore. + +2004-09-02 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimp/gimpui.def + * libgimpbase/gimpbase.def + * libgimpwidgets/gimpwidgets.def: added the preview and progress + related entries + +2004-09-02 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/neon.c + * plug-ins/common/noisify.c + * plug-ins/common/sobel.c + * plug-ins/common/softglow.c + * plug-ins/common/spread.c + * plug-ins/common/unsharp.c: fixed various coding style and naming + issues and added some missing signal connections to update the new + previews. + +2004-09-02 DindinX <david@dindinx.org> + + * plug-ins/common/despeckle.c: don't assume the preview has always the + same size, and do the memory allocation in preview_update(). As a side + effect, this fix a segfault :-). Also save the preview toggle state + between invocations. + +2004-09-02 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-render.c (check_combos): light and + dark check color were swapped for GIMP_CHECK_TYPE_GRAY_CHECKS. + + * libgimpwidgets/gimppreviewarea.[ch]: added "check-size" and + "check-type" properties and draw the checkerboard accordingly. + +2004-09-02 Sven Neumann <sven@gimp.org> + + * app/base/base-enums.[ch] + * libgimpbase/gimpbaseenums.[ch]: moved GimpCheckSize and + GimpCheckType enums to libgimpbase. Correctly prefix the enum + values. + + * app/base/temp-buf.c + * app/config/gimpdisplayconfig.c + * app/display/gimpdisplayshell-render.c + * app/pdb/fileops_cmds.c + * tools/pdbgen/pdb/fileops.pdb: changed accordingly. + +2004-09-02 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/script-fu-interface.c (script_fu_ok) + * plug-ins/script-fu/script-fu-scripts.c (script_fu_script_proc): + use a GString for assembling the commands string instead of + g_sprintf()ing into a buffer. Removes the need for a separate loop + over all args to determine the buffer's length and makes the + remaining code smaller and more readable. + +2004-09-02 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.[ch]: made gimp_preview_draw() public, + added some gtk-doc comments. + (gimp_preview_toggle_callback): immidiately invalidate the preview. + + * plug-ins/common/gauss.c (gauss): fixed (and simplified) handling + of zero radii by using the new GimpPreview API. + +2004-09-01 Helvetix Victorinox <helvetix@gimp.org> + + * app/composite/gimp-composite-mmx.[ch]: Added + gimp_composite_addition_va8_va8_va8_mmx(). + + * app/composite/make-installer.py: Regression tests now include + printing the image type for each test. + + * app/composite/gimp-composite-mmx-test.c + * app/composite/gimp-composite-regression.c + * app/composite/gimp-composite-sse-test.c + * app/composite/gimp-composite-sse2-test.c + * app/composite/gimp-composite-x86.h: regenerated. + +2004-09-02 Sven Neumann <sven@gimp.org> + + * plug-ins/common/borderaverage.c + * plug-ins/common/checkerboard.c + * plug-ins/common/diffraction.c + * plug-ins/common/illusion.c + * plug-ins/common/polar.c + * plug-ins/common/ripple.c + * plug-ins/common/spread.c + * plug-ins/common/video.c: don't pass run_mode to + gimp_rgn_iterator_new(), it's unused. Removes the need for it being + a global variable. + +2004-09-01 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplay.c + * app/widgets/gimpprogressdialog.c: gracefully handle progress + calls after the widget is destroyed. Re-fixes bug #150194. + +2004-09-01 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablepreview.[ch] + * libgimpwidgets/gimppreview.[ch]: always show the "Preview" check + button. Simplified the preview APIs, moved the "size" style + property to the GimpPreview class. + + * etc/gtkrc: changed the example accordingly. + + * plug-ins/common/despeckle.c + * plug-ins/common/gauss.c + * plug-ins/common/neon.c + * plug-ins/common/sobel.c + * plug-ins/common/softglow.c + * plug-ins/common/spread.c + * plug-ins/common/unsharp.c: follow change in GimpDrawablePreview API. + +2004-09-01 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/script-fu-types.h (struct SFOption): changed + "guint history" to "gint history". + + * plug-ins/script-fu/script-fu-interface.c: added callbacks for + string entries and combo boxes and connect *all* widgets to callbacks. + + (script_fu_ok): don't touch the widgets at all but get the values + directly now that the callbacks correctly write them to their + structs. + + (script_fu_reset): don't copy the default values manually but + simply set the default values on the widgets; their callbacks will + do the rest. + + * plug-ins/script-fu/script-fu-scripts.c (script_fu_add_script): + added some line breaks and spaces to make it more readable. + +2004-09-01 Michael Natterer <mitch@gimp.org> + + * libgimp/Makefile.am + * libgimp/gimpui.h + * libgimp/gimpuitypes.h + * libgimp/gimpprogressbar.[ch]: new widget GimpProgressBar which + automatically redirects any progress calls to itself while + it exists. + + * plug-ins/script-fu/script-fu-interface.c: removed all progress + callbacks and simply use a GimpProgressBar. + +2004-09-01 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.[ch]: set a busy cursor while the + preview is being recalculated. + + * libgimp/gimpdrawablepreview.c (gimp_drawable_preview_draw_original): + do nothing if there's no drawable. + +2004-09-01 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.c (CHECK_COLOR): oops, swapped x + and y variables. + + * libgimpwidgets/gimppreview.c: some minor changes, mainly cleanup. + +2004-09-01 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/gimpfu.py + * plug-ins/pygimp/gimpmodule.c: Hacked up support for the new + progress interface. Emphasis on hacked. + + * plug-ins/pygimp/gimpmodule.c: Wrapped gimp_extension_enable(). Minor + cleanups. + + * plug-ins/pygimp/pygimp-image.c + * plug-ins/pygimp/pygimp-tile.c: Minor cleanups. + +2004-08-31 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/plug-ins/gimpcons.py + * plug-ins/pygimp/plug-ins/pdbbrowse.py: remove deprecated mainloop + calls. + +2004-09-01 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablepreview.c: increased default preview size to + 150 pixels. Added a border of 2 pixels around the bounding box of + the selection. + + * libgimpwidgets/gimppreview.[ch]: only show the GDK_FLEUR cursor + if there's something to pan. Set the correct page size on the + scrollbar adjustments. + +2004-09-01 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.[ch]: added new function + gimp_preview_area_set_offsets(). + + * libgimpwidgets/gimppreview.c: use the new function to let the + checkerboard scroll with the preview. + +2004-09-01 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.[ch]: delay the emission of the + "invalidated" signal using a timeout. Removed hack that used to + invalidate the preview on button-release. + + * plug-ins/common/unsharp.c: no need to fiddle with the slider + update policies any longer. + +2004-09-01 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpdialogfactory.[ch]: added a boolean parameter to + gimp_dialog_factory_dialog_new() to let the caller decide whether + the window should be presented or not. + + * app/actions/dialogs-commands.c + * app/actions/image-commands.c + * app/actions/templates-commands.c + * app/gui/gui-vtable.c + * app/gui/gui.c + * app/widgets/gimpsessioninfo.c: changed accordingly. Do not let + gimp_dialog_factory_dialog_new() present the dialog if we need to + change it after creation. This avoids annoying resizes, noticeable + especially with the error dialog. + +2004-08-31 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpdockable.c + * libgimp/gimpdrawablepreview.c: converted tabs to spaces. + +2004-08-31 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablepreview.c: added a style property for the + minimum size. + + * etc/gtkrc: show how to adjust the size of GimpDrawablePreviews. + +2004-08-31 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdatafactoryview.c + (gimp_data_factory_view_activate_item): emit "clicked" on the + edit_button only if it exists and is sensitive. Fixes bug #151343. + +2004-08-31 Manish Singh <yosh@gimp.org> + + * app/plug-in/plug-in.c (plug_in_open): cast plug_in_recv_message + to GSourceFunc. + +2004-08-31 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.c: handle the widget size dynamically. + Hide scrollbars when there's nothing to scroll. + + * libgimp/gimpdrawablepreview.c: simplified a lot. The scrollbars + are handled completely in the GimpPreview widget now. + +2004-08-31 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.c: removed the hardcoded preview size, + removed some redundant assertions. + +2004-08-31 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.[ch]: removed the GUI code... + Also did some minor cleanups. + + * plug-ins/script-fu/script-fu-interface.[ch]: ...and added it here. + + * plug-ins/script-fu/script-fu-types.h: new file keeping the + various struct defs needed by both the above files. + + * plug-ins/script-fu/Makefile.am + * plug-ins/script-fu/siod-wrapper.c: changed accordingly. + +2004-08-31 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimppreview.c (gimp_preview_toggle_callback): + notify the "update" property on the preview, not the toggle. + +2004-08-31 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreview.c: allow to pan the preview with all + mouse buttons. Set a cursor to indicate that panning is possible. + +2004-08-31 DindinX <david@dindinx.org> + + * libgimpwidgets/gimppreview.c + * libgimpwidgets/gimppreview.h: renamed the "updated" signal to + "invalidated" and the confusing "update" virtual function to "draw". + + Gave the properties saner names, too. + + Removed _get_width and _get_height functions in favor of a _get_size + one. + + Added gimp_preview_invalidate function that emits the "invalidated" + signal if needed. + + * libgimp/gimpdrawablepreview.c + * libgimp/gimpdrawablepreview.h: modified accordingly and fixed the + scrollbar range. + + * plug-ins/common/despeckle.c + * plug-ins/common/gauss.c + * plug-ins/common/neon.c + * plug-ins/common/sobel.c + * plug-ins/common/softglow.c + * plug-ins/common/spread.c + * plug-ins/common/unsharp.c: modified accordingly. + +2004-08-31 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.c: removed the script title + label and moved the "About" button to the action_area. Minor + cleanups. + +2004-08-31 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable-transform.[ch]: added GimpProgress + parameter to gimp_drawable_transform_affine(). + + * tools/pdbgen/pdb/edit.pdb + * tools/pdbgen/pdb/transform_tools.pdb: show progress for "blend" + and all transform functions. + + * app/pdb/edit_cmds.c + * app/pdb/transform_tools_cmds.c: regenerated. + +2004-08-31 Sven Neumann <sven@gimp.org> + + * plug-ins/common/curve_bend.c: don't use GDK_TOP_LEFT_ARROW + to restore the default cursor, simply pass NULL to + gdk_window_set_cursor(). + +2004-08-31 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintoptions.[ch]: added "GimpPaintInfo *paint_info" + member and construct property. Changed gimp_paint_options_new() + to take only a GimpPaintInfo parameter. + + * app/core/gimpitem.c (gimp_item_stroke) + * app/core/gimppaintinfo.c (gimp_paint_info_new): changed accordingly. + + * app/core/gimpchannel.c (gimp_channel_stroke) + * app/vectors/gimpvectors.c (gimp_vectors_stroke): use + paint_options->paint_info->paint_type directly instead of casting + to GimpToolOptions and using + tool_options->tool_info->paint_info->paint_type (eek). Fixes crash + when stroking via the PDB because newly created GimpToolOptions + instances have no "tool_info" pointer yet. + + * tools/pdbgen/pdb/paint_tools.pdb: changed all paint PDB wrappers + accordingly. + + * app/pdb/paint_tools_cmds.c: regenerated. + +2004-08-31 Michael Natterer <mitch@gimp.org> + + * app/config/gimpconfig.c (gimp_config_iface_duplicate): set + construct_param->foo, not construct_param*s*->foo, so we don't set + the first construct param again and crash. + +2004-08-31 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/cubism.c: added "..." to the progress text. + +2004-08-31 Michael Natterer <mitch@gimp.org> + + * app/actions/file-actions.c (file_actions): added "..." to "Revert". + +2004-08-31 Sven Neumann <sven@gimp.org> + + * libgimp/gimpuitypes.h + * libgimpwidgets/gimpwidgetstypes.h: moved the GimpDrawablePreview + typedef to the header file that it belongs to. + + * libgimp/gimpdrawablepreview.[ch]: minor include cleanups and + gtk-doc fixes. + +2004-08-31 Sven Neumann <sven@gimp.org> + + * plug-ins/common/gauss.c (gauss_dialog): update the preview when + the blur radius is being changed. gimp_coordinates_new() seems to + be broken though; there shouldn't be two signal connections needed + here. + +2004-08-31 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablepreview.[ch] + * libgimpwidgets/gimppreview.[ch]: minor code cleanup, fixes to + gtk-doc comments and to the handling of object properties. + +2004-08-31 DindinX <david@dindinx.org> + + * libgimpwidgets/gimppreview.c + * libgimpwidgets/gimppreview.h: added a GimpPreview widget, abstract + base for a GimpDrawablePreview. + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgets.h + * libgimpwidgets/gimpwidgetstypes.h: modified accordingly. + + * libgimp/gimpdrawablepreview.c + * libgimp/gimpdrawablepreview.h: added a GimpDrawablePreview widget + to ease the use of previews by plug-ins. + + * libgimp/Makefile.am + * libgimp/gimpui.h: Changed accordingly. + + * plug-ins/common/despeckle.c + * plug-ins/common/gauss.c + * plug-ins/common/neon.c + * plug-ins/common/sobel.c + * plug-ins/common/softglow.c + * plug-ins/common/spread.c + * plug-ins/common/unsharp.c: use a GimpDrawablePreview with these + plug-ins. + +2004-08-30 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-progress.[ch]: added boolean return values + to plug_in_progress_install(), uninstall() and cancel(). Added + checks to make sure the installed progress_callback exists, has + the correct signature and was installed by this plug-in. + + * tools/pdbgen/pdb/progress.pdb: use the return values to let the + PDB wrappers succeed/fail. + + * app/pdb/progress_cmds.c: regenerated. + +2004-08-30 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimp/gimp.def: added gimp_progress_install & + gimp_progress_uninstall + +2004-08-30 Sven Neumann <sven@gimp.org> + + * libgimp/gimpregioniterator.c: document the fact that "run_mode" + is unused. Also did some code cleanup. + +2004-08-30 Michael Natterer <mitch@gimp.org> + + * libgimp/gimpregioniterator.c: always update the progress. + Makes all "run_mode" parameters useless. + +2004-08-30 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/gauss.c: add "..." to the progress text. + +2004-08-30 Sven Neumann <sven@gimp.org> + + * libgimp/gimpprogress.c: added some gtk-doc comments, could be + improved further. + +2004-08-30 Sven Neumann <sven@gimp.org> + + * plug-ins/common/colortoalpha.c + * plug-ins/common/compose.c + * plug-ins/common/decompose.c + * plug-ins/common/film.c + * plug-ins/fits/fits.c: always use the progress API, not doing it + in non-interactive mode has always been wrong. + +2004-08-30 Manish Singh <yosh@gimp.org> + + * libgimp/gimpprogress.[ch] (gimp_progress_uninstall): return the + user_data pointer on uninstall. Eases language binding work. + +2004-08-30 Sven Neumann <sven@gimp.org> + + * libgimp/gimpbrushmenu.c (gimp_brush_select_preview_draw): fixed + drawing of brushes that extend beyond the preview. + +2004-08-30 Sven Neumann <sven@gimp.org> + + * app/tools/gimpvectortool.[ch] (gimp_vector_tool_status_set): + avoid excessive use of strdup() and strcmp(). The strings are all + constant anyway. + +2004-08-30 Michael Natterer <mitch@gimp.org> + + Brought the PDB progress into a working state. Fixes bug #6010, + addresses bugs #97266 and #135185 and unfortunately reopens bug + #150194 (will fix that later). + + * libgimpbase/gimpbaseenums.h: added enum GimpProgressCommand. + + * app/core/gimppdbprogress.c + * libgimp/gimpprogress.c: use the enum instead of integer + constants for the different progress commands. Cleanup. + + * app/plug-in/plug-in-progress.c + * app/plug-in/plug-in-run.c + * app/plug-in/plug-in.c: switch back to real refcounting for + plug_in->progress (reopens bug #150194) and enabled the PDB + progress code. + + * plug-ins/script-fu/script-fu-scripts.c: cleaned up the + progress stuff and the script-fu interface a bit. + + * plug-ins/pygimp/gimpenums.py + * plug-ins/script-fu/script-fu-constants.c + * tools/pdbgen/enums.pl: regenerated. + +2004-08-29 Manish Singh <yosh@gimp.org> + + * app/plug-in/plug-in.c (plug_in_open): set can_recurse on the + recv_message watch, so we don't block on recursive calls to the + handler. plug_in_recv_message needs some refcounting help now + though. + +2004-08-29 Helvetix Victorinox <helvetix@gimp.org> + + * app/composite/gimp-composite-x86.h + * app/composite/gimp-composite-sse.c + * app/composite/gimp-composite-sse2.c: Fixed a bunch of + warnings due to bad type casting. + + * app/composite/gimp-composite-mmx.c + * app/composite/gimp-composite-sse.c + * app/composite/gimp-composite-x86.h + * app/composite/gimp-composite-sse2.c: + The last changes to fix the the clobber registers bug #147013. + Commented out some dead code to be reviewed later. + +2004-08-29 Michael Natterer <mitch@gimp.org> + + Added an API to allow plug-ins to embed the progress for the + actions they trigger into their own GUI (attention: half-done and + broken code ahead...) + + * app/core/Makefile.am + * app/core/core-types.h + * app/core/gimppdbprogress.[ch]: new object implementing dispatching + progress calls to a temporary PDB procedure in a plug-in. + + * app/Makefile.am: force to link gimppdbprogress.o, bah! + + * app/plug-in/plug-in-progress.[ch]: added API to install, + uninstall and cancel a PDB progress for this plug-in, but disabled + the implementation because it doesn't work yet. + + * tools/pdbgen/pdb/progress.pdb: added pdb wrappers for the new + install, uninstall and cancel functions. + + * libgimp/Makefile.am + * libgimp/gimp.h + * libgimp/gimpprogress.[ch]: added an API around the PDB progress + stuff. + + * app/pdb/internal_procs.c + * app/pdb/progress_cmds.c + * libgimp/gimpprogress_pdb.[ch]: regenerated. + + * plug-ins/script-fu/script-fu-scripts.c: use the new API to show + the progress in the script-fu dialog. + +2004-08-29 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimpwidgets/gimpwidgets.def: added + gimp_scale_entry_set_logarithmic + +2004-08-29 Sven Neumann <sven@gimp.org> + + * app/config/gimpconfigwriter.c: don't emit critical warnings + about a messed up state of GimpConfigWriter if the writer is + disabled because of a write error that occured earlier. + +2004-08-29 DindinX <david@dindinx.org> + + * app/core/core-enums.h: Renamed GimpPreviewSize to GimpViewSize. + + * app/core/core-enums.c: Regenerated. + + * app/actions/dockable-actions.c + + * app/config/gimpcoreconfig.c + * app/config/gimpcoreconfig.h + * app/config/gimpdisplayconfig.c + * app/config/gimpdisplayconfig.h + + * app/core/gimpundo.c + + * app/display/gimpnavigationeditor.c + + * app/gui/dialogs.c + * app/gui/file-open-location-dialog.c + + * app/tools/gimppaintoptions-gui.c + * app/tools/gimptextoptions.c + + * app/widgets/gimpbrushselect.c + * app/widgets/gimpcontainerpopup.c + * app/widgets/gimpcontainerview.c + * app/widgets/gimpdialogfactory.c + * app/widgets/gimpfontselect.c + * app/widgets/gimpgradientselect.c + * app/widgets/gimppaletteselect.c + * app/widgets/gimppatternselect.c + * app/widgets/gimpselectioneditor.c + * app/widgets/gimpsessioninfo.c + * app/widgets/gimptemplateeditor.c + * app/widgets/gimpundoeditor.c + * app/widgets/gimpundoeditor.h + * app/widgets/gimpviewablebutton.c: Changed accordingly. + +2004-08-28 Helvetix Victorinox <helvetix@gimp.org> + + * app/composite/gimp-composite-sse.c + * app/composite/gimp-composite-sse2.c: More updates to accomodate + the clobber registers. Additional progress against bug #147013. + + * app/composite/gimp-composite-sse.h: Fixed a bug where the wrong + manifest constant definition caused sse2 instructions to never be + compiled. + +2004-08-28 Sven Neumann <sven@gimp.org> + + * plug-ins/common/vpropagate.c (run): fixed confusion about which + mode to use when being run with last values (bug #151308). + +2004-08-28 Simon Budig <simon@gimp.org> + + * plug-ins/common/plugindetails.c: workaround to avoid a warning + by gcc about the use of "%c" in the format string for strftime. + +2004-08-28 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpwidgets.[ch]: applied a patch from Joao + S. O. Bueno which adds an API that allows to make the scale widget + of a GimpScaleEntry behave logarithmic. Fixes bug #149420. + + * app/widgets/gimpbrusheditor.c: use the new functionality for the + radius control. + +2004-08-28 Sven Neumann <sven@gimp.org> + + * plug-ins/common/compose.c (compose_dialog): applied patch from + Markus Triska that improves which layers are choosen by + default (bug #148172). + +2004-08-28 Sven Neumann <sven@gimp.org> + + * app/core/gimpimage-contiguous-region.c + (find_contiguous_region_helper): applied a patch from Eric Cheung + that changes the function to use a GQueue to implement recursion + instead of recursive function calls. Fixes bug #151124. + + * plug-ins/common/noisify.c (noisify_dialog): left-align the + preview. + +2004-08-28 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphelp-ids.h + * app/widgets/gimptoolbox.c (toolbox_create_image_area): added a + help-id for the image area. + +2004-08-27 Michael Natterer <mitch@gimp.org> + + Moved the gimp_progress_init() and gimp_progress_update() PDB + functions to their own group because they don't belong to the + "Plug-In" namespace and will soon get more functions. + + * tools/pdbgen/pdb/plug_in.pdb: removed the progress stuff... + + * tools/pdbgen/pdb/progress.pdb: ...and added it here. + + * tools/pdbgen/Makefile.am + * tools/pdbgen/groups.pl + * app/pdb/Makefile.am + * libgimp/Makefile.am: changed accordingly. + + * app/pdb/progress_cmds.c + * libgimp/gimpprogress_pdb.[ch]: new generated files. + + * app/pdb/internal_procs.c + * app/pdb/plug_in_cmds.c + * libgimp/gimp_pdb.h + * libgimp/gimpplugin_pdb.[ch]: regenerated. + +2004-08-27 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainereditor.c + (gimp_container_editor_construct): call + gimp_container_editor_select_item() manually at construction time + so views show the initially selected object's state correctly + (e.g. the brush spacing). Fixes bug #151227. + +2004-08-27 DindinX <david@dindinx.org> + + * app/widgets/gimpnavigationpreview.c + * app/widgets/gimpnavigationpreview.h: renamed these files to ... + + * app/widgets/gimpnavigationview.c + * app/widgets/gimpnavigationview.h: to these. + And renamed the GimpNavigationPreview type to GimpNavigationView. + + Hopefully, this is the last change in file names for the Preview->View + renaming process. + + * app/display/gimpnavigationeditor.c + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h: Changed accordingly. + +2004-08-26 Michael Natterer <mitch@gimp.org> + + * app/core/gimpitem.[ch]: removed "gboolean use_default_values" + from GimpItem::stroke(). + + * app/core/gimpchannel.c + * app/core/gimpselection.c + * app/vectors/gimpvectors.c: changed accordingly. + +2004-08-26 Michael Natterer <mitch@gimp.org> + + * app/core/gimpitem.c (gimp_item_stroke): implement the whole + paint_options fiddling here instead of in each subclass and pass + either GimpStrokeOptions or GimpPaintOptions (instead of + GimpStrokeOptions or GimpPaintInfo) to GimpItem::stroke(). + + Also copied code (that needs to be abstracted to a utility + function) from the tool_manager which makes sure we really use the + global brush, pattern etc. if these options are checked in prefs. + Fixes bug #150716. + + * app/core/gimpchannel.c (gimp_channel_stroke) + * app/vectors/gimpvectors.c (gimp_vectors_stroke): removed the + duplicated code mentioned above and simply use the paint_options + passed. + +2004-08-26 DindinX <david@dindinx.org> + + * app/widgets/gimpviewrenderervectors.h: GimpViewRendererVector is + really derived from GimpViewRenderer and not from + GimpViewRendererDrawable. + +2004-08-26 DindinX <david@dindinx.org> + + * app/widgets/gimppreviewrenderer-utils.c + * app/widgets/gimppreviewrenderer-utils.h + * app/widgets/gimppreviewrendererbrush.c + * app/widgets/gimppreviewrendererbrush.h + * app/widgets/gimppreviewrendererdrawable.c + * app/widgets/gimppreviewrendererdrawable.h + * app/widgets/gimppreviewrenderergradient.c + * app/widgets/gimppreviewrenderergradient.h + * app/widgets/gimppreviewrendererimage.c + * app/widgets/gimppreviewrendererimage.h + * app/widgets/gimppreviewrendererimagefile.c + * app/widgets/gimppreviewrendererimagefile.h + * app/widgets/gimppreviewrendererlayer.c + * app/widgets/gimppreviewrendererlayer.h + * app/widgets/gimppreviewrenderervectors.c + * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... + + * app/widgets/gimpviewrenderer-utils.c + * app/widgets/gimpviewrenderer-utils.h + * app/widgets/gimpviewrendererbrush.c + * app/widgets/gimpviewrendererbrush.h + * app/widgets/gimpviewrendererdrawable.c + * app/widgets/gimpviewrendererdrawable.h + * app/widgets/gimpviewrenderergradient.c + * app/widgets/gimpviewrenderergradient.h + * app/widgets/gimpviewrendererimage.c + * app/widgets/gimpviewrendererimage.h + * app/widgets/gimpviewrendererimagefile.c + * app/widgets/gimpviewrendererimagefile.h + * app/widgets/gimpviewrendererlayer.c + * app/widgets/gimpviewrendererlayer.h + * app/widgets/gimpviewrenderervectors.c + * app/widgets/gimpviewrenderervectors.h: ... to these names. And also + changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. + + * app/tools/gimppaintoptions-gui.c + + * app/widgets/Makefile.am + * app/widgets/gimpcomponenteditor.c + * app/widgets/gimpfiledialog.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimpview.c + * app/widgets/widgets-types.h + * app/widgets/gimpviewrenderer.c + * app/widgets/gimpviewrenderer.h: modified accordingly. + +2004-08-26 Sven Neumann <sven@gimp.org> + + * app/sanity.c (sanity_check_filename_encoding): try to convert + the result of gimp_directory() to UTF-8 and bail out with a + moderately helpful error message if this conversion fails. Works + around bug #150917. Also marked these strings for translation. + +2004-08-26 Sven Neumann <sven@gimp.org> + + * app/tools/gimp-tools.c (gimp_tools_register): set the paintbrush + as the default tool as suggested in bug #151091. + +2004-08-26 DindinX <david@dindinx.org> + + * app/widgets/gimppreview-popup.c + * app/widgets/gimppreview-popup.h + * app/widgets/gimppreviewrenderer.c + * app/widgets/gimppreviewrenderer.h: really removed these files from + cvs. + +2004-08-25 Manish Singh <yosh@gimp.org> + + * plug-ins/common/gifload.c: Guard against bogus logical screen + dimensions. Fixes bug #151053. + +2004-08-26 DindinX <david@dindinx.org> + + * app/widgets/gimppreview-popup.c + * app/widgets/gimppreview-popup.h: renamed these files... + + * app/widgets/gimpview-popup.c + * app/widgets/gimpview-popup.h: .. to these files, and changed the + GimpPreviewPopup type to GimpViewPopup. + + * app/widgets/gimppreviewrenderer.c + * app/widgets/gimppreviewrenderer.h: renamed these files... + + * app/widgets/gimpviewrenderer.c + * app/widgets/gimpviewrenderer.h: .. to these files, and changed + GimpPreviewRenderer to GimpViewRenderer. + + This is the second step of the great Preview->View renaming process. + + * app/display/gimpdisplayshell-layer-select.c + * app/display/gimpnavigationeditor.c + + * app/widgets/Makefile.am + * app/widgets/gimpbrushfactoryview.c + * app/widgets/gimpbufferview.c + * app/widgets/gimpcellrendererviewable.c + * app/widgets/gimpcellrendererviewable.h + * app/widgets/gimpcomponenteditor.c + * app/widgets/gimpcontainerbox.c + * app/widgets/gimpcontainercombobox.c + * app/widgets/gimpcontainereditor.c + * app/widgets/gimpcontainerentry.c + * app/widgets/gimpcontainergridview.c + * app/widgets/gimpcontainerpopup.c + * app/widgets/gimpcontainertreeview-dnd.c + * app/widgets/gimpcontainertreeview.c + * app/widgets/gimpcontainerview.c + * app/widgets/gimpdatafactoryview.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimpnavigationpreview.c + * app/widgets/gimppatternfactoryview.c + * app/widgets/gimppreviewrenderer-utils.c + * app/widgets/gimppreviewrendererbrush.c + * app/widgets/gimppreviewrendererbrush.h + * app/widgets/gimppreviewrendererdrawable.c + * app/widgets/gimppreviewrendererdrawable.h + * app/widgets/gimppreviewrenderergradient.c + * app/widgets/gimppreviewrenderergradient.h + * app/widgets/gimppreviewrendererimage.c + * app/widgets/gimppreviewrendererimage.h + * app/widgets/gimppreviewrendererimagefile.c + * app/widgets/gimppreviewrendererimagefile.h + * app/widgets/gimppreviewrendererlayer.c + * app/widgets/gimppreviewrenderervectors.c + * app/widgets/gimpselectioneditor.c + * app/widgets/gimptemplateview.c + * app/widgets/gimptooloptionseditor.c + * app/widgets/gimptoolview.c + * app/widgets/gimpview.c + * app/widgets/gimpview.h + * app/widgets/gimpviewablebutton.c + * app/widgets/widgets-enums.h + * app/widgets/widgets-types.h: Modified accordingly. + +2004-08-25 Sven Neumann <sven@gimp.org> + + * app/widgets/gimperrordialog.[ch] (gimp_error_dialog_add): stop + adding message boxes and redirect messages to stderr if there are + too many messages. + +2004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * devel-docs/ggr.txt: fix incorrect statement, add note re SVG. + +2004-08-25 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpmessagebox.[ch]: added gimp_message_box_repeat(). + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimperrordialog.[ch]: added new dialog that adds a new + GimpMessageBox for each message added. Fixes bug #92604. + + * app/widgets/gimpwidgets-utils.[ch]: removed old gimp_message_box() + functionality. + + * app/gui/gui.c (gui_abort): use a GimpMessageBox in a GimpDialog. + + * app/gui/dialogs-constructors.[ch] + * app/gui/dialogs.c: manage GimpErrorDialog as singleton. + + * app/gui/gui-vtable.c (gui_message): use the new error dialog. + + * app/core/gimp-gui.c (gimp_message): substitue "GIMP" for a NULL + domain. + + * app/widgets/gimperrorconsole.c (gimp_error_console_add): fail + when being called with a NULL domain. + +2004-08-25 DindinX <david@dindinx.org> + + * app/display/gimpnavigationeditor.[ch]: eradicate some more previews + in favor of views. + +2004-08-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * devel-docs/Makefile.am + * devel-docs/ggr.txt: added new file decribing the ggr (Gimp + gradient) file format. + +2004-08-25 DindinX <david@dindinx.org> + + * app/display/gimpnavigationview.c + * app/display/gimpnavigationview.h: renamed these files to... + + * app/display/gimpnavigationeditor.c + * app/display/gimpnavigationeditor.h: ... these files, and of course + changed GimpNavigationView to GimpNavigationEditor since it is really + inherited from GimpEditor anyway. + + This will leave the gimp_navigation_view namespace for the renaming + from gimp_navigation_preview. + + * app/display/Makefile.am + * app/display/display-types.h + * app/display/gimpdisplayshell-callbacks.c + * app/gui/dialogs-constructors.c: Changed accordlingly. + +2004-08-25 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-title.c + (gimp_display_shell_format_title): print bad '%' sequences + literally instead of warning (g_warning() is for programming + errors only and must never be triggered by bad or intermediate + user input). Fixes bug #150676 + +2004-08-24 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpmessagebox.c: put the icon to the right for RTL + layouts. + + * app/display/gimpdisplayshell-close.c + * app/gui/quit-dialog.c: use a GimpMessageBox. + +2004-08-24 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpmessagebox.[ch]: added API to change the labels. + Modeled after the proposed new API for GtkMessageDialog. + + * app/widgets/gimpwidgets-utils.c: changed accordingly. + +2004-08-24 DindinX <david@dindinx.org> + + * app/widgets/gimppreview.c + * app/widgets/gimppreview.h: renamed these two files to... + + * app/widgets/gimpview.c + * app/widgets/gimpview.h: ... these files. + + Also renamed GimpPreview to GimpView. + This is the first step of the great Preview->View renaming process. + + * app/actions/palettes-commands.c + + * app/display/gimpdisplayshell-layer-select.c + * app/display/gimpnavigationview.c + + * app/gui/palette-import-dialog.c + + * app/tools/gimppaintoptions-gui.c + + * app/widgets/Makefile.am + * app/widgets/gimpaction.c + * app/widgets/gimpactiongroup.c + * app/widgets/gimpbrusheditor.c + * app/widgets/gimpbufferview.c + * app/widgets/gimpcontainerbox.c + * app/widgets/gimpcontainergridview.c + * app/widgets/gimpcontainergridview.h + * app/widgets/gimpdevicestatus.c + * app/widgets/gimpdnd.c + * app/widgets/gimpdockbook.c + * app/widgets/gimpfiledialog.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimpnavigationpreview.c + * app/widgets/gimpnavigationpreview.h + * app/widgets/gimppaletteeditor.c + * app/widgets/gimppreview-popup.c + * app/widgets/gimppropwidgets.c + * app/widgets/gimpselectioneditor.c + * app/widgets/gimpthumbbox.c + * app/widgets/gimptoolbox-image-area.c + * app/widgets/gimptoolbox-indicator-area.c + * app/widgets/gimptooloptionseditor.c + * app/widgets/gimpviewabledialog.c + * app/widgets/widgets-types.h: changed accordingly. + +2004-08-24 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpmessagebox.[ch]: added new widget GimpMessageBox. + + * app/widgets/gimpwidgets-utils.c: use it for message dialogs. + +2004-08-23 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset + the filename if gtk_file_chooser_set_uri() failed. + + * app/actions/file-commands.c + * app/gui/file-save-dialog.c: trivial cleanups. + + * app/widgets/gimpwidgets-utils.c: removed an unused extern + variable declaration. + +2004-08-23 DindinX <david@dindinx.org> + + * app/tools/tools-utils.c: fixed a typo that broke the build. + +2004-08-22 Sven Neumann <sven@gimp.org> + + * app/tools/Makefile.am + * app/tools/tools-utils.[ch]: added gimp_tool_motion_constrain(), + + * app/paint/gimppaintcore.[ch]: removed gimp_paint_core_constrain(). + + * app/tools/gimppainttool.c: changed accordingly. + + * app/tools/gimpblendtool.[ch]: use gimp_tool_motion_constrain() + instead of duplicating that functionality. + + * app/tools/gimpmeasuretool.c: use gimp_tool_motion_constrain() + instead of implementing completely different constraints. + +2004-08-22 Simon Budig <simon@gimp.org> + + * app/vectors/gimpbezierstroke.c: Implemented the ellipse basic + shape differently to avoid possible rounding issues with + the _arcto () command. + + * app/vectors/gimpvectors-import.c: properly close the rounded + rectangles. + +2004-08-21 Sven Neumann <sven@gimp.org> + + * app/vectors/gimpvectors-import.c (parse_svg_transform): support + optional center coordinates for the "rotate" transformations. + (parse_svg_transform): apply transformations in reverse order. The + SVG spec is rather confusing here. + +2004-08-21 Sven Neumann <sven@gimp.org> + + * app/vectors/gimpbezierstroke.c (gimp_bezier_stroke_arcto): fixed + a bug I introduced with my last commit. + + * app/vectors/gimpvectors-import.c: added support for the basic + SVG shape "rect". Fixed handling of SVG lengths in basic shapes. + +2004-08-21 Sven Neumann <sven@gimp.org> + + * app/vectors/gimpbezierstroke.[ch]: added new function + gimp_bezier_stroke_new_ellipse() that provides a simple API to + create a bezier stroke that represents an ellipse. + + * app/vectors/gimpvectors-import.c: added support for the basic + SVG shapes "circle" and "ellipse". + +2004-08-21 Simon Budig <simon@gimp.org> + + * plug-ins/common/gih.c: Fix some GUI issues. Make the relation + between the dimension parameter and the rank thingies more clear + also changed to a nicer layout. + +2004-08-21 Sven Neumann <sven@gimp.org> + + * app/vectors/gimpvectors-import.c: added support for the basic + SVG shapes "polyline" and "polygon". + +2004-08-21 Sven Neumann <sven@gimp.org> + + * app/vectors/gimpvectors-import.c: added support for importing + the basic SVG shape "line". Other shapes will follow... + +2004-08-21 Sven Neumann <sven@gimp.org> + + * app/actions/layers-actions.[ch] + * app/actions/layers-commands.[ch] + * app/widgets/gimplayertreeview.c: added actions to handle layer + masks as suggested in bug #150446. + + * menus/layers-menu.xml: added menu entries for new actions, + commented out raise/lower menu entries. + +2004-08-20 Sven Neumann <sven@gimp.org> + + * modules/controller_linux_input.c: declare local function as static. + +2004-08-19 Michael Schumacher <schumaml@cvs.gnome.org> + + * plug-ins/common/guillotine.c: modified the coordinate insertion + into the file name to leave the file extension intact, changed the + format of the coordinates. Fixes bug #101901. + +2004-08-18 Manish Singh <yosh@gimp.org> + + * app/widgets/gimpcellrendereraccel.c + * app/widgets/gimphistogrambox.c + * plug-ins/gfig/gfig-dialog.c: Get rid of some unnecessary casts. + +2004-08-18 Sven Neumann <sven@gimp.org> + + * app/gui/color-notebook.c: no need to set a size_request here. + + * libgimpwidgets/gimpcolorselection.c: HIG-ified spacings. + + * libgimpwidgets/gimpcolorscales.c + * modules/colorsel_cmyk.c: don't set a minimum width on the color + scales. Improves behaviour for narrow color dockables. + +2004-08-18 Sven Neumann <sven@gimp.org> + + * modules/colorsel_triangle.c: fixed crashes that occured with + small sizes, some code cleanups and a simple optimization. + +2004-08-18 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphelp-ids.h: define GIMP_HELP_DOCK_SEPARATOR. + + * app/widgets/gimpdock.c + * app/widgets/gimpdockable.c: help-ids are never used directly, + use the defines from app/widgets/gimphelp-ids.h instead. + +2004-08-17 Simon Budig <simon@gimp.org> + + * modules/colorsel_triangle.c: Made the triangle colorselector + resizeable. Removed minimum size request (would probably need some + testing for *very* small sizes though). + +2004-08-17 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/widgets/gimpdock.c + * app/widgets/gimpdockable.c: add help-ids. + +2004-08-17 Sven Neumann <sven@gimp.org> + + * app/plug-in/plug-in-progress.c (plug_in_progress_start): reset + the "cancel" signal handler id when a new progress is set. + +2004-08-17 Sven Neumann <sven@gimp.org> + + * modules/colorsel_cmyk.c: minor cleanups. + + * modules/colorsel_water.c: let the widget take the available + space, don't set a minimum size. + +2004-08-17 Sven Neumann <sven@gimp.org> + + * app/plug-in/plug-in-progress.c + * app/plug-in/plug-in-run.c + * app/plug-in/plug-in.c: don't keep a strong reference to the + GimpProgress object, instead use a weak reference and deal with + the progress being destroyed while the plug-in is running. + Fixes bug #150194. + +2004-08-16 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcolorframe.c (gimp_color_frame_update): fixed + labels in CMYK mode. Fixes bug #150213. + +2004-08-16 DindinX <david@dindinx.org> + + * plug-ins/common/iwarp.c: fixed a typo preventing the preview to be + redrawn correctly in some case. Reported by AndyFitz. + +2004-08-15 Sven Neumann <sven@gimp.org> + + * modules/colorsel_triangle.c: minor cleanups. + + * modules/colorsel_water.c: GimpPreviewArea seems like overkill + here, use a GtkDrawingArea instead. + +2004-08-15 DindinX <david@dindinx.org> + + * modules/colorsel_triangle.c + * modules/colorsel_water.c: Replaced the GtkPreviews by + GimpPreviewAreas. + +2004-08-14 Manish Singh <yosh@gimp.org> + + * libgimpbase/gimpprotocol.c (_gp_params_read): make sure array + length values are not negative, to prevent bad calls to g_new. + Addresses bug #150154. + +2004-08-14 Sven Neumann <sven@gimp.org> + + * plug-ins/help/Makefile.am: no need to link gimp-help-lookup with + any GIMP libraries. + + * plug-ins/help/domain.[ch]: allow to specify the location of the + index files independently from the base URL. + + * plug-ins/help/help.c: changed accordingly. + + * plug-ins/help/gimp-help-lookup.c: added command-line options to + specify base URI and root directory for index files. + +2004-08-14 Sven Neumann <sven@gimp.org> + + * plug-ins/help/locales.c (locales_parse): don't mess up the order + of languages. + + * plug-ins/help/gimp-help-lookup.c: parse command-line options, + added --help output. + +2004-08-14 Sven Neumann <sven@gimp.org> + + * plug-ins/help/help.[ch]: moved some defines to the header file. + + * plug-ins/help/domain.c: trivial change to remove the libgimpbase + dependency. + + * plug-ins/help/Makefile.am + * plug-ins/help/gimp-help-lookup.c: added a very simple + command-line tool that allows to lookup a help-id. + +2004-08-13 DindinX <david@dindinx.org> + + * plug-ins/common/edge.c: update the preview when the user choose a + different algorithm from the combo box. This was one of the main + reasons to have a preview here, after all. + +2004-08-13 Sven Neumann <sven@gimp.org> + + * plug-ins/common/edge.c (edge_dialog): use a combo box instead of + too many radio buttons. + +2004-08-12 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpmenufactory.c (gimp_menu_factory_manager_new): + make sure that all actions, even if they have no menu proxy, can + be invoked by their accelerators. Fixes bug #149938. + + * app/widgets/gimpimagedock.c (gimp_image_dock_constructor): + removed the same code here. + + * app/widgets/gimpactionview.[ch] (gimp_action_view_dispose): new + function which disconnects from "accel_changed" of the accel_group + before upchaining (== before emitting "destroy"). + + The above changes make this one redundant, but since the crash in + bug #149938 was triggered by "accel_changed" emitted in the middle + of g_object_unref(tree_model), it feels better to be paranoic here + (fiddling with objects in destruction is no fun). + + (gimp_action_view_accel_edited): don't warn if assigning the same + accel to the same action again. + + (gimp_action_view_new): don't leak all accel_closures. + +2004-08-12 DindinX <david@dindinx.org> + + * plug-ins/common/edge.c: added a preview. + +2004-08-12 Sven Neumann <sven@gimp.org> + + * plug-ins/common/sel_gauss.c + * plug-ins/common/unsharp.c: place the preview widget into the + upper left corner like all other plug-ins do. + + * plug-ins/help/domain.c: added some (disabled) debug output. + +2004-08-12 DindinX <david@dindinx.org> + + * plug-ins/common/sel_gauss.c: added a preview. + + * plug-ins/common/unsharp.c: removed unused variables. + +2004-08-12 Sven Neumann <sven@gimp.org> + + * app/actions/context-actions.c: changed the icons to indicate + what part of the context is affected by the action. Looks better + in the shortcut editor. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/cartoon.c + * plug-ins/common/neon.c + * plug-ins/common/photocopy.c + * plug-ins/common/softglow.c: added four new plug-ins contributed + by Spencer Kimball. Ported them from 1.2 to 2.1 APIs. + + * plug-ins/common/plugin-defs.pl: added them here. + + * plug-ins/common/mkgen.pl: removed tab insanity now that + libgimpoldpreview is gone. + + * plug-ins/common/.cvsignore + * plug-ins/common/Makefile.am: regenerated. + +2004-08-11 DindinX <david@dindinx.org> + + Bad DindinX! Don't break the build! + + * configure.in + * plug-ins/common/mkgen.pl + * plug-ins/common/plugin-defs.pl: removed libgimpoldpreview from + here too. + + * plug-ins/common/Makefile.am: regenerated. + +2004-08-11 DindinX <david@dindinx.org> + + Removed the GimpOldPreview stuff. Die, crap, die! + + * plug-ins/libgimpoldpreview/*: removed. + + * plug-ins/Makefile.am + * plug-ins/common/Makefile.am: changed accordingly. + + * plug-ins/common/max_rgb.c + * plug-ins/common/noisify.c + * plug-ins/common/tileit.c: removed last forgotten + #include "libgimpoldpreview.h". + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainercombobox.[ch] + * app/widgets/gimpcontainertreeview.c: when removing the last item + from the view, manually clear all GimpCellRendererViewables' + "renderer" properties; otherwise we have stale GimpPreviewRenderers + with still-refed viewables hanging around in the cells. + Works around GTK+ bug #149906. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * app/core/gimp.c + * app/core/gimpimagefile.c: converted tabs to spaces, cosmetic + changes. + +2004-08-11 DindinX <david@dindinx.org> + + * plug-ins/common/waves.c: GimpPreviewArea-ified. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + Restored sane sorting order for menus which are created + entirely by plug-ins (like Xtns/Script-Fu/...). + + * app/menus/plug-in-menus.c (plug_in_menus_build_path): made it + return the built path. For each sub-menu created, add a "Menus" + placeholder and a separator. Make sure all sub-menus end up in the + "Menus" placeholder. More readable because we can use the path + returned by the recursive invocation now. + + (plug_in_menus_add_proc): simplified by using the path + plug_in_menus_build_path() returns. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * app/core/gimpprogress.[ch]: added virtual function + gboolean GimpProgressInterface::is_active(). + + * app/display/gimpdisplay.c + * app/display/gimpstatusbar.c + * app/widgets/gimpfiledialog.c + * app/widgets/gimpprogressbox.c + * app/widgets/gimpprogressdialog.c + * app/widgets/gimpthumbbox.c: implement it. + + * app/plug-in/plug-in.h: removed "gboolean progress_active" and + added "gulong progress_cancel_id" instead. + + * app/plug-in/plug-in-progress.c: changed accordingly. Make sure + we correctly handle the "cancel" connections of progress instances + passed from other plug-ins. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-message.c + * app/plug-in/plug-in-run.c (plug_in_temp_run) + * libgimp/gimp.c (gimp_temp_proc_run): removed ENABLE_TEMP_RETURN + #define and all code which was in #ifndef ENABLE_TEMP_RETURN. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * app/core/gimp-gui.[ch]: added "display_ID" to gimp_new_progress(). + + * app/gui/gui-vtable.c: changed accordingly. + + * app/plug-in/plug-in-progress.[ch]: reenabled showing the + progress in a particular display. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * etc/controllerrc: added a commented-out midi controller entry + with some example mappings. + +2004-08-11 DindinX <david@dindinx.org> + + * plug-ins/common/plasma.c: converted to GimpPreviewArea. + +2004-08-11 DindinX <david@dindinx.org> + + * plug-ins/common/noisify.c: converted to GimpPreviewArea. Also added + scrollbars to move around. The preview was rather useless without + them. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable-blend.c + * app/core/gimpprogress.c: some progress cleanup. + + * app/display/gimpstatusbar.c (gimp_statusbar_progress_start): no + need to warn if there is already a progress active, just silently + return NULL as all other GimpProgressInterface implementors. + + * app/plug-in/plug-in-progress.c: several progress fixes. + It's still a mess. + + * plug-ins/common/url.c: don't show progress depending on + run_mode. Run the actual file plug-in with the same run_mode we + were invoked with. + +2004-08-11 Sven Neumann <sven@gimp.org> + + * app/gui/file-open-location-dialog.c + * app/widgets/gimpprogressbox.c: increased horizontal size request + to reduce resizing. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpthumbbox.c (gimp_thumb_box_create_thumbnails): + fixed annoying resizing when thumbnailing exactly one image. + +2004-08-11 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpprogressbox.[ch]: new GtkVBox subclass featuring + a label and a progressbar. Implements GimpProgressIterface. + + * app/widgets/gimpprogressdialog.[ch]: replaced label and progress + by a GimpProgressBox. Delegate most progress functionality to it. + + * app/widgets/gimpwidgets-utils.[ch]: factored out utility + function gimp_dialog_set_sensitive(). + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_sensitive): + use it. + + * app/gui/file-open-location-dialog.c (file_open_location_response): + embed the called file procedure's progress using a GimpProgressBox. + +2004-08-10 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpfiledialog.[ch] + (gimp_file_dialog_set_sensitive): new function which works on all + widgets in the dialog except the cancel button. + + Remember if the active progress is cancelable and added two + booleans "busy" and "canceled". Added GtkDialog::response() + implementation which, if the dialog is busy, cancels the active + progress and sets the dialog's "canceled" state. + + Moved the progress bar right above the action area so it is next + to the cancel button and in the same place for both open and save + dialogs. + + * app/gui/file-open-dialog.c + * app/gui/file-save-dialog.c: use the new API to make image loading + and saving cancelable again. + + * app/widgets/gimpthumbbox.c: use the same stuff to make + thumbnailing cancelable. Increased the minimum height a bit so it + doesn't resize when the progress bars are shown. + +2004-08-10 Michael Natterer <mitch@gimp.org> + + Redid the whole internal progress stuff: don't pass around + progress_callback and progress_data; instead, provide a + pointer to a GimpProgressInterface which can be implemented + by a variety of backends. + + Addresses (but not yet fixes) bugs #6010, #97266 and #135185. + + * app/display/Makefile.am + * app/display/gimpprogress.[ch]: removed the old progress hack. + + * app/core/Makefile.am + * app/core/core-types.h + * app/core/gimpprogress.[ch]: implement GimpProgressInterface. + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpprogressdialog.[ch]: the standalone progress + dialog as widget implementing GimpProgressInterface. + + * app/display/gimpdisplay.c + * app/display/gimpstatusbar.[ch] + * app/widgets/gimpfiledialog.[ch] + * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface + implementation to these classes. + + * app/core/gimp-gui.[ch] + * app/gui/gui-vtable.c: replaced the old progress vtable entries + by two new to create and destroy a GimpProgressDialog in case + no other progress is available. + + * app/pdb/procedural_db.[ch] + * app/plug-in/plug-in-run.[ch] + * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and + all plug-ins. + + * app/plug-in/plug-in.[ch] + * app/plug-in/plug-ins.c + * app/plug-in/plug-in-message.c + * app/plug-in/plug-in-progress.c: handle the case there the + plug-in was crated with a progress as well as the case where it + wasn't. + + * app/app_procs.c + * app/batch.c + * app/xcf/xcf.c + * app/file/file-open.[ch] + * app/file/file-save.[ch] + * app/widgets/gimphelp.c + * app/widgets/gimpbrushselect.c + * app/widgets/gimpfontselect.c + * app/widgets/gimpgradientselect.c + * app/widgets/gimppaletteselect.c + * app/widgets/gimppatternselect.c: changed accordingly. + + * app/core/gimpimagefile.[ch] + * app/display/gimpdisplayshell-dnd.c + * app/gui/file-open-dialog.c + * app/gui/file-open-location-dialog.c + * app/gui/file-save-dialog.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file + related functions. Embed the progress in the file dialog where + possible. + + * app/core/gimpdrawable-blend.[ch] + * app/core/gimpdrawable-transform.[ch] + * app/core/gimpimage-convert.[ch] + * app/core/gimpimage-flip.[ch] + * app/core/gimpimage-resize.[ch] + * app/core/gimpimage-rotate.[ch] + * app/core/gimpimage-scale.[ch] + * app/core/gimpitem-linked.[ch] + * app/core/gimpitem.[ch] + * app/core/gimpchannel.c + * app/core/gimpdrawable.c + * app/core/gimplayer.c + * app/core/gimpselection.c + * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. + + * app/tools/gimpblendtool.c + * app/tools/gimptransformtool.c + * app/gui/convert-dialog.c + * app/actions/documents-commands.c + * app/actions/file-commands.c + * app/actions/image-commands.c + * app/actions/layers-commands.c + * app/actions/plug-in-commands.c + * app/actions/vectors-commands.c + * tools/pdbgen/pdb/convert.pdb + * tools/pdbgen/pdb/edit.pdb + * tools/pdbgen/pdb/image.pdb + * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. + + * app/pdb/*_cmds.c: regenerated. + +2004-08-10 DindinX <david@dindinx.org> + + * plug-ins/common/blinds.c: GimpPreviewArea-ified. + +2004-08-10 DindinX <david@dindinx.org> + + * plug-ins/common/AlienMap2.c: Ported to GimpPreviewArea, use an enum + for the color model instead of some defines and use gboolean instead + of gint where appropriate. + +2004-08-10 Sven Neumann <sven@gimp.org> + + * app/core/gimpbrushgenerated.c (gimp_brush_generated_load): + plugged more file descriptor leaks. + +2004-08-10 DindinX <david@dindinx.org> + + * app/core/gimpbrushgenerated.c: don't leak a file descriptor when + reading a bad .vbr file. + +2004-08-10 Sven Neumann <sven@gimp.org> + + * plug-ins/common/unsharp.c: don't show progress on the image + window while updating the preview. + +2004-08-09 Sven Neumann <sven@gimp.org> + + * plug-ins/common/unsharp.c (unsharp_region): reset the progress + when done; some code cleanup. + +2004-08-09 DindinX <david@dindinx.org> + + * plug-ins/common/unsharp.c: continuously show the (original) image + during a scrollbar movement. This makes it easier to navigate. + +2004-08-09 Michael Natterer <mitch@gimp.org> + + Applied (slightly modified) patch from Shlomi Fish which adds a + progress bar to the RGB -> INDEXED conversion. Fixes bug #145274 + and shows that we really really need a GimpProgressInterface in + the core to give progress users full access to the progress API. + + * app/core/gimpimage-convert.[ch]: added special + GimpImageConvertProgress function typedef to cope with the + different stages of converting. Support passing such a callback & + data to gimp_image_convert() and update the progress accordingly. + + * app/gui/convert-dialog.[ch]: added a convert progress callback + and pass it to gimp_image_convert(). + + * app/actions/image-commands.c + * tools/pdbgen/pdb/convert.pdb: changed accordingly. + + * app/pdb/convert_cmds.c: regenerated. + +2004-08-09 Sven Neumann <sven@gimp.org> + + * data/misc/gimp.desktop.in.in: added GenericName and Version, + updated Categories. + +2004-08-09 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-ins.c + (plug_ins_file_register_magic) + (plug_ins_file_register_mime): don't dereference + gimp->current_plug_in->plug_in_def if it's NULL. + Fixes bug #149678. + + (plug_ins_file_register_mime): moved returning the proc_def inside + the right if() statement. + +2004-08-09 Hans Breuer <hans@breuer.org> + + * app/core/gimp-edit.c (gimp_edit_paste_as_new): + gimp_create_display() with the right parameters order + + * app/widgets/gimpwidgets-utils.c (gimp_message_box_set_icons) + handle gtk_style_lookup_icon_set() returnig NULL + + * app/gimpcore.def app/widgets/makefile.msc + themes/default/images/makefile.msc : updated + +2004-08-09 Sven Neumann <sven@gimp.org> + + * plug-ins/common/postscript.c (save_ps_header): use the basename + as Title, not the full filename. Fixes bug #149669. + +2004-08-08 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/siod/sliba.c (array_prin1): when printing a + character array, don't flush the buffer for each byte but wait + until it is filled. + +2004-08-08 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/siod-wrapper.[ch] (siod_output_string): use + g_strdup_vprintf() instead of guessing the string length. Also + declare the function using G_GNUC_PRINTF(). + +2004-08-08 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/ifscompose/README.ifscompose: fix out of date info, + pointed out by the author. + +2004-08-08 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/Makefile.am: do not build test-preview-area by + default, put it into EXTRA_PROGRAMS. Fixes parallel builds. + +2004-08-08 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_sensitive): + new function which checks a GimpImageType against the + proc_def->image_types_val mask. + + * app/actions/plug-in-actions.c: use the new function here. Also + separated setting the "Repeat last" and "Reshow last" actions' + labels from setting their sensitivity and made them use the same + sensitivity logic as all other plug-in actions. Fixes bug #149567. + +2004-08-07 Simon Budig <simon@gimp.org> + + * libgimpwidgets/gimpcolorscales.c: emit the COLOR_CHANGED signal + when the hex entry is changed. + +2004-08-07 Sven Neumann <sven@gimp.org> + + * app/sanity.c: abort if the configured filename encoding can't be + converted to UTF-8. Fixes bug #149464 for the HEAD branch. + +2004-08-07 Sven Neumann <sven@gimp.org> + + * libgimp/gimpgradientmenu.c (gimp_gradient_select_preview_expose): + corrected dither offset. + +2004-08-07 DindinX <david@dindinx.org> + + * plug-ins/common/max_rgb.c: use a GimpPreviewArea instead of + GimpOldPreview. + +2004-08-07 Sven Neumann <sven@gimp.org> + + * libgimp/gimpgradientmenu.c: use a GtkDrawingArea instead of + GtkPreview. + + * libgimp/gimpbrushmenu.c + * libgimp/gimppatternmenu.c: minor cleanup. + +2004-08-07 DindinX <david@dindinx.org> + + * plug-ins/common/jigsaw.c: ported to GimpPreviewArea, did some + cleanup and removed tabs. + +2004-08-07 Sven Neumann <sven@gimp.org> + + * configure.in: bumped version number to 2.1.4. + +2004-08-07 DindinX <david@dindinx.org> + + * plug-ins/common/illusion.c: ported to GimpPreviewArea. + +2004-08-07 DindinX <david@dindinx.org> + + * libgimpwidgets/gimppreviewarea.c: fixed the rendering for INDEXED + and INDEXEDA image types. + + * plug-ins/common/grid.c: ported to GimpPreviewArea. + +2004-08-06 DindinX <david@dindinx.org> + + * plug-ins/common/glasstile.c: ported to GimpPreviewArea. + +2004-08-06 DindinX <david@dindinx.org> + + * plug-ins/common/nlfilt.c: ported to GimpPreviewArea. + +2004-08-06 Michael Natterer <mitch@gimp.org> + + * app/tools/gimptransformtool.h: removed the recently added + "gdouble aspect_ratio"... + + * app/tools/gimpscaletool.[ch]: ...and added it where it belongs. + +2004-08-06 Michael Natterer <mitch@gimp.org> + + Transform tool cleanup: + + * app/tools/gimptransformtool.[ch]: added new virtual function + GimpTransformTool::dialog_update(). + Made wrapper for ::recalc() public and function + transform_bounding_box() private. + Call ::dialog_update() and transform_bounding_box() from the + ::recalc() wrapper. + + * app/tools/gimpperspectivetool.[ch] + * app/tools/gimprotatetool.[ch] + * app/tools/gimpscaletool.[ch] + * app/tools/gimpsheartool.[ch]: turned all info_dialog update + functions into GimpTransformTool::dialog_update() implementations + and don't call them from ::recalc(), also removed calls to + transform_bounding_box(); both functions are called by the parent + class now. Call gimp_transform_tool_recalc() when dialog values + were changed, not the tool's internal function. + Moved all static variables to the instance structs. + +2004-08-06 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpsheartool.[ch]: applied (modified) patch from Ari + Pollak which enables controlling the shear direction from the + dialog and changing the shear direction without hitting "Reset". + Fixes bug #149467. + + Also moved all static variables to the GimpShearTool struct and + converted tabs to spaces. + +2004-08-06 DindinX <david@dindinx.org> + + * plug-ins/common/nova.c: ported to GimpPreviewArea. + +2004-08-06 Sven Neumann <sven@gimp.org> + + * Made 2.1.3 release. + +2004-08-06 DindinX <david@dindinx.org> + + * plug-ins/common/polar.c: ported to GimpPreviewArea (from + GimpOldPreview). + +2004-08-06 Sven Neumann <sven@gimp.org> + + * libgimpcolor/test-color-parser.c: include <glib-object.h>. + +2004-08-06 Sven Neumann <sven@gimp.org> + + * plug-ins/common/depthmerge.c: + * plug-ins/common/despeckle.c: removed unused variables. + +2004-08-06 DindinX <david@dindinx.org> + + * plug-ins/common/flarefx.c: ported to GimpPreviewArea (from + GimpOldPreview) + +2004-08-06 Sven Neumann <sven@gimp.org> + + * plug-ins/twain/Makefile.am (EXTRA_DIST): forgot to remove + tw_sess.c here. + +2004-08-05 DindinX <david@dindinx.org> + + * plug-ins/common/wind.c: ported to GimpPreviewArea (from + GimpOldPreview) + +2004-08-05 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpiscissorstool.c: increased the handle size from 8 + to 9 pixels (which is the same as in the path tool) as suggested + in bug #134250. + +2004-08-05 Michael Natterer <mitch@gimp.org> + + * app/display/gimpstatusbar.c: make the cursor coordinates label + insensitive when displaying out-of-image coordinates. + +2004-08-05 Michael Natterer <mitch@gimp.org> + + * app/config/gimprc-blurbs.h (INSTALL_COLORMAP_BLURB): + s/pseudocolor visuals/8-bit (256 colors) displays/. + Fixes bug #137078. + +2004-08-05 Michael Natterer <mitch@gimp.org> + + Enabled previewing items without selecting them in all list and + grid views using mouse button 2. Implicitly enables previewing of + items in container popups and thus fixes bug #121011: + + * app/widgets/gimppreview.c (gimp_preview_button_press_event) + * app/widgets/gimpcellrendererviewable.c + (gimp_cell_renderer_viewable_clicked): show the preview also on + mouse button 2 click. + + * app/widgets/gimpcontainertreeview.c + (gimp_container_tree_view_button_press): dispatch mouse button 2 + clicks to GimpCellRendererViewable, but don't select or change + anything in the tree_view. + + Unrelated cleanup: + + * app/widgets/gimppreview.c (gimp_preview_button_press_event): + don't offset bevent->x,y by widget->allocation.x,y before calling + gimp_preview_popup_show() ... + + * app/widgets/gimppreview-popup.c (gimp_preview_popup_show): + ... instead, do it here generically (check if the parent widget is + GTK_WIDGET_NO_WINDOW()). + +2004-08-05 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpintstore.c (gimp_int_store_add_empty): + allocate the empty_iter using g_new0(). Fixes valgrind warnings + about reads from uninitialized memory. + +2004-08-05 Michael Natterer <mitch@gimp.org> + + * app/actions/context-actions.c: use GTK_STOCK_JUMP_TO for + all "Set" actions (like context-foreground-red-set). + +2004-08-05 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpscaletool.c + * app/tools/gimptransformtool.h: applied patch from Jordi Gay + (attached to bug #131111) which adds an aspect ratio spinbutton to + the scale dialog and keeps the aspect ratio intact when width or + height are changed using the dialog. Fixes bug #132274. + + * app/tools/gimpcroptool.c + * app/tools/gimpscaletool.c: don't set the aspect spinbuttons to + "wrap" and decrease their climb_rate. + +2004-08-05 Michael Natterer <mitch@gimp.org> + + * app/actions/context-actions.c + * app/actions/context-commands.[ch] + * menus/image-menu.xml.in: added actions, callbacks and menu items + for the brush shape and spikes. + +2004-08-04 Simon Budig <simon@gimp.org> + + * plug-ins/common/grid.c: changed the default colors for the + first invocation to the current foregroud color which is more + likely to be useful than the blue shades. + +2004-08-04 Sven Neumann <sven@gimp.org> + + * themes/Default/images/Makefile.am + * themes/Default/images/stock-brush-generated-*-16.png: removed ... + + * themes/Default/images/stock-shape-*-16.png: ... and added back + with more generic names. + + * libgimpwidgets/gimpstock.[ch] + * app/widgets/gimpbrusheditor.c: changed accordingly. + + * app/tools/gimpinkoptions-gui.c: use the new stock icons here as + well. + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpblobeditor.[ch]: added a simple blob shape + editor widget factored out of app/tools/gimpinkoptions-gui.c. + +2004-08-04 Simon Budig <simon@gimp.org> + + * app/core/gimpbrushgenerated.c: Enhanced the range of the hardness + parameter to make more soft brushes possible. Please note that this + makes existing generated brushes look more soft. But since people + apparently rarely use more than one or two generated brushes and + these get changed frequently I guess it should be OK. + +2004-08-04 Michael Natterer <mitch@gimp.org> + + Allow URI drops from apps linked against GLib < 2.4.4 to GIMP + linked against GLib >= 2.4.5. Fixes bug #148140. + + * app/core/gimp-utils.[ch]: added gimp_check_glib_version(). + + * app/widgets/gimpselectiondata.c: added runtime check for GLib + versions that encode file:// URIs correctly (>= 2.4.5). For older + (broken) GLibs, leave the code path as is, for newer (fixed) ones, + perform an additional check if the dropped URI is in the (broken) + escaped-UTF-8 format and convert it to local filename encoding. + + * app/gui/gui.c: warn the user that non-ASCII filenames can't + be used when linked against GLib 2.4.4. + +2004-08-04 Michael Natterer <mitch@gimp.org> + + * app/core/gimp.[ch]: changed member "ProcRecord *last_plug_in" + to "PlugInProcDef *last_plug_in". Added function + gimp_set_last_plug_in() and signal Gimp::last-plug-in-changed. + + * app/actions/plug-in-commands.c + * app/plug-in/plug-in-run.c: changed accordingly. + + * app/actions/plug-in-actions.c: factored out updating of the + "Reshow Last" and "Rerun Last" actions to a private function. + Connect each "plug-in" action group to Gimp::last-plug-in-changed + and update the actions' label and sensitivity in the + callback. Fixes bug #149139. + +2004-08-04 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimplayertreeview.c: #include "core/gimpimage-undo.h" + +2004-08-04 Manish Singh <yosh@gimp.org> + + * configure.in: Really really really really fix WINDRES logic. + +2004-08-03 DindinX <david@dindinx.org> + + * plug-ins/winicon/icodialog.c: ported to GimpPreviewArea. Still needs + work. + +2004-08-03 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainergridview.c + (gimp_container_grid_view_item_context): ref/unref the view around + the calls to gimp_container_view_item_selected() and _item_context() + because the former may destroy the view which leads to a crash + when trying the latter. Fixes bug #148955. + +2004-08-03 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage-undo.[ch] (gimp_image_undo_can_compress): + new function which checks if undo compression is possible: + + (1) is the image dirty? Fixes bug #148853. + (2) is redo stack empty? + (3) do both the passed undo object_type and undo_type + match the top undo item? + + Consistently name the GType and GimpUndoType passed to undo + functions "object_type" and "undo_type" to avoid confusion. + + * app/actions/layers-commands.c + * app/tools/gimpeditselectiontool.c + * app/tools/gimptexttool.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimplayertreeview.c: use the new utility function + instead of checking the above conditions manually. + +2004-08-03 Michael Natterer <mitch@gimp.org> + + * app/core/gimpbrushgenerated.c (gimp_brush_generated_load): don't + leak the brush's name if parsing the shape fails. + + (gimp_brush_generated_dirty): shut up bogus compiler warnings + about uninitialized variables. + +2004-08-03 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/imagemap/imap_preview.c + * plug-ins/imagemap/imap_preview.h: ported to GimpPreviewArea. + +2004-08-03 DindinX <david@dindinx.org> + + * plug-ins/ifscompose/ifscompose.c: ported to GimpPreviewArea. + +2004-08-03 DindinX <david@dindinx.org> + + * plug-ins/fp/fp.c: converted to GimpPreviewArea. + +2004-08-03 DindinX <david@dindinx.org> + + * plug-ins/rcm/rcm_callback.c + * plug-ins/rcm/rcm_dialog.c + * plug-ins/rcm/rcm_misc.c: Ported to GimpPreviewArea. + +2004-08-02 Simon Budig <simon@gimp.org> + + * app/widgets/gimpbrusheditor.c: Fixed brush spacing for brushes + with >= 2 spikes. Spotted by Joao S. O. Bueno. + + Fixes bug #149099. + +2004-08-02 DindinX <david@dindinx.org> + + * plug-ins/common/whirlpinch.c: ported to GimpPreviewArea. + +2004-08-02 DindinX <david@dindinx.org> + + * plug-ins/common/video.c: ported to GimpPreviewArea. + +2004-08-02 DindinX <david@dindinx.org> + + * plug-ins/common/unsharp.c: ported to GimpPreviewArea. Centered the + preview, too. + +2004-08-01 DindinX <david@dindinx.org> + + * plug-ins/common/tileit.c: ported to GimpPreviewArea. + +2004-08-01 DindinX <david@dindinx.org> + + * plug-ins/common/sinus.c: ported to GimpPreviewArea. + +2004-08-01 Manish Singh <yosh@gimp.org> + + * configure.in: Really really really fix WINDRES logic. + +2004-08-01 Manish Singh <yosh@gimp.org> + + * plug-ins/common/mkgen.pl: update install-% rule to match newer + libtool commands. + + * plug-ins/common/Makefile.am: regenerated. + +2004-08-01 Manish Singh <yosh@gimp.org> + + * configure.in: Really really fix WINDRES logic. + +2004-08-01 Manish Singh <yosh@gimp.org> + + * configure.in: Really fix WINDRES logic. + +2004-08-01 DindinX <david@dindinx.org> + + * plug-ins/common/scatter_hsv.c: ported to GimpPreviewArea. + +2004-08-01 Hans Breuer <hans@breuer.org> + + * app/display/makefile.msc app/widgets/makefile.msc : build + but *dont link* display-enums.obj, widget-enums.obj and + gimpdisplayoptions.obj. They must be in the dll + * app/makefile.msc : build gimp.exe and gimp-console.exe both + using the same gimp-core.dll + * app/gimpcore.def : new file, exports for gimp-core.dll + * app/Makefile.am : added to EXTRA_DIST + + * cursors/makefile.msc : new file to create gimp-tool-cursors.h + * cursors/Makefile.am : added to EXTRA_DIST + + * **/makefile.msc : updated + + * app/main.c app/app_procs.c : moved code to close the console + from the former to the later. It only is to be used if The Gimp + is not build as console app. + + * plug-ins/gfig/gfig.c : dont gimp_drawable_detach() the same + drawable twice + * plug-ins/gfig-dialog.c() : added a g_return_if_fail() to avoid + crashing on File/Import + +2004-08-01 Simon Budig <simon@gimp.org> + + * app/widgets/gimpbrusheditor.c: Fixed oversight that accidentially + reset the number of spikes to 2. + +2004-08-01 Simon Budig <simon@gimp.org> + + * app/core/gimpbrushgenerated.[ch]: Added optional spikes for + the generated brushes, enabling star shaped generated brushes. + + * app/widgets/gimpbrusheditor.[ch]: GUI for this. + + * app/core/gimpbrush.c: changed accordingly. + +2004-08-01 DindinX <david@dindinx.org> + + * plug-ins/common/mapcolor.c + * plug-ins/common/sample_colorize.c: ported to GimpPreviewArea. + + * plug-ins/common/newsprint.c: ported to GimpPreviewArea, even though + it should use some pngs instead. + +2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> + + * configure.in: modified the checks. hopefully it works on all + platforms this time. + +2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> + + * configure.in: move an AM_CONDITIONAL out of an if block + +2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> + + * configure.in: added checks for windres. Fixes bug #148443 + together with my last commit. + +2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> + + * app/Makefile.am: added checks and rules to build and link the + win32 icon resource if the resource compiler windres is found by + configure. First part of a fix for bug #148443. + +2004-08-01 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimpwidgets/gimpwidgets.def: added gimp_preview_area_fill + +2004-08-01 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/flame/flame.c: ported to GimpPreviewArea. + +2004-08-01 Simon Budig <simon@gimp.org> + + * app/core/core-enums.h + * app/core/gimpbrushgenerated.[ch]: Implement three different + brush shapes for generated brushes. + + * app/core/gimpbrush.c: changed accordingly. + * app/core/core-enums.c: regenerated. + + * app/widgets/gimpbrusheditor.[ch]: Add toggles for the shape. + * themes/Default/images/stock-brush-generated-*-16.png: New stock + icons for the brush shapes. + + * themes/Default/images/Makefile.am + * libgimpwidgets/gimpstock.[ch]: changed accordingly + + untabified the files touched. + +2004-08-01 DindinX <david@dindinx.org> + + * plug-ins/common/iwarp.c: ported to GimpPreviewArea. + +2004-07-31 DindinX <david@dindinx.org> + + * plug-ins/common/gqbist.c: ported to GimpPreviewArea. + +2004-07-31 DindinX <david@dindinx.org> + + * plug-ins/common/fractaltrace.c: ported to GimpPreviewArea. + +2004-07-31 DindinX <david@dindinx.org> + + * plug-ins/common/exchange.c: ported to GimpPreviewArea. + +2004-07-31 DindinX <david@dindinx.org> + + * plug-ins/common/emboss.c: ported to GimpPreviewArea. + +2004-07-31 DindinX <david@dindinx.org> + + * plug-ins/common/diffraction.c: ported to GimpPreviewArea. + +2004-07-31 DindinX <david@dindinx.org> + + * plug-ins/common/despeckle.c: use even more GimpPreviewArea's + facilities. + + * plug-ins/common/destripe.c: ported to GimpPreviewArea. + +2004-07-31 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gflare/gflare.c: ported to GimpPreviewArea. + +2004-07-31 DindinX <david@dindinx.org> + + * plug-ins/common/despeckle.c: ported to GimpPreviewArea. + +2004-07-31 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/brush.c + * plug-ins/gimpressionist/orientmap.c + * plug-ins/gimpressionist/paper.c + * plug-ins/gimpressionist/preview.c + * plug-ins/gimpressionist/size.c: + Converted the code from using GtkPreview to GimpPreviewArea. + +2004-07-30 Seth Burgess <sjburges@gimp.org> + + * plug-ins/common/gauss.c: added some non-interactive modes (if called + from the pdb with RUN_INTERACTIVE). + +2004-07-31 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpcolorselect.c: minor cleanup. + +2004-07-31 Sven Neumann <sven@gimp.org> + + * libgimp/gimppatternmenu.c: ported to GimpPreviewArea. + + * libgimp/gimpbrushmenu.c: some small changes for consistency. + +2004-07-31 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.[ch]: added new function + gimp_preview_area_fill(). + + * libgimpwidgets/test-preview-area.c: added a test for new function. + + * libgimp/gimpbrushmenu.c: ported to GimpPreviewArea. + +2004-07-31 DindinX <david@dindinx.org> + + * plug-ins/common/depthmerge.c: use a GimpPreviewArea instead of a + GtkPreview. Some code cleanup, too. + +2004-07-31 Sven Neumann <sven@gimp.org> + + * libgimp/gimpmenu.c (gimp_menu_make_preview): use a GtkImage and + a GdkPixbuf instead of the deprecated GtkPreview widget. + +2004-07-30 DindinX <david@dindinx.org> + + * plug-ins/common/curve_bend.c: Use a GimpPreviewArea instead of + GtkPreview. + +2004-07-30 Sven Neumann <sven@gimp.org> + + Applied a bunch of small changes contributed by Tim Mooney to fix + stack corruption on Tru64 and Aix (bug #129867). + + * app/Makefile.am + * plug-ins/script-fu/Makefile.am: changed the dependency order so + that $(REGEXREPL) is linked earlier. + + * regexrepl/regex.[ch]: fixed check for __STDC__, merged upstream + fix for re_max_failures value. + +2004-07-30 Sven Neumann <sven@gimp.org> + + * configure.in: always do the check for perl and use the + substituted perl executable name in the call for gimp-mkenums. + Fixes the build on platforms where perl is not available as + /usr/bin/perl. Closes bug #148813. + + * app/widgets/gimpenumstore.c: added missing include. + +2004-07-30 DindinX <david@dindinx.org> + + * plug-ins/common/channel_mixer.c: GtkPreview->GtkDrawingArea, plus + some minor code cleanups. + +2004-07-30 DindinX <david@dindinx.org> + + * plug-ins/common/CML_explorer.c: Transformed one GtkPreview to a + GimpPreviewArea and the other to a simple GtkDrawingArea, since this + makes the code simpler. + +2004-07-30 Shlomi Fish <shlomif@iglu.org.il> + + * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw): + corrected a typo causing mayhem in previews of non-alpha grayscale + images. Fixes bug #148873. + +2004-07-30 Sven Neumann <sven@gimp.org> + + * plug-ins/common/ccanalyze.c (fillPreview): optimized preview + filling a little bit, removed trailing whitespace. + +2004-07-30 DindinX <david@dindinx.org> + + * plug-ins/common/ccanalyze.c: converted to use a GimpPreviewArea, + and some small cleanups (g_malloc to g_new, removing tabs) + +2004-07-30 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.c (gimp_preview_area_draw): + optimized alpha blending. + +2004-07-30 Sven Neumann <sven@gimp.org> + + Applied a bunch of AIX portability fixes (bug #148813): + + * configure.in: when testing for Xmu library, link with -lXt -lX11. + + * app/gui/tips-parser.c + * app/gui/user-install-dialog.c + * app/tools/tools-enums.h + * app/widgets/gimpdasheditor.c + * app/widgets/widgets-enums.h + * libgimpthumb/gimpthumb-error.h + * libgimpwidgets/gimpcolorbutton.c + * plug-ins/common/edge.c: removed trailing commas from enums. + + * plug-ins/common/snoise.c: renamed defines to avoid collision + with system headers. + + * plug-ins/imagemap/imap_cmd_move.c: no C++ style comments. + + * app/paint-funcs/paint-funcs-generic.h + * app/paint-funcs/paint-funcs.c: use integers for bit fields. + +2004-07-30 Sven Neumann <sven@gimp.org> + + * plug-ins/common/bumpmap.c: removed preview code that isn't used + any longer. + +2004-07-30 DindinX <david@dindinx.org> + + * plug-ins/common/bumpmap.c: use GimpPreviewArea instead of + GtkPreview (which leads to much simpler code) + +2004-07-29 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppreviewarea.c: only invalidate the buffer + on size_allocate; allocate a new one on the next call to + gimp_preview_area_draw(). Fixed buffer offset in expose method. + + * libgimpwidgets/Makefile.am + * libgimpwidgets/test-preview-area.c: more a benchmark than a + test; quite similar to testrgb from the GTK+ source tree. + +2004-07-29 DindinX <david@dindinx.org> + + * plug-ins/FractalExplorer/Dialogs.c: converted all GtkPreview + widgets to GimpPreviewArea. + +2004-07-29 Michael Natterer <mitch@gimp.org> + + * libgimpmodule/gimpmoduledb.c: converted tabs to spaces, removed + unused #if 0'ed prototype and unused #includes, minor cleanups. + +2004-07-29 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/*.[ch]: normalized the names of the fields + of gimpressionist_vals_t. + +2004-07-29 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgets.def + * libgimpwidgets/gimpwidgets.h + * libgimpwidgets/gimpwidgetstypes.h + * libgimpwidgets/gimppreviewarea.[ch]: added GimpPreviewArea, a + replacement for GtkPreview, loosely based on patches from Geert + Jordaens and David Odin. Fixes bug #144759. + + * plug-ins/common/sharpen.c: use the new widget instead of a + GtkPreview; saves about 100 lines of rather complex code :) + +2004-07-29 Michael Natterer <mitch@gimp.org> + + * etc/controllerrc: changed default configuration of the keyboard + controller: scroll the display one step on cursor_key, scroll by + one page on <shift>+cursor_key and scroll to top/bottom/left/right + on <control>+cursor_key. Fixes bug #53988. + + Moved the old opacity-modifying actions to <alt>+cursor_key. + +2004-07-29 Michael Natterer <mitch@gimp.org> + + Replaced the concept of having a boolean indicating if an undo + step dirties the image by a bitfield indicating which parts + of the image are dirtied: + + * app/core/core-enums.[ch]: reordered two values in enum + GimpUndoType, added GIMP_DIRTY_IMAGE_SIZE to enum GimpDirtyMask. + + The values of GimpDirtyMask are still questionable and will + probably change... + + * app/core/gimpimage.[ch]: removed signal "undo_start" and added + a GimpDirtyMask parameter to the "dirty" and "clean" signals. + + * app/core/gimpimage-undo.[ch] (gimp_image_undo_push): replaced + "gboolean dirties_image" by "GimpDirtyMask dirty_mask" and pass + it to gimp_image_dirty(). + + (gimp_image_undo_group_start): added *ugly* code which tries to + figure GimpDirtyMask from the group's GimpUndoType and store it in + the GimpUndoGroup. Call gimp_image_dirty() instead of the removed + gimp_image_undo_start(). This means the undo group now dirties the + image just like one of its undo steps, but that's no problem since + undoing cleans it in the same way. + + * app/core/gimpundo.[ch]: s/dirties_image/dirty_mask/g + + (gimp_undo_pop): emit clean/dirty signals *before* performing the + actual undo step so listeners can detach from the image before it + is changed by undo. + + * app/core/gimpimage-undo-push.c (gimp_image_undo_push_*): pass a + GimpDirtyMask instead of TRUE/FALSE to gimp_image_undo_push(). + + * app/core/gimpimagemap.[ch]: removed "gboolean interactive" + because it makes no sense to use GimpImageMap noninteractively. + Don't freeze()/thaw() undo while the image_map is active which + fixes many ways of trashing the image's undo state but probably + introduces new ways of doing evil things. + + * app/display/gimpdisplay-foreach.c + * app/display/gimpdisplayshell-handlers.c: changed according + to the GimpImage::clean()/dirty() signal changes. Small fixes + in the quit dialog's dirty image container. + + * app/tools/gimptoolcontrol.[ch]: added member and API to + set/get the dirty_mask. + + * app/tools/gimpcroptool.c + * app/tools/gimpimagemaptool.c + * app/tools/gimpiscissorstool.c + * app/tools/gimptexttool.c + * app/tools/gimptransformtool.c: whenever setting "preserve" to + FALSE, also set a "dirty_mask" which specifies on which image + changes the tool wants to be canceled. + + * app/tools/tool_manager.c: removed "undo_start" connection and + connect to both "dirty" *and* "clean" to check if the active_tool + needs to be canceled. Cancel the tool only if the dirty_mask + passed in the signal has common bits with the tool's dirty_mask. + + Fixes bug #109561 and probably opens some new ones... + +2004-07-29 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimp/gimp.def + * libgimp/gimpui.def: added some missing symbols + +2004-07-29 Sven Neumann <sven@gimp.org> + + * libgimpbase/gimpbase.def: added new symbols. + +2004-07-29 Michael Natterer <mitch@gimp.org> + + Added support for motion event history as provided by some input + device drivers. If you have a tablet driver supporting this, + please try and report back. + + * app/display/gimpdisplayshell.h (struct GimpDisplayShell): added + member "guint32 last_motion_time". + + * app/display/gimpdisplayshell-callbacks.c + (gimp_display_shell_tool_events): remember the last_motion_time on + button_press() and after motion() and ask the current device for + its motion history; in motion(), if the active_tool asks for exact + motions, check if the input device recorded a motion history and + process the history instead of the motion event. + + (gimp_display_shell_get_time_coords): new utility function which + gets GimpCoords from a GdkTimeCoord struct as used by the motion + history. + +2004-07-29 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/repaint.c: converted a multiple if into + a nested one. + +2004-07-29 Sven Neumann <sven@gimp.org> + + * app/core/core-enums.h: removed enums GimpImageType and + GimpImageBaseType ... + + * libgimpbase/gimpbaseenums.h: ... and added them here. Also moved + all enums from gimpbasetypes.h to this new file. + + * libgimpbase/Makefile.am + * tools/pdbgen/Makefile.am: changed accordingly. + + * app/core/core-enums.c + * libgimp/gimpenums.h + * libgimpbase/gimpbaseenums.c + * tools/pdbgen/enums.pl: regenerated. + + * libgimpbase/gimpparasite.c + * libgimpbase/gimpprotocol.c + * libgimp/gimp.c: include <glib-object.h> + + * libgimpbase/gimpbasetypes.[ch]: added API to set and get a + translation domain on a GType. This is used for translatable enum + values. + + * libgimpbase/gimputils.[ch]: added API to retrieve the translated + name for an enum value. + + * app/widgets/gimpenumstore.c + * app/widgets/gimpenumwidgets.c: use the new API in libgimpbase. + +2004-07-29 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawable.c: fixed gtk-doc comments. + +2004-07-29 Dave Neary <bolsh@gimp.org> + + * app/core/gimpdrawable-transform.c: Stop signed ints overflowing + while getting the mean by replacing (a + b) / 2 with a / 2 + b / 2. + Fixes bug #128594 for drawables less than 32K wide. + +2004-07-29 Michael Natterer <mitch@gimp.org> + + * app/gui/preferences-dialog.c: renamed "Cleared saved foobar now" + buttons to "Reset saves foobar to default values". Fixes bug #5673. + Added mnemonics for all the configure/save/reset buttons. + +2004-07-29 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.c (script_fu_free_script): + applied patch by Kevin Cozens that moves a g_free() to the right + place (bug #148729). + +2004-07-28 Michael Natterer <mitch@gimp.org> + + * app/actions/actions.c (action_groups): register the + GIMP_STOCK_VISIBLE icon with the "view" action group. + +2004-07-28 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/brush.c: removed a redundant parameter + from one of the internal functions. + * plug-ins/gimpressionist/utils.c: Made sure that resources that + are selected by the presets will position their list views + accordingly. + +2004-07-28 Sven Neumann <sven@gimp.org> + + * autogen.sh: if the check for libtoolize fails, try glibtoolize. + +2004-07-28 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/presets.c: created a base function for + two functions with duplicate code. + +2004-07-28 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_default_dialog.c: no need to include + "libgimp/stdplugins-intl.h" here. + +2004-07-28 Michael Natterer <mitch@gimp.org> + + * app/gui/preferences-dialog.c (prefs_dialog_new): reordered + buttons in the Interface -> Keyboard Shortcuts section to be + consistent with other sections which provide configure/save/clear + buttons. + +2004-07-28 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpbycolorselecttool.c (gimp_by_color_select_tool_init) + * app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_init): + don't call gimp_tool_control_set_preserve (tool->control, FALSE) + because these tools don't cache any image state and don't care + about the image changing under their feet. + +2004-07-28 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell.c (gimp_display_shell_reconnect): + emit "reconnect" *before* emitting scale and scroll events so + listeners (the navigation view) can switch to the new image at the + right time. + +2004-07-28 Sven Neumann <sven@gimp.org> + + Applied a patch from Brion Vibber that makes the TWAIN plug-in + available on Mac OS X (bug #147962): + + * configure.in + * plug-ins/Makefile.am: check for Mac OS X twain support. + + * plug-ins/twain/Makefile.am + * plug-ins/twain/tw_local.h + * plug-ins/twain/tw_mac.c + * plug-ins/twain/tw_platform.h + * plug-ins/twain/tw_win.c: new files with platform specific code. + + * plug-ins/twain/README + * plug-ins/twain/tw_dump.[ch] + * plug-ins/twain/tw_func.[ch] + * plug-ins/twain/tw_util.[ch] + * plug-ins/twain/twain.c: changed accordingly. + + * plug-ins/twain/gimp-twain.png: twain application icon used by + the Mac port. + + * plug-ins/twain/tw_sess.c: removed, doesn't seem to be used. + +2004-07-28 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/image.pdb (image_is_dirty): fix typo in + parameter description. + + * app/pdb/image_cmds.c + * libgimp/gimpimage_pdb.c: regenerated. + +2004-07-28 DindinX <david.odin@cpe.fr> + + * plug-ins/common/unsharp.c: Added a toggle button to enable/disable + preview updating. Should fix #144972. + +2004-07-28 DindinX <david.odin@cpe.fr> + + * plug-ins/common/shift.c + * plug-ins/common/sinus.c + * plug-ins/common/snoise.c + * plug-ins/common/spheredesigner.c: added missing calls to + g_rand_free (), remove tabs while I was at it. + + * plug-ins/common/smooth_palette.c: minor cleanup + + * plug-ins/common/spread.c: removed tabs. + +2004-07-28 Michael Natterer <mitch@gimp.org> + + * app/core/core-enums.h: added still unused flags type + GimpDirtyMask. + + * app/base/Makefile.am + * app/core/Makefile.am + * app/display/Makefile.am + * app/paint/Makefile.am + * app/text/Makefile.am + * app/tools/Makefile.am + * app/widgets/Makefile.am + * libgimpthumb/Makefile.am: changed calls to gimp-mkenums to + support GTypeFlags and to make the value arrays private to the + get_type() functions. + + * app/base/base-enums.c + * app/core/core-enums.c + * app/display/display-enums.c + * app/paint/paint-enums.c + * app/text/text-enums.c + * app/tools/tools-enums.c + * app/widgets/widgets-enums.c: regenerated. + +2004-07-28 Michael Natterer <mitch@gimp.org> + + * app/paint/gimpclone.c: converted tabs to spaces. + +2004-07-28 DindinX <david.odin@cpe.fr> + + * plug-ins/common/spread.c: fix a smallish memory leak. + +2004-07-28 Sven Neumann <sven@gimp.org> + + * tools/gimp-mkenums: synced with glib-mkenums (execept for the + newly added template feature). + +2004-07-28 Michael Natterer <mitch@gimp.org> + + * libgimp/gimpbrushselect.c + * libgimp/gimpfontselect.c + * libgimp/gimpgradientselect.c + * libgimp/gimppalettemenu.c + * libgimp/gimppaletteselect.c + * libgimp/gimppatternselect.c (gimp_*_select_destroy): don't + leak the selected object's name and its data (brush mask etc). + + * libgimp/gimpfontmenu.c: moved the icon to the left side of the + button. + + * libgimp/gimppalettemenu.c: ditto. Added "Since: GIMP 2.2" to + API docs. + +2004-07-28 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpactiongroup.c + (gimp_action_group_set_action_label): forgot to strip mnemonics + here. + +2004-07-28 Michael Natterer <mitch@gimp.org> + + Enabled disabling all menu mnemonics. Addresses bug #120034: + + * app/config/gimpguiconfig.[ch] + * app/config/gimprc-blurbs.h: added boolean RESTART property + "menu-menonics". + + * app/gui/preferences-dialog.c: added a GUI for it. + + * app/widgets/gimpactiongroup.[ch]: added boolean CONSTRUCT_ONLY + property "mnemonics". + + (gimp_action_group_add_*_actions): call gimp_strip_uline() on + the actions' labels if mnemonics is FALSE. + + * app/widgets/gimpactionfactory.[ch] + * app/actions/actions.c: pass gui_config->menu_menmonics to + all action groups. + +2004-07-27 Sven Neumann <sven@gimp.org> + + * menus/image-menu.xml.in: commented out "Context" menu now that + we have a shortcut editor. + +2004-07-27 Sven Neumann <sven@gimp.org> + + * app/core/gimpgradient-load.c: don't leak empty SVG gradients. + +2004-07-27 Sven Neumann <sven@gimp.org> + + * app/actions/image-commands.c: include "libgimpbase/gimpbase.h", + not an individual header out of libgimpbase. + +2004-07-27 Sven Neumann <sven@gimp.org> + + * libgimpbase/Makefile.am + * libgimpbase/gimpbase.h + * libgimpbase/gimpbase.def + * libgimpbase/gimpmemsize.[ch]: added new files with memsize + related functions (moved here from gimputil.c) and + GIMP_TYPE_MEMSIZE (moved here from app/config/gimpconfig-types.[ch]). + + * libgimpbase/gimputils.[ch]: removed gimp_memsize_to_string() here. + + * libgimpbase/gimpunit.[ch]: added GIMP_TYPE_UNIT (moved here from + app/config/gimpconfig-types.[ch]). + + * libgimpbase/gimpbase-private.c + * libgimp/gimptile.c + * libgimp/gimpunitcache.c + * plug-ins/help/domain.c + * app/xcf/xcf-read.c: need to include glib-object.h. + + * plug-ins/common/uniteditor.c: use GIMP_TYPE_UNIT. + + * app/config/gimpconfig-types.[ch]: removed code that lives in + libgimpbase now. + + * app/config/gimpconfig-deserialize.c: changed accordingly. + + * app/config/gimpbaseconfig.c + * app/config/gimpdisplayconfig.c + * app/core/gimpcontext.c + * app/gui/grid-dialog.c + * app/tools/gimpcolortool.c + * app/widgets/gimpaction.c + * app/widgets/gimpunitstore.c: no need to include gimpconfig-types.h + any longer. + +004-07-27 Michael Natterer <mitch@gimp.org> + + * libgimp/Makefile.am + * libgimp/gimp.h + * libgimp/gimpui.h + * libgimp/gimppalettemenu.[ch] + * libgimp/gimppaletteselect.[ch]: added palette select wrapper and + widget (straight copy & string replace of the font select stuff). + Fixes bug #136130. + + * plug-ins/script-fu/script-fu-enums.h + * plug-ins/script-fu/script-fu-scripts.c + * plug-ins/script-fu/siod-wrapper.c: added SF_PALETTE so it can + be used in scripts. + + * plug-ins/script-fu/scripts/test-sphere.scm: added a palette + parameter to the test script. + +2004-07-27 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage.c (gimp_image_finalize): remove the image + from the image hash table and set its "gimp" pointer to NULL + *after* all layers, channels, vectors and the selection are + finalized; otherwise these items have no chance of removing + themselves from the item hash table (because image->gimp is + already NULL). Spotted by pgimeno and nomis. + (should be backported after it got some testing) + +2004-07-27 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_new): string change. + +2004-07-27 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_uri): make + sure we always set a non-null URI. + +2004-07-27 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphelp-ids.h removed unused help IDs + GIMP_HELP_FILE_OPEN_XCF and GIMP_HELP_FILE_SAVE_XCF. The help IDs + for these entries are generated from the procedure names. + +2004-07-27 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphelp.c (gimp_help): print the help-id and + help-domain to stdout if gimp was started with the --verbose + command-line option. + +2004-07-27 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_add_filters): + show extensions in the filters menu. Is this a good idea at all? + +2004-07-27 Sven Neumann <sven@gimp.org> + + * libgimp/gimpbrushmenu.c + * libgimp/gimppatternmenu.c: attempt to make the brush and pattern + selectors look less like buttons (supposed to fix bug #147777). + +2004-07-27 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpcolorhexentry.c (gimp_color_hex_entry_events): + also accept the short hexadecimal notation (3 hex digits). + +2004-07-26 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/Makefile.am (libgimpwidgetsinclude_HEADERS): + added new files. + +2004-07-26 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/gimpcellrenderertoggle.[ch]: moved to libgimpwidgets. + + * app/widgets/gimpcomponenteditor.c + * app/widgets/gimpcontainertreeview.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimptoolview.c + * app/widgets/widgets-types.h: changed accordingly. + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgets.def + * libgimpwidgets/gimpwidgets.h + * libgimpwidgets/gimpwidgetsmarshal.list + * libgimpwidgets/gimpwidgetstypes.h + * libgimpwidgets/gimpcellrenderertoggle.[ch]: custom toggle cell + renderer moved here from app/widgets. + + * libgimpwidgets/gimpcellrenderercolor.[ch]: unified code with the + new toggle cell renderer. + +2004-07-26 Michael Natterer <mitch@gimp.org> + + * app/pdb/procedural_db.[ch] (procedural_db_free_data): new + function which clears the whole list of data set by plug-ins. + + (procedural_db_free): use it. + + * app/actions/plug-in-actions.c + * app/actions/plug-in-commands.[ch]: added action, callback and + confirmation dialog for "Reset all filters to default values". + Somehow addresses bug #81015. + + * app/widgets/gimphelp-ids.h: added a help ID for the new action. + + * menus/image-menu.xml.in: added it to the "Filters" submenu. + +2004-07-26 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpcellrenderercolor.c + (gimp_cell_renderer_color_get_size): fine-tuning. + +2004-07-26 Michael Natterer <mitch@gimp.org> + + * app/config/gimpconfig-types.h: removed GIMP_TYPE_COLOR. + + * app/config/gimpconfig-params.[ch]: renamed GimpParamSpecColor + to GimpParamSpecRGB. + + * app/config/gimpconfig-deserialize.c + * app/config/gimpconfig-dump.c + * app/config/gimpconfig-serialize.c + * app/config/gimpscanner.c + * app/core/gimp-utils.c + * app/core/gimpcontext.c + * app/core/gimpgrid.c + * app/display/gimpdisplayoptions.c + * app/text/gimptext.c + * app/tools/gimpcolortool.c + * app/widgets/gimpaction.c + * app/widgets/gimpcolorbar.c + * app/widgets/gimppropwidgets.c: changed accordingly. + +2004-07-26 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: added a de-allocation to the PPM's + allocated by the size map dialog. + +2004-07-26 Sven Neumann <sven@gimp.org> + + * app/core/gimpgradient-load.c: load all linear gradients from an + SVG file, not only the first one. + +2004-07-26 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdatafactory.h: added "gboolean writable" to the + GimpDataFactoryLoaderEntry struct. Return a GList* instead of + GimpData* from GimpDataLoadFunc so it's possible to load more than + one data object from one file. + + * app/core/gimpdatafactory.c (gimp_data_factory_load_data): + changed accordingly: add all items of the returned lists to the + data factory. Make the data object writable only if it's in the + writable path *and* its loader entry says it's a writable format + *and* the returned list contains exactly one element. + + * app/core/gimp.c (gimp_real_initialize): declare all loader + entries as writable where we have code to read and write exactly + one object per file; all others are not writable. + + * app/core/gimpbrush.[ch] + * app/core/gimpbrushgenerated.[ch] + * app/core/gimpbrushpipe.[ch] + * app/core/gimpgradient-load.[ch] + * app/core/gimppalette.[ch] + * app/core/gimppattern.[ch] (all load functions): return a list + containing the loaded object instead of the object itself. + +2004-07-26 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgets.def + * libgimpwidgets/gimpwidgets.h + * libgimpwidgets/gimpwidgetstypes.h + * libgimpwidgets/gimpcellrenderercolor.[ch]: added a GimpRGB cell + renderer. + + * libgimpwidgets/gimpcolorarea.[ch]: exported the function that + renders the color to a buffer for internal use in libgimpwidgets. + + * libgimpwidgets/gimpcolorhexentry.c: use the new cell renderer + for the completion popup. + +2004-07-26 Sven Neumann <sven@gimp.org> + + * libgimpcolor/gimpcolor.def + * libgimpwidgets/gimpwidgets.def: added new symbols. + +2004-07-26 Sven Neumann <sven@gimp.org> + + * libgimpcolor/gimprgb.[ch]: register GimpRGB as a boxed type. + + * libgimpcolor/gimpadaptivesupersample.c + * libgimpcolor/gimpcolorspace.c + * libgimpcolor/gimprgb-parse.c + * libgimp/gimp.h: include <glib-object.h> instead of <glib.h>. + +2004-07-26 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: placed all the orientation map-related + public functions in orientmap.h. Now we're freeing the PPM's that it + is allocating by a call to orientation_map_free_resources(). + +2004-07-26 Michael Natterer <mitch@gimp.org> + + * app/core/core-types.h: removed unused typedef + GimpDataObjectLoaderFunc. + +2004-07-26 Sven Neumann <sven@gimp.org> + + * libgimpcolor/gimprgb-parse.c + * libgimpcolor/gimprgb.h: added new function gimp_rgb_list_names() + that gives access to the list of SVG color keywords. + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgets.h + * libgimpwidgets/gimpwidgetstypes.h + * libgimpwidgets/gimpcolorhexentry.[ch]: added new widget that + allows to enter colors in hex notation or by using color names. + + * libgimpwidgets/gimpcolorscales.c: use a GimpColorHexEntry. + +2004-07-26 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpeditselectiontool.[ch]: renamed init_edit_selection() + to gimp_edit_selection_tool_start(). Removed enum EditType. + + * app/tools/tools-enums.h: added enum GimpTranslateMode instead. + + * app/tools/gimpmovetool.c: changed accordingly. + + * app/tools/gimpselectiontool.[ch]: added protected utility + function gimp_selection_tool_start_edit(). + + * app/tools/gimpfreeselecttool.c + * app/tools/gimpfuzzyselecttool.c + * app/tools/gimprectselecttool.c: use the new function instead of + duplicating the same code three times, don't include + "gimpeditselectiontool.h". + + * app/tools/gimpiscissorstool.c: don't include + "gimpeditselectiontool.h". + +2004-07-26 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpeditselectiontool.c: don't freeze()/thaw() the + image's undo to prevent live-movement from ending up on the undo + stack. Instead, just stop pushing undo steps after the initial + movement. Simplifies edit_select's undo code quite a bit and fixes + bug #148458. + +2004-07-26 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpcolorscales.c (gimp_color_scales_hex_events): + accept SVG color names in the hex entry. Not very intuitive but + probably a nice experts feature and it can be improved later. + +2004-07-26 Michael Natterer <mitch@gimp.org> + + * app/main.c (main): use #ifdef GIMP_UNSTABLE instead of looking + at GIMP_MINOR_VERSION. + + * app/app_procs.c: don't #include "tools/gimp-tools.h". + +2004-07-26 Sven Neumann <sven@gimp.org> + + * plug-ins/bmp/bmp.h + * plug-ins/bmp/bmpread.c: applied a patch by Brion Vibber that + fixes extra data overflow, nonstandard 16bpp field arrangement + and unrecognized compression (bug #143682). + +2004-07-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/decompose.c: clamp results of LAB decomposition + so that out-of-gamut conversions do not overflow and get badly + distorted. Fixes bug #147603. Note that it would probably be a + good idea to do similar things for other conversion types. + +2004-07-25 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: converted checks for initialization of + ppm's done by checking the "col" buffer, to macro calls. + +2004-07-25 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: fixed bug #148088: ("Gimpressioinst + crashes if given malicious presets with out of range values, in + the radio buttons group numeric values: "placetype", "orienttype", + etc. "). + + This was done by adding clamps to the relevant values in the preset. + +2004-07-25 Raphaël Quinet <quinet@gamers.org> + + * INSTALL: Minor fixes and improvements. Suggest using a + different prefix and setting PKG_CONFIG_LIBDIR if old versions of + GTK+ libs are found and cannot be removed without breaking other + packages. + +2004-07-23 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: created a header "orientation.h" + for the Orientation tab specific declarations. + +2004-07-23 Sven Neumann <sven@gimp.org> + + * libgimp/gimppixbuf.c (gimp_pixbuf_from_data): added missing code + for grayscale previews. + +2004-07-23 Sven Neumann <sven@gimp.org> + + * app/core/gimpgradient-load.c (svg_parser_end_element): fixed + handling of the last gradient segment and did some code cleanup. + +2004-07-23 Sven Neumann <sven@gimp.org> + + * app/core/gimpgradient-load.c (gimp_gradient_load_svg): improved + error message. + (svg_parser_end_element): don't crash on empty gradient definitions. + +2004-07-23 Sven Neumann <sven@gimp.org> + + * libgimpcolor/test-color-parser.c: added more test samples. + + * libgimpcolor/gimprgb-parse.c: fixed a bug that I found with the + new tests. + + * app/core/gimpgradient-load.c: changed SVG parser to handle + gradients that are defined more deeply in the SVG hierarchy. Added + a simplistic CSS style parser to deal with gradient definitions + that use CSS to define the gradient stop properties (closes bug + #148127). + +2004-07-23 Sven Neumann <sven@gimp.org> + + * app/core/gimpdatafactory.c: some newlines to improve error + messages. + + * app/core/gimpgradient-load.c (gimp_gradient_load_svg): fixed + error handling. + +2004-07-23 Sven Neumann <sven@gimp.org> + + * libgimpcolor/Makefile.am + * libgimpcolor/test-color-parser.c: added a simple unit test + framework for the color parser. + + * libgimpcolor/gimprgb-parse.c: fixed parsing of rgba() values. + + * libgimpmath/test-md5.c: minor cleanup. + +2004-07-23 Sven Neumann <sven@gimp.org> + + * libgimpcolor/gimprgb-parse.c (gimp_rgba_parse_css): added support + for the "transparent" color name. + +2004-07-22 Sven Neumann <sven@gimp.org> + + * libgimpcolor/gimprgb-parse.c + * libgimpcolor/gimprgb.h: improved the CSS color parser code, + added new function gimp_rgba_parse_css(), added support for HSL + color values. + +2004-07-22 Sven Neumann <sven@gimp.org> + + * libgimpcolor/gimprgb-parse.c + * libgimpcolor/gimprgb.h: use a signed integer to pass the string + length to the new parser functions. The API explicitely asks for + -1 to be passed... + + * app/core/gimp.c + * app/core/gimpgradient-load.[ch] + * app/core/gimpgradient.h: added preliminary support for loading + simple SVG gradients (see bug #148127). Be careful with this new + feature; editing the loaded gradient will cause the SVG file to be + overwritten! Work in progress... + +2004-07-22 Sven Neumann <sven@gimp.org> + + * app/core/Makefile.am + * app/core/gimpgradient-load.[ch] + * app/core/gimpgradient-save.[ch] + * app/core/gimpgradient.[ch]: moved gradient file handling out of + gimpgradient.c to new files. + + * app/core/gimp.c + * app/actions/gradients-commands.c: changed accordingly. + + * libgimpcolor/gimpcolor.def: added gimp_rgb_parse_name. + +2004-07-22 Michael Natterer <mitch@gimp.org> + + * data/misc/gimp.desktop.in.in (MimeType): image/g -> image/g3fax. + +2004-07-22 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpactionview.c: rephrased the text for the dialog + that appears if a new shortcut collides with an existing one. + + * libgimpcolor/gimprgb.[ch]: added new function gimp_rgb_parse_name() + which accepts RGB colors in hexadecimal notation or as SVG color + keywords. + +2004-07-22 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell.c (gimp_display_shell_resume): + s/pause/resume/ in the API docs. + +2004-07-22 Michael Natterer <mitch@gimp.org> + + * tools/gimp-remote.c (main): correctly convert relative paths to + URIs. Append the resulting URI only if it's not NULL. + +2004-07-22 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimptoolbox.c (toolbox_create_tools): connect to + "accel-changed" of the accel_group using connect_object(), not + just connect() so we don't crash when it's emitted after the + toolbox is destroyed. + +2004-07-21 Ray Strode <rstrode@redhat.com> + + * gimp/data/misc/gimp.desktop.in.in: Add MimeType line to desktop + file for new MIME system. + +2004-07-21 Sven Neumann <sven@gimp.org> + + * plug-ins/common/gif.c: declared global const variable as static. + Fixes compiler warnings seen with gcc 3.4.1 (don't ask me why). + +2004-07-21 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimptemplateeditor.c + * plug-ins/common/gif.c + * plug-ins/common/jpeg.c: set GTK_SHADOW_IN on scrolled windows of + text views. Fixes bug #148025. + +2004-07-21 Michael Natterer <mitch@gimp.org> + + Enabled the various "Clear saved foobar now" buttons in prefs: + + * app/gui/session.[ch] + * app/menus/menus.[ch] + * app/widgets/gimpdevices.[ch]: implemented the _clear() + functions: unlink() the rc file and set an internal flag that it + has been deleted. Added "gboolean always_save" parameter to the + _save() functions and don't save anything if it is FALSE and the + internal deletion flag has been set. + + * app/gui/gui.c + * app/widgets/gimpdevicestatus.c: changed accordingly. + + * app/gui/preferences-dialog.c: added callbacks for all "Save now" + and "Clear now" buttons and show error messages if clearing fails. + Inform the user that she has to restart GIMP to see the effect of + the clearing. + +2004-07-21 Michael Natterer <mitch@gimp.org> + + * app/core/gimpmarshal.list + * app/widgets/gimpcellrendereraccel.[ch]: added "gboolean delete" + parameter to the GimpCellRendererAccel::accel_edited() signal. + + * app/widgets/gimpactionview.c: distinguish between deletion of an + accelerator and the user entering an invalid accelerator. + +2004-07-21 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: normalized the identifiers in + placement.c. + +2004-07-21 Michael Natterer <mitch@gimp.org> + + * app/actions/context-actions.c: changed names of actions which + select brushes, patterns etc. from e.g. "context-brush-first" to + "context-brush-select-first". + + * menus/image-menu.xml.in: changed accordingly. + +2004-07-21 Michael Natterer <mitch@gimp.org> + + * app/gui/preferences-dialog.c: remember the keyboard shortcut + dialog and show it only once. + + * app/widgets/gimpactionview.c + * app/widgets/gimpcellrendereraccel.c: minor cleanups. + + Seems to work pretty well now and thus fixes bug #142922. + +2004-07-21 Michael Natterer <mitch@gimp.org> + + * app/core/gimpmarshal.list + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcellrendereraccel.[ch]: new cell renderer + which displays an accelerator and allows to edit it (ripped + out of libegg and modified). + + * app/widgets/gimpactionview.c: use the new renderer and connect + to its "accel-edited" signal (its callback is one huge mess that + needs to be cleaned up). Added ugly hack to work around GTK+ API + limitation that seems to prevent implementing a shortcut editor in + a sane way. + + * app/actions/file-actions.c + * app/actions/image-actions.c + * app/actions/tools-actions.c: added ugly hacks here, too. + + * app/gui/preferences-dialog.c: relaced Cancel/Ok in the shortcut + editor by Close. + +2004-07-20 Sven Neumann <sven@gimp.org> + + * configure.in (ALL_LINGUAS): added back "pa" for Punjabi now that + the missing po files have been added (tips/pa.po is still missing + though). + +2004-07-20 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpactionfactory.[ch] + * app/widgets/gimpactiongroup.[ch]: added "label" and "stock-id" + properties to GtkActionGroup and allow to register them in the + GimpActionFactory. + + * app/actions/actions.c: register user visible labels and icons + with all action groups. + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpactionview.[ch]: new widget which shows a + treeview of action groups and their actions & shortcuts. + + * app/widgets/gimpaction.[ch]: added gimp_action_name_compare() + utility function. + + * app/widgets/gimpwidgets-utils.[ch]: added + gimp_get_accel_string() utility function. + + * app/widgets/gimpcontrollers.[ch]: added + gimp_controllers_get_ui_manager() which will be used for setting + up the controller mapping dialog. + + * app/gui/preferences-dialog.c: added a "Configure Keyboard + Shortcuts" button which pops up a GimpActionView. Work in + progress... + +2004-07-20 Michael Natterer <mitch@gimp.org> + + * app/actions/image-actions.c: make sure that the "image-new" and + "image-new-from-image" actions always have the same shortcut. + +2004-07-20 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/Lighting/lighting_main.c + * plug-ins/Lighting/lighting_main.h + * plug-ins/Lighting/lighting_preview.c + * plug-ins/Lighting/lighting_preview.h + * plug-ins/Lighting/lighting_shade.c + * plug-ins/Lighting/lighting_ui.c: completely reworked UI for + lighting page. Now supports up to 6 lights (more is trivial). + Added ability to temporarily isolate selected light. Added + light intensity controls. Can interactively position each light + (does not quite work yet for directional lights). + +2004-07-20 Michael Natterer <mitch@gimp.org> + + * app/actions/tools-actions.c: added an icon to the + "tools-visibility" action. + +2004-07-20 Sven Neumann <sven@gimp.org> + + * app/composite/gimp-composite.c (gimp_composite_init): now that + the output depends on --verbose, enable it for stable releases also. + +2004-07-20 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/presets.c: fixed the incorrect strings + for input and output of the preset's fields. (a relic of an + irresponsible search-and-replace script). + + * plug-ins/gimpressionist/: normalized the identifiers of + orientmap.c. + +2004-07-20 Helvetix Victorinox <helvetix@gimp.org> + + * app/composite/Makefile.am (regenerate): Updated make-installer.py + command line to take advantage of the new compile time method of + determining which instruction set to compile. + + * app/composite/gimp-composite.c (gimp_composite_init): Print the + list of active instruction sets if the --verbose command line + switch is ON (via be_verbose) + + * app/composite/gimp-composite-x86.h: Factored code from the mmx, + and sse implementations. + + * app/composite/make-installer.py: Raised the number of test + iterations from 1 to 10. + + * app/composite/gimp-composite-3dnow.[ch] + * app/composite/gimp-composite-3dnow-test.c + * app/composite/gimp-composite-3dnow-installer.c + * app/composite/gimp-composite-altivec.[ch] + * app/composite/gimp-composite-altivec-test.c + * app/composite/gimp-composite-altivec-installer.c + * app/composite/gimp-composite-mmx.[ch] + * app/composite/gimp-composite-altivec-test.c + * app/composite/gimp-composite-altivec-installer.c + * app/composite/gimp-composite-sse.[ch] + * app/composite/gimp-composite-sse-test.c + * app/composite/gimp-composite-sse-installer.c + * app/composite/gimp-composite-sse2.[ch] + * app/composite/gimp-composite-sse2-test.c + * app/composite/gimp-composite-sse2-installer.c + * app/composite/gimp-composite-vis.[ch] + * app/composite/gimp-composite-vis-test.c: + Regenerated sources via make-installer.py + +2004-07-20 Sven Neumann <sven@gimp.org> + + * app/app_procs.c + * app/base/base.[ch] + * app/composite/gimp-composite.[ch]: pass "be_verbose" to the base + and composite subsystems. + +2004-07-20 Sven Neumann <sven@gimp.org> + + * autogen.sh: added some empty lines to improve readability of the + output in case of problems. + + * configure.in: bumped version number to 2.1.3. + +2004-07-19 Helvetix Victorinox <helvetix@gimp.org> + + * app/composite/gimp-composite-mmx.c + (xxxgimp_composite_dodge_rgba8_rgba8_rgba8_mmx) + * app/composite/gimp-composite-mmx.c + (xxxgimp_composite_divide_rgba8_rgba8_rgba8_mmx) + * app/composite/gimp-composite-mmx.c + (gimp_composite_difference_rgba8_rgba8_rgba8_mmx) + * app/composite/gimp-composite-mmx.c + (gimp_composite_darken_rgba8_rgba8_rgba8_mmx): More clobber + register corrections. + +2004-07-20 Sven Neumann <sven@gimp.org> + + * Made 2.1.2 release. + +2004-07-20 Sven Neumann <sven@gimp.org> + + * plug-ins/winicon/icoload.c + * plug-ins/winicon/icosave.c: added explicit casts to please the + compiler. + +2004-07-20 Sven Neumann <sven@gimp.org> + + * plug-ins/gimpressionist/Makefile.am (gimpressionist_sources): + added paper.h. + + * plug-ins/MapObject/Makefile.am (MapObject_SOURCES): added back + arcball.h. + + * plug-ins/MapObject/mapobject_main.c + * plug-ins/MapObject/mapobject_preview.c: no need to include + arcball.h here. + + * plug-ins/gfig/Makefile.am (SUBDIRS): added back gfig-examples + + * plug-ins/gfig/gfig-examples/Makefile.am: cleanup. + +2004-07-20 Sven Neumann <sven@gimp.org> + + * plug-ins/Lighting/lighting_ui.c: fixed some GUI issues: + left-align labels, use stock buttons, added line-breaks to make + the code fit into 80 columns. + +2004-07-19 Sven Neumann <sven@gimp.org> + + * plug-ins/Lighting/lighting_ui.c: fixed a couple of issues with + the new code: don't include individual glib headers, never ever + use sprintf(), mark user-visible strings for translations, use + default messages, removed trailing whitespace. + +2004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/Lighting/lighting_ui.c: added ability to save and load + presets for lights. + +2004-07-19 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/orientation.c: normalized some variables + in the module and fixed some indentation. + +2004-07-19 Helvetix Victorinox <helvetix@gimp.org> + + * app/composite/gimp-composite-mmx.c + (gimp_composite_addition_rgba8_rgba8_rgba8_mmx) + * app/composite/gimp-composite-mmx.c + (gimp_composite_burn_rgba8_rgba8_rgba8_mmx) + * app/composite/gimp-composite-x86.h: Correction of clobbered + register lists, as additional progress against bug #147013. + +2004-07-19 Michael Natterer <mitch@gimp.org> + + * app/core/gimpmarshal.list: removed unused VOID:UINT,STRING. + +2004-07-19 Michael Natterer <mitch@gimp.org> + + * app/gui/file-open-location-dialog.c + (file_open_location_dialog_show): added the "web" icon left of + label & entry. + +2004-07-19 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintcore.h: removed enum GimpPaintCoreState. + + * app/paint/paint-enums.h: added enum GimpPaintState (with values + that have a name space). + + * app/paint/gimppaintcore.[ch] + * app/paint/gimpairbrush.c + * app/paint/gimpbrushcore.c + * app/paint/gimpclone.c + * app/paint/gimpconvolve.c + * app/paint/gimpdodgeburn.c + * app/paint/gimperaser.c + * app/paint/gimpink.c + * app/paint/gimppaintbrush.c + * app/paint/gimppaintcore-stroke.c + * app/paint/gimpsmudge.c + * app/tools/gimppainttool.c: changed accordingly. + + * app/tools/gimpinktool.c: removed unused #include. + +2004-07-19 Sven Neumann <sven@gimp.org> + + * app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse): + moved variable declarations to the scope they are being used in, + removed trailing whitespace, minor cleanups. + +2004-07-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/core/gimpchannel-combine.c: put in two lines accidentally + omitted in previous change, improve doc comment. + +2004-07-19 Michael Natterer <mitch@gimp.org> + + * libgimpbase/gimpwin32-io.h: added copyright header, added + #defines for access(), F_OK, R_OK and X_OK. + + * app/core/gimpdata.c: include the above instead of defining + the workarounds here. + + * app/base/tile-swap.c + * app/config/gimpconfig-dump.c + * libgimpthumb/gimpthumb-utils.c + * libgimpthumb/gimpthumbnail.c: for consistency, #include + gimpwin32-io.h with "" instead of <>. + +2004-07-19 Michael Natterer <mitch@gimp.org> + + * app/core/gimpchannel-combine.c (gimp_channel_combine_ellipse): + comments not intended for gtk-doc must not start with '/**'. + +2004-07-19 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in.h (struct _PlugIn): removed obsolete + compile-time check for GLIB >= 2.3.5. + +2004-07-19 Shlomi Fish <shlomif@iglu.org.il> + + * ChangeLog: Fixed a copy-and-paste error with the dates of my commits. + * plug-ins/gimpressionist/ppmtool.c: removed a few commented-out + asserts, and the function that was used to implement them. + +2004-07-19 Michael Natterer <mitch@gimp.org> + + * app/widgets/widgets-types.h: reordered and commented to match + API docs. + +2004-07-19 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_browse.[ch]: renamed struct member + file_selection to file_chooser. + +2004-07-19 Michael Natterer <mitch@gimp.org> + + * app/config/config-types.h: removed GimpConfigInterface typedef, + added comments to typedefs which don't belong here. + + * app/config/gimpconfig.h: added GimpConfigInterface typedef. + + * app/core/core-types.h + * app/display/display-types.h: added commented out typedefs for + types that live in config-types.h for obscure reasons. + + * app/core/core-types.h: reordered stuff to match the order in the + API docs (makes keeping stuff in sync much easier). + +2004-07-19 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/repaint.c: replaced a few if's+destructors + pairs for ppm_ with just the destructors. + +2004-07-19 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/repaint.c: normalized some identifiers of + repaint.c, and corrected some indentation there. + +2004-07-18 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/core/gimpchannel-combine.c: improve anti-aliasing for + elliptical selections, as described in bug #147836. + +2004-07-18 Sven Neumann <sven@gimp.org> + + * app/composite/gimp-composite-mmx.h: don't start a comment with + /** unless it's meant to be parsed by gtk-doc. + + * app/actions/Makefile.am: + * app/actions/file-dialog-commands.[ch]: removed, not used any + longer. + +2004-07-18 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/paint/gimpink-blob.c (blob_make_convex): Check if the + array index is legal before using it, not the other way around. + Fixes bug #144856. + +2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/polar.c (dialog_update_preview): Fixed a + write to unallocated memory that was causing crashes in various + spots. + +2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/polar.c (polarize_func): moved array + initialization out of variable declaration. Fixes bug #147799. + +2004-07-17 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimphelp-ids.h: added the removed help IDs back. + + * app/widgets/gimpfileprocview.[ch]: cache all file_procs' help + IDs and added gimp_file_proc_view_get_help_id() which returns the + selected item's help ID. + + * app/widgets/gimpfiledialog.c: added a custom help func which + shows the help for the selected file_proc if the proc_view has the + focus. + +2004-07-17 Sven Neumann <sven@gimp.org> + + * app/actions/file-actions.c (file_actions): use GIMP_STOCK_WEB + for "file-open-location". + + * app/widgets/gimpfiledialog.c: create the scrolled window with + shadow_type GTK_SHADOW_IN. + + * app/widgets/gimpfileprocview.c (gimp_file_proc_view_new): skip + procedures that register a prefix (the URL loader). + + * app/widgets/gimphelp-ids.h: removed help IDs that used to be + used from the file-open and file-save menus. + + * plug-ins/common/xwd.c (query): "X window dump" seems to be more + appropriate than "X window image". + +2004-07-17 Sven Neumann <sven@gimp.org> + + * app/actions/Makefile.am + * app/actions/file-dialog-actions.[ch] + * app/actions/file-open-actions.[ch] + * app/actions/file-save-actions.[ch]: these aren't needed any + longer. + + * app/actions/actions.c: changed accordingly. + + * app/menus/Makefile.am + * app/menus/file-dialog-menu.[ch] + * app/menus/file-open-menu.[ch] + * app/menus/file-save-menu.[ch]: these aren't needed any longer. + + * app/menus/menus.c: changed accordingly. + + * menus/Makefile.am + * menus/file-open-menu.xml + * menus/file-save-menu.xml: these are also not needed any longer. + +2004-07-17 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/bmp/bmpwrite.c (WriteImage): Applied a patch from + Brion Vibber that fixes corruption when saving RLE-encoded + BMPs on big endian hosts. Fixes bug #147759. + +2004-07-17 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: normalized the identifiers of + general.c and general.h. Also, renamed a callback from _store + to simply _callback to avoid confusion with the _store methods. + Some of the member variables of the pcvals struct were changed + as a result. + +2004-07-16 Helvetix Victorinox <helvetix@gimp.org> + + * app/composite/gimp-composite-mmx.[ch] + * app/composite/gimp-composite-sse.[ch] + * app/composite/gimp-composite-sse2.[ch]: + + We've had trouble compiling with the Intel compiler which + identifies itself as GCC, but doesn't support the same extended + assembly features/misfeatures as GCC. With the help of the Intel + compiler group, we've determined that the Intel compiler can be + identified at compile time by the definition of the preprocessor + variable __INTEL_COMPILER. + + These changes make all of the assembly code currently written to + simply avoid the Intel compiler. + + This is an interim solution to get a build working despite the + Intel compiler. A more correct solution has been identified, see + the discussion of bug #147013 for more information. + +2004-07-17 Sven Neumann <sven@gimp.org> + + * app/xcf/xcf.c (xcf_init): also register the internal XCF + handlers according to the new scheme. + + * plug-ins/common/Makefile.am + * plug-ins/common/plugin-defs.pl + * plug-ins/common/hrz.c: removed the HRZ file plug-in since it + doesn't seem to be very useful. + +2004-07-17 Sven Neumann <sven@gimp.org> + + * app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add) + (plug_ins_init_file): use g_slist_prepend() instead of + g_slist_append(). + + * plug-ins/common/url.c (query): ported to the new PDB registration + scheme. + +2004-07-16 Sven Neumann <sven@gimp.org> + + * app/plug-in/plug-ins.c (plug_ins_init): sort the file procedures + by their menu labels. + + * app/widgets/gimpfileprocview.c: removed the sort function here. + +2004-07-16 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpfileprocview.[ch]: added new widget that offers + a treeview on file procedures. + + * app/widgets/gimpfiledialog.[ch]: replaced the file type option + menu with the new GimpFileProcView widget. + (gimp_file_dialog_set_image): reset the file type to Automatic + (fixes bug #141535). + + * app/actions/file-commands.c + * app/gui/file-open-dialog.[ch] + * app/gui/file-save-dialog.[ch]: changed accordingly. + + * plug-ins/common/bz2.c + * plug-ins/common/gz.c: don't register "xcf.gz" and "xcf.bz2" + extension. It's redundant and breaks the code that sets the + extension from the selected file-type. + + * plug-ins/common/dicom.c: register a shorter menu label. + + * plug-ins/common/gbr.c + * plug-ins/common/gih.c + * plug-ins/common/pat.c + * plug-ins/common/url.c: register stock icons. + +2004-07-16 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/Lighting/lighting_main.[ch] + * plug-ins/Lighting/lighting_preview.[ch] + * plug-ins/Lighting/lighting_shade.c + * plug-ins/Lighting/lighting_ui.c: Made this plug-in support + multiple light sources; implemented three, architecture now + supports any number. Changed material properties to more intuitve + names; added "metallic" property. Cleaned out some unused, + commented-out code. + +2004-07-16 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb.pl: include "libgimpbase/gimpbase.h" instead of + "libgimpbase/gimpparasite.h" for getting the GimpParasite type. + + * tools/pdbgen/app.pl + * tools/pdbgen/pdb/drawable.pdb + * tools/pdbgen/pdb/edit.pdb + * tools/pdbgen/pdb/gradients.pdb + * tools/pdbgen/pdb/guides.pdb + * tools/pdbgen/pdb/image.pdb: removed redundant #includes. + + * tools/pdbgen/pdb/plug_in.pdb: standardized "success" logic. + Consistently fail if there is no currently queried plugin. + + * app/pdb/*.c: regenerated. + +2004-07-16 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-transform.c: made gtk-doc even + happier; clarified meaning of the "use_offsets" parameter. + +2004-07-16 Sven Neumann <sven@gimp.org> + + * app/core/gimpdata.c: + * app/display/gimpcanvas.c: + * app/display/gimpdisplayshell.c + * app/display/gimpdisplayshell-transform.c: corrected API + documentation, removed trailing whitespace. + + Please do always build the documentation if you add or change any + gtk-doc comments. + +2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/display/gimpcanvas.c: + * app/display/gimpdisplayshell-transform.c: added gtk-doc + comments for all public functions that lack them. + + * app/display/gimpdisplayshell.c: added a couple of + gtk-doc comments. + +2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/core/gimpdata.c: added gtk-doc comments for + public functions. + +2004-07-15 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: normalized the identifiers of + paper.c and paper.h. Made one variable local to the function + instead of module static. + +2004-07-15 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: normalized the ppmtools.c and + ppmtool.h identifiers. Also fixed some (but not all) of the + syntax. + +2004-07-15 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/winicon/icoload.c: + * plug-ins/winicon/icosave.c: Applied a patch from Brion Vibber + that fixes byte-swapping on big endian hosts. Fixes bug #147610. + +2004-07-15 Sven Neumann <sven@gimp.org> + + * plug-ins/helpbrowser/dialog.c + * plug-ins/helpbrowser/uri.c: don't warn if no help pages are + installed and the Home button is clicked. + +2004-07-15 Michael Natterer <mitch@gimp.org> + + * app/file/file-open.c (file_open_layer): don't crash if no + layer or only one layer is visible. Fixes bug #143804. + + * app/app_procs.c (app_run): fixed log domain registration. + +2004-07-15 Michael Natterer <mitch@gimp.org> + + * app/core/gimpviewable.[ch]: corrected API docs and fixed + function parameter names to silent gtk-doc warnings. + +2004-07-15 Michael Natterer <mitch@gimp.org> + + * app/app_procs.c (app_run): register a log handler for the + "Gimp-Menus" domain. + +2004-07-15 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/mng.c: cleanup. + +2004-07-15 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/core/gimpviewable.c: added gtk-doc comments for public + functions. + +2004-07-15 Michael Natterer <mitch@gimp.org> + + * app/actions/file-commands.h: reordered to match the .c file. + + * app/core/gimpitem.c + * app/vectors/gimpvectors-import.c: fixed API docs. + +2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/png.c: + * plug-ins/common/mng.c: Fixed erroneously reported warning + message when saving indexed layers with an alpha channel but + no transparent pixels. + +2004-07-14 Sven Neumann <sven@gimp.org> + + * app/app_procs.c (app_run): register a log handler for the + "Gimp-Actions" domain. + +2004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * devel-docs/objects.txt: . . . and removed because it is + redundant with devel-docs/app/app.hierarchy. + +2004-07-14 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * devel-docs/objects.txt: added file containing a map of Gimp's + GObject hierarchy . + +2004-07-14 Michael Natterer <mitch@gimp.org> + + * app/display/gimpstatusbar.[ch]: massively changed: removed + message_ids, the message mem chunk and all signals. Added new + function gimp_statusbar_replace() which updates a message without + moving it to the top of the stack. Fixes bug #120175. + + * app/display/gimpdisplayshell-title.[ch]: renamed + gimp_display_shell_update_title() to + gimp_display_shell_title_update() and switched from pop()/push() + to replace() so the title message keeps its place in the stack. + Added new function gimp_display_shell_title_init() which push()es + the title message to the stack. + + * app/display/gimpdisplayshell.c (gimp_display_shell_new): call + gimp_display_shell_title_init() so the "title" message is at the + bottom of the stack. + + * app/display/gimpdisplayshell-callbacks.c + * app/display/gimpdisplayshell-handlers.c: changed accordingly. + +2004-07-14 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-console.[ch] + * plug-ins/script-fu/script-fu.c + * plug-ins/script-fu/siod-wrapper.[ch] + * plug-ins/script-fu/siod/slib.c: applied a patch from Kevin + Cozens that removes an unneeded pipe which was causing problems + on long output from the SIOD interpreter (bug #139200). Also + shortened the welcome message. + +2004-07-14 Sven Neumann <sven@gimp.org> + + * plug-ins/pagecurl/pagecurl.c: GUI polishing. + +2004-07-14 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: Added more underscores to identifiers. + Fixed some of the style issues (added whitespace before the '(' in + function calls). + +2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/mng.c: Now writes a global palette chunk, and + empty palette chunks for the frames that use it. This saves a + bit of diskspace. + +2004-07-14 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage.c: added properties "gimp", "id", "width", + "height" and "base-type". Moved all code from gimp_image_new() + to GObject::constructor(). + + * app/core/gimpimage-convert.c + * app/core/gimpimage-crop.c + * app/core/gimpimage-resize.c + * app/core/gimpimage-rotate.c + * app/core/gimpimage-scale.c + * app/core/gimpimage-undo-push.c: set "width", "height" and + "base-type" with g_object_set() so "notify" is emitted on the + properties. + + * app/core/gimpimage-undo.c (gimp_image_undo_pop_stack): + freeze/thaw property notifications around undoing/redoing so they + are not emitted in the middle of the undo operation. + +2004-07-14 Michael Natterer <mitch@gimp.org> + + * app/core/gimpitem.c: converted tabs to spaces, cleanup, + reviewed new API docs. + +2004-07-14 Sven Neumann <sven@gimp.org> + + * plug-ins/common/tiff.c: applied a patch done by Brion Vibber + and Philip Lafleur that fixes loading of CMYK TIFF images on + big-endian hardware (bug #147328). + +2004-07-14 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/mng.c (respin_cmap): Properly check the return + value of find_unused_ia_color(). The plugin will now save indexed + MNGs correctly; fixes bug #139947. Also converted tabs to spaces. + +2004-07-14 Michael Natterer <mitch@gimp.org> + + Code review & cleanup: + + * app/config/gimpguiconfig.[ch]: removed transparency-size, + transparency-type and snap-distance properties... + + * app/config/gimpdisplayconfig.[ch]: ...and added them here. + + * app/display/gimpdisplayshell.c + * app/tools/gimpmovetool.c: changed accordingly. + + * app/core/gimpimage-scale.[ch] (gimp_layer_scale_check): added a + "max_memsize" parameter instead of looking it up in GimpGuiConfig. + + * app/actions/image-commands.c: changed accordingly. + + * app/core/gimparea.c + * app/core/gimpdrawable.c: converted tabs to spaces, cleanup. + + * app/core/gimpprojection.[ch]: renamed IdleRenderStruct to + GimpProjectionIdleRender, reordered functions, cleanup. + + * app/display/gimpdisplay-handlers.c + * app/display/gimpdisplay.c: removed unused #includes. + + * app/display/gimpdisplayshell.[ch] + * app/display/gimpdisplayshell-close.c: renamed + shell->warning_dialog to shell->close_dialog, some random + cleanups. + + * app/display/gimpdisplayshell-handlers.c + * app/widgets/gimpselectioneditor.c: minor coding style cleanup. + +2004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/core/gimpitem.c: added documentation comments to some + of the functions. + +2004-07-14 Michael Natterer <mitch@gimp.org> + + * app/display/Makefile.am + * app/display/gimpdisplayshell-close.[ch]: new files for + gimp_display_shell_close() and its dialog & callback. + + * app/display/gimpdisplayshell.[ch]: removed from here. + + * app/actions/view-actions.c (view_close_view_cmd_callback): + changed accordingly. + +2004-07-14 Sven Neumann <sven@gimp.org> + + * plug-ins/pagecurl/pagecurl.c: code cleanup. Use enums instead of + a plethora of booleans. Added some macros for readability. Allow + to use a reversed gradient for colorizing the curl. + +2004-07-14 Michael Natterer <mitch@gimp.org> + + * app/core/Makefile.am + * app/core/core-types.h + * app/core/gimppickable.[ch]: new interface which has + get_image_type(), get_tiles() and get_color_at() methods. + + * app/core/gimpdrawable.[ch] + * app/core/gimpimagemap.[ch] + * app/core/gimpprojection.[ch]: implement GimpPickableInterface + and removed public get_colot_at() functions. + + * app/core/gimpimage-pick-color.[ch]: removed typedef + GimpImagePickColorFunc and gimp_image_pick_color_by_func(). Use + gimp_pickable_pick_color() instead. + + * app/core/gimpimage-contiguous-region.c + * app/core/gimpimage-crop.c + * app/gui/info-window.c + * app/paint/gimpconvolve.c + * app/paint/gimpsmudge.c + * app/tools/gimpbycolorselecttool.c + * app/tools/gimpimagemaptool.c + * app/widgets/gimpselectioneditor.c: use GimpPickable functions + instead of the various get_color_at() functions. Simplifies code + which has a "sample_merged" boolean. Various cleanups. + +2004-07-13 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/presets.c: Added underscores between + words in function names according to the GIMP's (and common + sense) convention. + +2004-07-13 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: Moved the global declarations of + img_has_alpha and create_colorpage to more specialized headers. + +2004-07-13 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/: Added the paper.h header for the functions + defined in the paper.c module. (thus removing more declarations + from gimpressionist.h) + +2004-07-13 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-preview.[ch} + * plug-ins/gfig/gfig.h: Made Cancel work properly. Moved "show grid", + "snap to grid", and "show image" checkbuttons back onto main + interface. Eliminated GtkPreview and removed undef of + GTK_DISABLE_DEPRECATED from gfig-preview.c. Removed some + unused code. + +2004-07-13 Sven Neumann <sven@gimp.org> + + * plug-ins/gflare/gflare.c (preview_handle_idle): use + gtk_widget_queue_draw_area() instead of the deprecated + gtk_widget_draw() routine. + + * plug-ins/gimpressionist/orientmap.c + * plug-ins/gimpressionist/paper.c + * plug-ins/gimpressionist/sizemap.c: use gtk_widget_queue_draw() + instead of the deprecated gtk_widget_draw() routine. + +2004-07-13 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/preview.c + * plug-ins/gimpressionist/sizemap.c: + eliminated two compile-time warnings. + +2004-07-13 Michael Natterer <mitch@gimp.org> + + Added a GimpProjection object which maintains the idle projection + logic that was in GimpDisplay and takes care of constructing the + projection even without any display open. Makes color picking and + other reads from the projection work without display and fixes the + major bug that we were constructing the projection n times (!) + for n displays. + + * app/core/Makefile.am + * app/core/gimpimage-projection.[ch]: removed. + + * app/core/core-types.h + * app/core/gimpmarshal.list + * app/core/gimparea.[ch] + * app/core/gimpprojection.[ch] + * app/core/gimpprojection-construct.[ch]: new files assembled from + the pieces of gimpdisplay.c and gimpimage-projection.c. + + * app/core/gimpimage.[ch]: create a GimpProjection. + Removed explicit projection realloc calls because the projection + connects to the relevant GimpImage signals now. + Added gimp_image_coords_in_active_drawable(). + + * app/display/Makefile.am + * app/display/gimpdisplay-area.[ch]: removed. + + * app/display/gimpdisplay.[ch]: stripped away the idle render stuff + and just keep a list of update_areas which is painted on flush(). + Removed gimp_display_coords_in_active_drawable(). + + * app/display/gimpdisplay-foreach.[ch]: removed + gimp_display_finish_draw(). + + * app/core/gimpchannel.c + * app/core/gimpimage-contiguous-region.c + * app/core/gimpimage-convert.c + * app/core/gimpimage-crop.c + * app/core/gimpimage-merge.c + * app/core/gimpimage-pick-color.c + * app/core/gimpimage-scale.c + * app/core/gimppalette-import.c + * app/display/gimpdisplay-handlers.c + * app/display/gimpdisplayshell-render.c + * app/display/gimpdisplayshell.c + * app/gui/info-window.c + * app/tools/gimpbucketfilltool.c + * app/tools/gimpbycolorselecttool.c + * app/tools/gimpclonetool.c + * app/tools/gimpcolortool.c + * app/tools/gimpeditselectiontool.c + * app/tools/gimpfliptool.c + * app/tools/gimpimagemaptool.c + * app/tools/gimpiscissorstool.c + * app/tools/gimppainttool.c + * app/tools/gimpselectiontool.c + * app/tools/gimptransformtool.c + * app/widgets/gimpselectioneditor.c: changed accordingly. + +2004-07-13 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppixmap.[ch]: declared GimpPixmap as deprecated. + + * libgimpwidgets/gimpwidgets.[ch]: ditto for gimp_pixmap_button_new(). + + * plug-ins/Lighting/ChangeLog: removed outdated and unused ChangeLog. + + * plug-ins/Lighting/Makefile.am + * plug-ins/Lighting/*.xpm: removed XPM files... + + * configure.in + * plug-ins/Lighting/images: ... and added them as PNG images here. + These should be redone with antialiased edges. + + * plug-ins/Lighting/lighting_stock.[ch] + * plug-ins/Lighting/lighting_ui.c: register stock icons and use + those instead of GimpPixmaps. + + * plug-ins/MapObject/Makefile.am + * plug-ins/MapObject/*.xpm: removed duplicated XPM files. + + * plug-ins/MapObject/mapobject_stock.[ch]: register stock icons + reusing the generated header from the Lighting plug-in. + + * plug-ins/MapObject/mapobject_ui.c: use them. + + * plug-ins/pagecurl/pagecurl.c: undef GIMP_DISABLE_DEPRECATED until + GimpPixmap has been replaced here as well. + +2004-07-13 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/presets.c: fixed bug #147483 (gimpressionist + will delete global presets if the user running GIMP has priviliges to + do so). This was done by creating a function to check if a preset is + global, and by making sure the delete button is in-sensitive when + this is the case. + +2004-07-13 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpcolorbutton.c + * libgimpwidgets/gimpcolornotebook.c + * libgimpwidgets/gimpcolorscale.c + * libgimpwidgets/gimpcolorscales.c + * libgimpwidgets/gimpcolorselect.c + * libgimpwidgets/gimpcolorselection.c + * libgimpwidgets/gimpframe.c + * libgimpwidgets/gimppickbutton.c + * libgimpwidgets/gimpunitmenu.c: some code review and cosmetics. + +2004-07-13 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/*.[ch]: normalized some of brush.c's + identifiers (= variable names and function name) + +2004-07-13 Sven Neumann <sven@gimp.org> + + * app/core/gimp-utils.c (gimp_g_value_get_memsize): handle NULL + string values. + +2004-07-13 Sven Neumann <sven@gimp.org> + + * plug-ins/common/jpeg.c: override the output_message error + handler in order to propagate warnings to the user interface + (related to bug #145212). + +2004-07-13 Sven Neumann <sven@gimp.org> + + * app/core/gimp-utils.[ch]: added new function + gimp_g_value_get_memsize() that attempts to calculate the memory + requirements for a GValue. + + * app/text/gimptextundo.c (gimp_text_undo_get_memsize): use the + new function to obtain a better estimate for the size of the text + undo. + +2004-07-13 Sven Neumann <sven@gimp.org> + + * app/tools/gimptexttool.c (gimp_text_tool_create_layer): plugged + a tiny memory leak. + +2004-07-13 Sven Neumann <sven@gimp.org> + + * app/core/gimpimage-undo.c: resurrected some bit-rotting debug + code. Might become useful one day. + +2004-07-13 Sven Neumann <sven@gimp.org> + + * autogen.sh: when automake 1.8 is being used, require at least + version 1.8.3. Earlier versions of the automake-1.8 series don't + handle gimp-console correctly. + +2004-07-13 Michael Natterer <mitch@gimp.org> + + * app/config/gimpconfig-dump.c + * app/display/gimpdisplayshell-title.c + (gimp_display_shell_format_title): applied patch from Dave Neary + which adds %B which expands to (modified) if the image is + dirty. Also added %A which expands to (clean) because we also have + a short indicator for the clean image. Fixes bug #130943. + +2004-07-13 Sven Neumann <sven@gimp.org> + + * app/Makefile.am: removed hack for gimp-console compilation. + automake seems to handle it correctly all by itself. + +2004-07-12 Michael Schumacher <schumaml@cvs.gnome.org> + + * app/app_procs.c: added + #ifdef G_OS_WIN32 + #include <windows.h> + #endif + +2004-07-12 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpbufferview.[ch]: added a preview of the global + buffer. + +2004-07-12 Sven Neumann <sven@gimp.org> + + * app/Makefile.am: make sure that gimp-console is enabled for + 'make dist'. Use it to dump the system gimprc and gimprc man-page. + +2004-07-12 Michael Natterer <mitch@gimp.org> + + * app/text/gimptextundo.[ch]: removed member "guint time"... + + * app/core/gimpundo.[ch]: ...and added it here. + + * app/tools/gimptexttool.c (gimp_text_tool_apply): changed + accordingly. Reordered undo compression code to look like other + pieces of code which do undo compression. + +2004-07-12 Michael Natterer <mitch@gimp.org> + + * app/core/gimpundo.[ch] + * app/core/gimpitemundo.[ch] + * app/text/gimptextundo.[ch]: removed all _new() functions and + added properties and GObject::constructor() implementations + instead. + + * app/core/gimpimage-undo.[ch] (gimp_image_undo_push): added + "GType undo_gtype" parameter and allow to pass name-value pairs as + "...". Use the new GParameter utility functions to construct the + appropriate undo step with g_object_newv(). + + (gimp_image_undo_push_item): removed. + + (gimp_image_undo_push_undo): removed. Merged its code back into + gimp_image_undo_push(), where it originally came from. + + * app/core/gimpimage-undo-push.c + * app/core/gimpundostack.c + * app/paint/gimppaintcore-undo.c + * app/tools/gimptransformtool-undo.c + * app/widgets/gimpundoeditor.c: changed accordingly. + +2004-07-12 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-preview.c + * plug-ins/gfig/gfig-style.c + * plug-ins/gfig/gfig.c: some include cleanups. Use + libgimpbase/gimpwin32-io.h instead of defining W_OK explicitely. + Don't undef GTK_DISABLE_DEPRECATED except for gfig-preview.c. + +2004-07-12 Michael Natterer <mitch@gimp.org> + + * plug-ins/script-fu/scripts/round-corners.scm: applied patch from + Dave Neary that changes the behavior from undo disable/enable to + using an undo group if the script doesn't work on a copy of the + image. Fixes bug #146344. + +2004-07-12 Michael Natterer <mitch@gimp.org> + + * menus/toolbox-menu.xml.in: applied patch from Brion Vibber + which adds <Toolbox>/Acquire/Paste as new. Fixes bug #147358. + +2004-07-12 Michael Natterer <mitch@gimp.org> + + * app/core/gimp-modules.c: don't do anything if gimp->no_interface + is TRUE. + +2004-07-12 Michael Natterer <mitch@gimp.org> + + Made the gimp-console binary compile. + Finishes core/GUI separation and fixes bug #71514: + + * configure.in: removed the crazy-hacker warning for + --enable-gimp-console. + + * app/Makefile.am: for gimp-console, copy app_procs.c to + app_procs_console.c and compile it instead of app_procs.c with + -DGIMP_CONSOLE_COMPILATION + + * app/app_procs.[ch]: added some #ifndef GIMP_CONSOLE_COMPILATION + to skip GUI stuff for the gimp-console case. + Renamed app_gui_libs_init() to app_libs_init(), renamed + app_gui_abort() to app_abort() and added app_exit() so everything + that needs #ifdefs lives here now. + + * app/main.c: changed accordingly. + + * app/gui/gui.c (gui_abort): really abort (call exit()). + +2004-07-12 Sven Neumann <sven@gimp.org> + + * INSTALL: made the suggestion to use binary packages more + prominent, mention --enable-gimp-console. + +2004-07-12 Sven Neumann <sven@gimp.org> + + * app/sanity.[ch]: removed the gtk+ sanity check here ... + + * app/gui/gui.c: ... and do it here from gui_libs_init(). + + * app/main.c: changed accordingly. + +2004-07-12 Sven Neumann <sven@gimp.org> + + * app/app_procs.s: don't use gtk_main() / gtk_main_quit() but run + our own main-loop like we already used to do when being run + non-interactively. + +2004-07-12 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdialogfactory.c + (gimp_dialog_factories_set_busy_foreach) + (gimp_dialog_factories_unset_busy_foreach): set/unset the busy + cursor on all windows which have widget->window, not only for + those which are GTK_WIDGET_VISIBLE. Fixes stale busy cursors when + dialogs are hidden while the busy cursor is active and later shown + again. + +2004-07-12 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplay.c: added an "id" CONSTRUCT_ONLY + property. Some minor cleanup. + +2004-07-12 Michael Natterer <mitch@gimp.org> + + * app/core/Makefile.am + * app/core/gimp-gui.[ch]: new files defining a GimpGui vtable + struct and contianing all the vtable wrapper functions. Reordered + and renamed some functions for consistency. + + * app/core/gimp.[ch]: removed all the vtable code. + + * app/gui/gui-vtable.c: changed accordingly. + +2004-07-12 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplay-foreach.c + (gimp_displays_get_dirty_images): remove images from the + container when they become clean. Should move to the Gimp object. + + * app/gui/quit-dialog.c: some cosmetic changes. + +2004-07-12 Sven Neumann <sven@gimp.org> + + * plug-ins/common/tiff.c: applied a patch from Brion Vibber that + sets the 'Save color values from transparent pixels' insensitive + when there's no alpha channel. + +2004-07-11 Hans Breuer <hans@breuer.org> + + * **/makefile.msc : updated + app/actions/makefile.msc app/menus/makefile.msc : (new files) + app/actions/Makefile.msc app/menus/Makefile.am : added to EXTRA_DIST + + * libgimpbase/gimputils.c libgimpwidgets/gimpmemsizeentry.c + app/widgets/gimppropwidgets.c : bumped compiler version check, + msvc6 still can't cast from unsigned __int64 to double + + * app/actions/debug-actions.c : only use debug_*_callback + and thus debug_action if ENABLE_DEBUG_MENU + + * app/core/gimpalette-import.c : added gimpwin32-io.h + + * plug-ins/common/convmatrix.c : s/snprintf/g_snprintf/ + + * plug-ins/common/screenshot.c : make it compile with msvc, + but still no win32 specific implementation ... + +2004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/gfig/gfig-dobject.h: fix commit error that + broke build. + +2004-07-11 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/gfig/gfig-dialog.c + * plug-ins/gfig/gfig-dobject.[ch] + * plug-ins/gfig/gfig.c: added buttons to select an object, and + raise or lower the selected object; also a few minor cleanups. + +2004-07-11 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/widgets/gimpdevices.c (gimp_devices_check_change): Applied a + patch from Robert Ögren, moved here from toolbox_check_device(). + Only change devices if the event came from a widget that accepts + extension events. Fixes bug #115774. + +2004-07-11 Michael Natterer <mitch@gimp.org> + + * app/core/gimp-utils.[ch] (gimp_parameters_append) + (gimp_parameters_append_valist) + (gimp_parameters_free): new utility functions which create and + destroy GParameter arrays for g_object_newv(). + + * app/gui/gui-vtable.c (gui_pdb_dialog_new): use them. + +2004-07-10 Michael Natterer <mitch@gimp.org> + + Removed any remaining GUI dependency from the PDB wrappers: + + * app/core/gimp.[ch]: added vtable entries for the display and + help stuff. + + * app/widgets/gimphelp.[ch]: renamed gimp_help() to + gimp_help_show(). + + * app/gui/gui-vtable.c: implement the new display and help vtable + entries. + + * tools/pdbgen/pdb.pl + * tools/pdbgen/pdb/display.pdb + * tools/pdbgen/pdb/help.pdb: use the new functions of the Gimp + object instead of using stuff from display/ and widgets/. + + * tools/pdbgen/app.pl: removed bad hacks which enabled including + stuff from gui/, display/ and widgets/. + + * app/Makefile.am: link widgets-enums.o, display-enums.o and + gimpdisplayoptions.o into the gimp-console binary because they are + needed for the config system and don't depend on any GUI stuff. + + * app/pdb/Makefile.am: s/GTK_CFLAGS/GDK_PIXBUF_CFLAGS/ + + * app/pdb/display_cmds.c + * app/pdb/help_cmds.c: regenerated. + +2004-07-10 Sven Neumann <sven@gimp.org> + + * app/gui/quit-dialog.c (quit_dialog_new): let the labels line-wrap. + +2004-07-10 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplay-foreach.[ch]: added new function + gimp_displays_get_dirty_images(). + + * app/gui/quit-dialog.c: show a container treeview of all dirty + images in the quit dialog. Still work in progress... + +2004-07-09 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * gimp/plug-ins/gfig/gfig-circle.c + * gimp/plug-ins/gfig/gfig-dialog.c + * gimp/plug-ins/gfig/gfig-dobject.c + * gimp/plug-ins/gfig/gfig-ellipse.c + * gimp/plug-ins/gfig/gfig-poly.c + * gimp/plug-ins/gfig/gfig-preview.c + * gimp/plug-ins/gfig/gfig-star.c + * gimp/plug-ins/gfig/gfig-style.c + * gimp/plug-ins/gfig/gfig-style.h + * gimp/plug-ins/gfig/gfig.c + * gimp/plug-ins/gfig/gfig.h: Made FG, BG, and pattern fill work for + fillable objects; other miscellaneous cleanups and minor fixes. + +2004-07-09 Sven Neumann <sven@gimp.org> + + * app/gui/gui.c: removed the quit dialog code here. + + * app/gui/Makefile.am + * app/gui/quit-dialog.[ch]: added new files that hold the old code + for now. + +2004-07-09 Michael Natterer <mitch@gimp.org> + + * app/pdb/procedural_db.c: #include <glib-object.h> instead of + <gtk/gtk.h>. + +2004-07-09 Michael Natterer <mitch@gimp.org> + + * app/gui/Makefile.am + * app/gui/brush-select.[ch] + * app/gui/font-select.[ch] + * app/gui/gradient-select.[ch] + * app/gui/palette-select.[ch] + * app/gui/pattern-select.[ch]: removed... + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimppdbdialog.[ch] + * app/widgets/gimpdataselect.[ch] + * app/widgets/gimpbrushselect.[ch] + * app/widgets/gimpgradientselect.[ch] + * app/widgets/gimppaletteselect.[ch] + * app/widgets/gimppatternselect.[ch] + * app/widgets/gimpfontselect.[ch]: ...and added here as a + hierarchy of widgets. + + * app/widgets/gimpdatafactoryview.h: removed typdef + GimpDataEditFunc, it's in widgets-types.h now. + + * app/gui/convert-dialog.c: changed accordingly. + + * app/core/gimp.[ch]: added vtable entries for creating, closing + and setting PDB dialogs. + + * app/gui/gui-vtable.c: implement the vtable entries using the new + widgets. + + * tools/pdbgen/pdb/brush_select.pdb + * tools/pdbgen/pdb/font_select.pdb + * tools/pdbgen/pdb/gradient_select.pdb + * tools/pdbgen/pdb/palette_select.pdb + * tools/pdbgen/pdb/pattern_select.pdb: use the new functions of + the Gimp object to create / manage the selection dialogs. The + generated files don't depend on GUI stuff any longer. + + * app/pdb/brush_select_cmds.c + * app/pdb/font_select_cmds.c + * app/pdb/gradient_select_cmds.c + * app/pdb/palette_select_cmds.c + * app/pdb/pattern_select_cmds.c: regenerated. + +2004-07-09 Sven Neumann <sven@gimp.org> + + * app/gui/file-save-dialog.c (file_save_overwrite): improved text + of the dialog. + +2004-07-09 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpdialog.c (gimp_dialog_class_init): document + that "help-func" and "help-id" properties have been added for 2.2. + +2004-07-09 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphistogrameditor.c + (gimp_histogram_editor_menu_update): reverted my last change. + (gimp_histogram_editor_item_visible): fix the problem here instead. + +2004-07-08 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpdialog.c: removed "role" property because + GtkWindow has an equivalent property now. Added "help-func" and + "help-id" construct properties. + + * app/widgets/gimptexteditor.c + * app/widgets/gimptooldialog.c + * app/widgets/gimpviewabledialog.c: removed calls to + gimp_help_connect() and pass help_func and help_id to + g_object_new(). + +2004-07-08 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimphelpui.c (gimp_context_help): fixed typo in + API docs. + +2004-07-08 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist/Presets: converted the newlines in the + descriptions to whitespaces, so they'll simply wrap (in accordance + with making the description label wrappable). + +2004-07-08 Shlomi Fish <shlomif@iglu.org.il> + + * plug-ins/gimpressionist: Various Gimpressionist Cleanups. Made most + remaining non-static global variables static, and created functions + that manipulate them. Created new headers. Renamed some variables and + functions to make their names more menanigful. + +2004-07-08 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphistogrameditor.c + (gimp_histogram_editor_menu_update): set the active item of the + combo-box after changing the visibility filter. + +2004-07-08 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimppropwidgets.c (gimp_prop_boolean_combo_box_notify): + same fix as below. + +2004-07-08 Sven Neumann <sven@gimp.org> + + * app/widgets/gimppropwidgets.c (gimp_prop_enum_combo_box_notify): + block gimp_prop_enum_combo_box_callback() before changing the + combo-box. + +2004-07-08 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpsessioninfo.c: only write aux-info for properties + that have been changed from their default values. + + * app/widgets/gimphistogrameditor.c: some code cleanup. + +2004-07-08 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpselectiondata.[ch]: added a "const gchar *format" + parameter to gimp_selection_data_set_pixbuf() which selects the + format in which to encode the pixbuf (was defaulting to "png" + before). + + * app/widgets/gimpclipboard.c: when copying, offer all formats which + are savable with GdkPixbuf. Added a GimpClipboard struct which is + attached to the Gimp and which stores all the persistent data + needed by the clipboard. Renamed some private functions. + + (unfortunately this change breaks pasting to AbiWord: + http://bugzilla.abisource.com/show_bug.cgi?id=7068) + +2004-07-08 Sven Neumann <sven@gimp.org> + * app/config/gimpconfig-deserialize.c + * app/config/gimpconfig-serialize.c: removed redundant casts. + + * app/widgets/gimpsessioninfo.[ch]: added convenience functions to + get and set aux-info based on object properties. + + * app/widgets/gimphistogrameditor.c: use the new functions to save + a histogram's channel and scale in the sessionrc. + +2004-07-07 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpclipboard.c: sort the list of pixbuf formats so + that PNG is the preferred format and GIF and JPEG come last. + +2004-07-07 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/gfig/*.[ch]: Use single centralized functions to + create, load, and save objects, instead of separate functions + for each type of object. A few other miscellaneous fixes. + +2004-07-07 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpclipboard.[ch]: changed to allow pasting any + GdkPixbuf supported format (makes pasting from OpenOffice + work). Cleaned up a bit to perpare pasting of SVG data. + +2004-07-07 Sven Neumann <sven@gimp.org> + + * app/core/gimplayer.c (gimp_layer_new_from_tiles): add an alpha + channel if the src tile-manager doesn't have one. Warn on + unsupported type conversions instead of silently doing the wrong + thing. Fixes bug #145482. + + * app/core/gimpbuffer.c: cosmetics. + +2004-07-07 Michael Natterer <mitch@gimp.org> + + * app/gui/Makefile.am + * app/gui/clipboard.[ch]: removed... + + * app/widgets/Makefile.am + * app/widgets/gimpclipboard.[ch]: ...and added here. + + * app/actions/edit-commands.c + * app/gui/gui.c: changed accordingly. + +2004-07-07 Michael Natterer <mitch@gimp.org> + + Made the undo system robust against the currently pushed undo + being too large according to prefs settings. Fixes bug #145379. + + * app/core/gimpimage-undo.[ch] (gimp_image_undo_push_undo) + (gimp_image_undo_group_end): emit "undo-event" *before* calling + gimp_image_undo_free_space() so the undo history doesn't try to + remove an item that has never been added. + + (gimp_image_undo_push_undo): added boolean return value indicating + if the undo could be pushed (FALSE means the undo was to large + and was discarded right away). + + (gimp_image_undo_push_item): return NULL if the above returned + FALSE. + + * app/core/gimpimage-undo-push.c (gimp_image_undo_push_text_layer): + changed accordingly. + +2004-07-07 Manish Singh <yosh@gimp.org> + + * plug-ins/common/jpeg.c: Don't try to load EXIF data if any warnings + happened, cause that likely means corruption and libexif doesn't + handle that very happily. Addresses bug #145212. Perhaps the error and + warning messages should be propagated to the user in the GUI somehow, + currently they are not. + +2004-07-07 Michael Natterer <mitch@gimp.org> + + * app/actions/edit-actions.c (edit_actions): added "..." to "Clear + undo history" because it has a confirmation dialog. + + * app/actions/edit-commands.c: cleanup: moved static functions to + the end of the file and prototyped them. + +2004-07-07 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphistogramview.c (gimp_histogram_view_expose): + fixed a drawing bug I introduced earlier today. + +2004-07-07 Michael Natterer <mitch@gimp.org> + + * app/actions/view-actions.c + * app/actions/view-commands.[ch]: added actions and callbacks for + scrolling the view. Not used in menus but useful for controllers. + +2004-07-07 Sven Neumann <sven@gimp.org> + + * app/tools/gimpeditselectiontool.c + (gimp_edit_selection_tool_key_press): adapt the arrow key velocity + to the display scale factor. Please test and complain if you + dislike this behaviour. + + * themes/Default/images/Makefile.am + * themes/Default/images/stock-color-pick-from-screen-16.png: new + icon drawn by Jimmac. + + * libgimpwidgets/gimpstock.[ch]: register the new icon. + + * libgimpwidgets/gimppickbutton.c: use it for the screen color + picker instead of reusing the color picker tool icon. + +2004-07-06 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/gfig/*.[ch]: a bunch of code clean-up and + debugging. Created "classes" for the objects, and + attached functions to classes rather than objects. + +2004-07-06 Sven Neumann <sven@gimp.org> + + Added an RGB histogram based on a patch by Tor Lillqvist. Fixes + bug #145401. + + * app/base/base-enums.[ch]: added GIMP_HISTOGRAM_RGB, don't export + it to the PDB. + + * app/base/gimphistogram.c: implemented histogram functions for + the RGB mode. + + * app/base/levels.c + * app/tools/gimpcurvestool.c + * app/tools/gimplevelstool.c + * app/widgets/gimpcolorbar.c + * app/widgets/gimphistogrameditor.c: handle the new enum value. + + * app/widgets/gimphistogramview.c: for GIMP_HISTOGRAM_RGB mode, + draw a histogram that shows the RGB channels simultaneously + +2004-07-06 Sven Neumann <sven@gimp.org> + + * libgimpmodule/gimpmodule.c: comply with C99 aliasing rules. + +2004-07-06 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpwidgets-utils.c (gimp_menu_position) + (gimp_button_menu_position): call gtk_menu_set_monitor() only + for GTK+ < 2.4.4 and added a #warning about it. + +2004-07-06 Sven Neumann <sven@gimp.org> + + * plug-ins/gimpressionist: applied patch from Shlomi Fish that + fixes confusion of filenames and user-visible object names (bug + #132621). Also removed function remove_trailing_whitespace() that + used to duplicate functionality from GLib and updated + preset_create_filename(). + +2004-07-06 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimppreviewrenderer.c + (gimp_preview_renderer_set_viewable): queue an idle update when + setting the viewable to NULL so the view gets cleared correctly. + + (gimp_preview_renderer_idle_update): call + gimp_preview_renderer_update() even if renderer->viewable is NULL + so clearing the viewable gets propagated to the GUI. + + Moved clearing the viewable and removing the idle from + GObject::finalize() to GObject::dispose() because calling + set_viewable() with a NULL viewable triggers typechecking casts + and queuing idle functions, which is not nice in finalize(). + +2004-07-06 Sven Neumann <sven@gimp.org> + + * modules/Makefile.am (libcdisplay_proof_la_LIBADD): added back + $(LCMS_LIBS) that I had accidentally removed. + +2004-07-06 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpvectorstreeview.c (gimp_vectors_tree_view_drag_svg): + return the proper type. + +2004-07-06 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainertreeview.c: connect to + "editing-canceled" of the name cell renderer and restore the + original text in the callback. Doesn't work reliably until GTK+ + bug #145463 is fixed. + +2004-07-05 Sven Neumann <sven@gimp.org> + + * app/plug-in/plug-in-rc.c (plug_in_icon_deserialize): fixed a + compiler warning. + + * plug-ins/common/dog.c: removed some redundant casts and other + trivial cleanups. + +2004-07-06 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcontroller.h: removed #define + GIMP_CONTROLLER_PARAM_SERIALIZE. + + * libgimpmodule/gimpmoduletypes.h: added + GIMP_MODULE_PARAM_SERIALIZE instead. + + * modules/controller_linux_input.c + * modules/controller_midi.c: changed accordingly. + + * modules/cdisplay_colorblind.c + * modules/cdisplay_gamma.c + * modules/cdisplay_highcontrast.c + * modules/cdisplay_proof.c: made the new properties serializable. + +2004-07-05 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/Makefile.am (enum_headers): don't scan + app/paint-funcs/paint-funcs-types.h for enums. + + * app/paint-funcs/paint-funcs-types.h: removed /*< pdb-skip >*/ + + * app/core/core-types.h: reordered opaque typedefs to somehow + match the categories in the comments. + +2004-07-05 Michael Natterer <mitch@gimp.org> + + * app/core/core-types.h: removed enum SizeType. + + * app/text/text-enums.h: added it as enum GimpSizeType and added + comment that it's for backward compatibility only. + + * tools/pdbgen/Makefile.am + * tools/pdbgen/pdb/text_tool.pdb: changed accordingly. + + * libgimp/gimpenums.h + * plug-ins/pygimp/gimpenums.py + * plug-ins/script-fu/script-fu-constants.c + * tools/pdbgen/enums.pl: regenerated (pdbgen insisted on + reordering the enums). + +2004-07-05 Michael Natterer <mitch@gimp.org> + + * app/core/core-types.h: #define MIN and MAX values for + GimpCoords.pressure, .tilt and .wheel. + + * app/display/gimpdisplayshell-callbacks.c + (gimp_display_shell_get_event_coords) + (gimp_display_shell_get_device_coords): use the #defines instead + of hardcoded magic values when CLAMP()ing event or device values. + +2004-07-05 Sven Neumann <sven@gimp.org> + + * modules/Makefile.am: link all modules with libgimpmodule. + +2004-07-05 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/dog.c: improved defaults. use gimp_invert() + instead of rolling own. Use nasty hack to get previews to + work with grayscale images. Accept grayscale images. + +2004-07-05 Sven Neumann <sven@gimp.org> + + * app/core/gimpdata.[ch] (gimp_data_create_filename): Removed the + basename parameter and use the object name instead. Convert it to + the filesystem encoding. + + * app/core/gimpdatafactory.c: changed accordingly. + +2004-07-05 Sven Neumann <sven@gimp.org> + + * plug-ins/gimpressionist: applied patch from Shlomi Fish that + fixes a number of bugs in the gimpressionst plug-in (bug #145309). + + Also added some const qualifiers, cleaned up includes and removed + degtorad() and radtodeg() functions that used to duplicate + functionality from libgimpmath. + +2004-07-05 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimptemplateview.c + (gimp_template_view_tree_name_edited): removed unused local variables. + +2004-07-05 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig-dialog.c: don't g_free() a GdkPixbuf, it's an + object. Removed trailing whitespace. + + * plug-ins/gfig/gfig-preview.c (draw_background): fixed declaration. + +2004-07-05 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpcolorizetool.c (gimp_colorize_tool_initialize): + return TRUE if initialization was successful. Makes the + tool->drawable pointer being set correctly by the calling code and + fixes bugs where colorize was leaving the drawable in a modified + but non-undoable state when cancelling or changing images. + +2004-07-05 Sven Neumann <sven@gimp.org> + + * modules/cdisplay_proof.c: use object properties for the + configurable values. + +2004-07-05 Michael Natterer <mitch@gimp.org> + + * app/core/gimpchannel.[ch]: added signal "color-changed" and emit + it in gimp_channel_set_color() and gimp_channel_set_opacity(). + + * app/core/gimpimage-qmask.[ch]: added new functions + gimp_image_set,get_qmask_color(). + + * app/core/gimpimage.[ch]: install a "color-changed" handler on + gimage->channels and update gimage->qmask_color when the qmask's + color changes. Fixes bug #145361. + + * app/actions/qmask-commands.c: use the new qmask color API. + +2004-07-04 Simon Budig <simon@gimp.org> + + * app/actions/dialogs-commands.c + * app/display/gimpdisplayshell-dnd.c + * app/gui/preferences-dialog.c + * app/tools/gimppainttool.c + * app/widgets/gimpdeviceinfo.c + * app/widgets/gimpitemtreeview.c + * plug-ins/imagemap/imap_selection.c + * tools/pdbgen/pdb/gradients.pdb: Small changes to make GIMP + CVS compile with gcc 2.95 again. Mostly double semicolons and + variable declarations after other stuff. Spotted by Martin + Renold. + + * app/pdb/gradients_cmds.c: regenerated. + + (there is one issue left, see his patch at + http://old.homeip.net/martin/gcc-2.95.diff, I did not + copy the #define va_copy __va_copy, since I don't know + what happens here.) + +2004-07-04 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/gfig/gfig-dialog.[ch]: + * plug-ins/gfig/gfig-style.[ch]: + * plug-ins/gfig/notes.txt: New files. + * plug-ins/gfig/*.[ch]: Complete reworking of the gfig plug-in. + See 'notes.txt' for a summary of what has changed, and how to use + it now. Plenty of bugs have been introduced, which will take a + while to straighten out. + +2004-07-04 Tor Lillqvist <tml@iki.fi> + + * app/core/gimpdrawable-equalize.c (gimp_drawable_equalize): Drop + a couple of unused variables. + + * libgimpmodule/gimpmodule.def: Add gimp_module_register_enum. + +2004-07-04 Sven Neumann <sven@gimp.org> + + * libgimpmodule/gimpmodule.[ch]: added gimp_module_register_enum(), + a function to register an enum type for a GTypeModule. + + * modules/cdisplay_colorblind.c: use an object property for the + color deficiency enum. + +2004-07-04 Sven Neumann <sven@gimp.org> + + * plug-ins/common/channel_mixer.c: don't attempt to store a + pointer to the last used filename in the plug-in parameter + struct. Fixes bug #145380. + +2004-07-04 Sven Neumann <sven@gimp.org> + + * modules/cdisplay_gamma.c + * modules/cdisplay_highcontrast.c: added object properties for + configurable values. + + * app/widgets/gimpcolordisplayeditor.c + * libgimpwidgets/gimpcolordisplaystack.c + * modules/cdisplay_colorblind.c + * modules/cdisplay_proof.c: cosmetic changes. + +2004-07-03 Michael Natterer <mitch@gimp.org> + + * app/core/gimpcontext.[ch]: added context->serialize_props mask + which enables specifying exactly which properties will be + serialized. Also fixes a bug that prevented undefined properties + from being serialized, breaking tool_options and device status + serialization. + + * app/core/gimptoolinfo.c (gimp_tool_info_new): make only the + properties in the tool_info->context_props mask serializable, also + configure/initialize tool_info->tool_options. + + * app/tools/gimp-tools.c (gimp_tools_register): removed + tool_options initialization that is now done in + gimp_tool_info_new(). + + * app/widgets/gimpdeviceinfo.c: make only the properties in + GIMP_DEVICE_INFO_CONTEXT_MASK serializable. + + * app/widgets/gimpdevicestatus.c: add the device table to its + parent container again. Fixes "missing" devices. + + * app/core/gimptooloptions.c + * app/widgets/gimpdevices.c: cleanup / code review. + +2004-07-03 Michael Natterer <mitch@gimp.org> + + * app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): if + the color tool is enabled, skip cursor hiding entirely. + +2004-07-03 Sven Neumann <sven@gimp.org> + + * plug-ins/common/dog.c (dog): removed #ifdef'ed code that isn't + any longer needed. + +2004-07-02 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/tools/gimptransformoptions.[ch]: + * app/tools/gimptransformtool.c: + * app/tools/tools-enums.[ch]: Replaced "Preview" checkbutton with + a combobox with options "Outline", "Grid", "Image", and + "Image + Grid". Addresses bug #108172. + +2004-07-02 Sven Neumann <sven@gimp.org> + + * app/actions/edit-actions.c: don't let the Paste menu items + sensitivity depend on the availability of clipboard data because + we aren't notified when the GDK clipboard changes. + +2004-07-02 Sven Neumann <sven@gimp.org> + + * app/gui/Makefile.am + * app/gui/clipboard.[ch]: new files implementing a clipboard for + image data based on GDK_SELECTION_CLIPBOARD (bug #133247). + + * app/actions/edit-actions.c + * app/actions/edit-commands.c: use the new clipboard API. + + * app/gui/gui.c: initialize and shutdown the clipboard. + + * app/core/gimpbuffer.c: cosmetics. + + * app/actions/actions.c + * app/menus/menus.c: added sanity checks to exit functions. + + * app/display/gimpdisplayshell-dnd.[ch]: let + gimp_display_shell_drop_svg() take a guchar * buffer. + + * app/widgets/gimpselectiondata.c (gimp_selection_data_get_pixbuf): + fixed the implementation. + +2004-07-02 Michael Natterer <mitch@gimp.org> + + * plug-ins/gimpressionist/Makefile.am + * plug-ins/gimpressionist/*.[ch]: applied patch from Shlomi Fish + that massively cleans up gimppressionist (touching all files and + addding some new ones) and adds a simple PDB interface for + selecting one of the previously created presets. + Fixes bugs #145191, #144913 and #144922. + +2004-07-01 Sven Neumann <sven@gimp.org> + + * configure.in: bumped version number to 2.1.2. + +2004-07-01 Michael Schumacher <schumaml@cvs.gnome.org> + + * plug-ins/common/align_layers.c: there seems to be no reason why + this plug-in should not work on INDEXED* images, added it to the + registered image types + +2004-07-01 Roman Joost <roman@bromeco.de> + + * plug-ins/script-fu/scripts/blend-anim.scm + * plug-ins/script-fu/scripts/glossy.scm + * plug-ins/script-fu/scripts/test-sphere.scm: fixed typos + +2004-07-01 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpselectiondata.[ch]: added (yet unused) functions + gimp_selection_data_[get|set]_pixbuf(). + +2004-07-01 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpfgbgarea.[ch]: implement GtkWidget::drag_motion() + and set the FG/BG depending on where the color was dropped. Also + set the drag status accordingly so the cursor indicates whether + dropping will have an effect or not. Fixes bug #145219. + +2004-07-01 Sven Neumann <sven@gimp.org> + + * app/core/gimptemplate.c: do like Liam taught us and use the + golden ratio as default for new images. + +2004-06-30 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/tools/gimppainttool.c (gimp_paint_tool_cursor_update): + Chain up if the color tool is enabled. This fixes the problem of + the color picker cursor not appearing when using a paint tool + in color picking mode while "Show Paint Tool Cursor" is off. + +2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * libgimp/gimpdrawable.c: moved call to + _gimp_tile_cache_flush_drawable() from gimp_drawable_detach() to + gimp_drawable_flush(), to resolve problem described in bug + #145051. + +2004-06-30 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-ins.[ch] (plug_ins_init): added a GimpContext + parameter and use it to start plug-ins. + + * app/core/gimp.c (gimp_real_restore): pass the user context. + Restores script-fu's access to the global FG, FG, brush, ... + +2004-06-30 Sven Neumann <sven@gimp.org> + + * app/core/core-enums.c + * app/display/display-enums.c + * app/paint/paint-enums.c + * app/text/text-enums.c + * app/widgets/widgets-enums.c: regenerated. + +2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/actions/file-commands.c: revert previous change that was + intended to fix bug #141971. + +2004-06-30 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/*/*-enums.h: did HIG-compliant capitalization in the right + place, instead of the auto-generated *-enums.c files. + +2004-06-30 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdnd.[ch] + * app/widgets/gimpselectiondata.[ch] + * app/widgets/gimpcontainertreeview.[ch]: changed "files" and "uris" + to "uri_list" in all function names, parameters and typedefs. + + * app/widgets/gimpcontainertreeview-dnd.c + * app/widgets/gimpdocumentview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimptoolbox-dnd.c + * app/display/gimpdisplayshell-dnd.[ch] + * app/display/gimpdisplayshell.c: changed accordingly. + +2004-06-30 Sven Neumann <sven@gimp.org> + + * plug-ins/maze/maze_face.c: made the dialog look a little less + clumsy. + +2004-06-30 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/drawable.pdb + * libgimp/gimppixbuf.c: raised the maximum size for thumbnails + from 256 to 512 pixels. + + * app/pdb/drawable_cmds.c + * libgimp/gimpdrawable_pdb.c: regenerated. + + * plug-ins/gfig/gfig-preview.c + * plug-ins/gfig/gfig.c: redone Bill's fix using + gimp_image_get_thumbnail(). A lot simpler, renders the alpha + checkerboard and also works for grayscale images. + +2004-06-30 Michael Natterer <mitch@gimp.org> + + Fixed a 1.2 -> 2.0 regression that was forgotten: + + * app/widgets/widgets-enums.[ch]: added enum GimpColorPickState + which can be one of { NEW, UPDATE }. + + * app/widgets/gimppaletteeditor.[ch]: changed #if 0'ed function + gimp_palette_editor_update_color() to + gimp_palette_editor_pick_color() and restored the functionality of + creating/updating colors via this API + + Changed button_press handler to only edit the color on double + click if it's really a double click on the same color. + Fixes bug #141381. + + * app/tools/gimpcolorpickeroptions.[ch]: added boolean property + "add-to-palette" and a GUI for it. + + * app/core/gimpmarshal.list + * app/tools/gimpcolortool.[ch]: added a GimpColorPickState + parameter to the "color_picked" signal. Pass NEW on button_press + and UPDATE on motion. + + * app/tools/gimpcurvestool.c (gimp_curves_tool_color_picked) + * app/tools/gimplevelstool.c (gimp_levels_tool_color_picked) + * app/tools/gimppainttool.c (gimp_paint_tool_color_picked): + changed accordingly + + * app/tools/gimpcolorpickertool.c (gimp_color_picker_tool_picked): + If "add-to-palette" is TRUE, get the palette editor and call + gimp_palette_editor_pick_color(). + +2004-06-30 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpselectiondata.[ch]: renamed the SVG related + functions so that they deal with an anonymous data stream that + could as well be a PNG image. + + * app/widgets/gimpdnd.[ch] + * app/widgets/gimpcontainertreeview-dnd.c: changed accordingly. + + * app/display/gimpdisplayshell-dnd.[ch] + * app/vectors/gimpvectors-import.[ch] + * app/widgets/gimpcontainertreeview-dnd.c + * app/widgets/gimpvectorstreeview.c: use gsize for the length of + the buffer. + + * app/widgets/gimpdnd.[ch] + * app/widgets/widgets-enums.[ch]: added GIMP_DND_TYPE_PNG which isn't + used yet. + +2004-06-30 Michael Natterer <mitch@gimp.org> + + * app/core/gimppalette.[ch] (gimp_palette_add_entry): take + const GimpRGB* instead of just GimpRGB*. + Converted tabs to spaces. + +2004-06-30 Michael Natterer <mitch@gimp.org> + + * widgets/gimpselectiondata.[ch] (gimp_selection_data_get_svg): + changed return value from gchar* to const gchar*. Renamed + parameters to be consistent with other SVG functions. + + * widgets/gimpcontainertreeview-dnd.c + * widgets/gimpdnd.c: changed accordingly. + +2004-06-30 Simon Budig <simon@gimp.org> + + * app/vectors/gimpstroke.[ch] + * tools/pdbgen/pdb/paths.pdb: Applied a modified patch from + Geert Jordaens that implements the gimp-path-get-point-at-dist + PDB function (fixes bug #138754). + + * app/pdb/paths_cmds.c: regenerated. + +2004-06-30 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimptoolbox.c (gimp_toolbox_button_accel_changed): + do like GtkAccelLabel does and turn underscores in accels into + spaces so e.g. "Page_Up" becomes "Page Up". + +2004-06-29 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell.c: reordered drop destinations + so vectors are preferred over SVG. + + * app/vectors/gimpvectors-import.[ch]: added "gint position" + parameter to all import functions so the imported vectors can be + added at any position in the vectors stack. + + * app/actions/vectors-commands.c + * app/display/gimpdisplayshell-dnd.c + * tools/pdbgen/pdb/paths.pdb: changed accordingly (pass -1 as + position). + + * app/pdb/paths_cmds.c: regenerated. + + * app/widgets/gimpvectorstreeview.c: implemented SVG DND from and + to the paths dialog. + +2004-06-29 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainertreeview-dnd.c: don't free the SVG data + after dropping, it's owned by GtkSelectionData. + +2004-06-29 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdnd.c: use gtk_target_list_add() instead of + gtk_target_list_add_table() because the latter prepends the + targets to the internal list which screws the order (== priority) + of DND targets. + + * app/widgets/gimpselectiondata.c: added some more checks for + failed drops (selection_data->length < 0). + +2004-06-29 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/unsharp.c: The preview's row buffer was + accidentally made way too large. + +2004-06-29 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpwidgets-utils.[ch]: added new function + gimp_get_mod_string() which takes a GdkModifierType and returns + correctly formated strings for all shift,control,alt combinations. + + * app/tools/gimpbucketfilloptions.c + * app/tools/gimpcolorpickeroptions.c + * app/tools/gimpconvolvetool.c + * app/tools/gimpcropoptions.c + * app/tools/gimpdodgeburntool.c + * app/tools/gimperasertool.c + * app/tools/gimpflipoptions.c + * app/tools/gimpmagnifyoptions.c + * app/tools/gimpmoveoptions.c + * app/tools/gimptransformoptions.c + * app/tools/gimpvectoroptions.c + * app/widgets/gimpchanneltreeview.c + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimpdocumentview.c + * app/widgets/gimperrorconsole.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimppaletteeditor.c + * app/widgets/gimpselectioneditor.c + * app/widgets/gimpthumbbox.c + * app/widgets/gimptooloptionseditor.c + * app/widgets/gimpvectorstreeview.c: use the new function instead + of gimp_get_mod_name_shift(),control(),alt(),separator(). This + kindof addresses the issue of configurable modifier keys but is + actually indended to ease translation of format strings ("%s" is + easier to get right than "%s%s%s"). + +2004-06-28 Michael Natterer <mitch@gimp.org> + + Allow all sorts of things to be dropped on or in between the + items of a GimpContainerTreeView: + + * app/widgets/gimpcontainertreeview.[ch]: added more parameters to + GimpContainerTreeView::drop_possible() to specify where ecactly + the drop should take place (between or into items) and to support + dropping all sorts of things. + + Renamed ::drop() to ::drop_viewable() and added ::drop_color(), + ::drop_files() and ::drop_svg(), which cover all possible drop + types. + + * app/widgets/gimpcontainertreeview-dnd.[ch]: changed accordingly. + Dispatch all kinds of drops to the resp. virtual functions. + + * app/widgets/gimpitemtreeview.c: changed accordingly. + + * app/widgets/gimplayertreeview.c: allow to drop URIs, colors + and patterns to the layers dialog. Fixes bugs #119506 and #139246. + +2004-06-28 Michael Natterer <mitch@gimp.org> + + * app/file/file-open.[ch] (file_open_layer): new utility function + which opens an image, flattens it if needed and returns the only + layer, converted for a passed destination image. + + * app/display/gimpdisplayshell-dnd.c + (gimp_display_shell_drop_files): use the new function. + +2004-06-28 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/gimpselectiondata.[ch]: new files containing the + code which encodes/decodes all sorts of stuff to/from its + GtkSelectionData representation. Used to live in gimpdnd.c + + * app/widgets/gimpdnd.c: use the new functions (unclutters the + file quite a bit), converted tabs to spaces. + +2004-06-28 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainergridview.c: + #include "libgimpwidgets/gimpwidgets.h" + +2004-06-28 Michael Natterer <mitch@gimp.org> + + Fixed bug #141930 while keeping bug #132322 fixed: + + * app/base/curves.c (curves_lut_func) + * app/base/levels.c (levels_lut_func): changed meaning of channel + slots for GRAYA images: just as for GRAY images, expect the value + channel in slot 0 and the alpha channel in slot 1, so it matches + the meaning of slots of GimpHistogram (before this change, only + GRAY images had their value in slot 0 and GRAYA images had it in + slot 1, whereas the histogram had the value channel in slot 0, + which was breaking auto levels for GRAYA images). + + * app/tools/gimpcurvestool.c + * app/tools/gimplevelstool.c + * tools/pdbgen/pdb/color.pdb: adjusted channel fiddling for GRAY + and GRAYA images accordingly. + + * app/tools/gimpcurvestool.c (curves_update) + * app/tools/gimplevelstool.c (levels_update): call + gimp_color_bar_set_buffers() with the right buffers. + + * app/pdb/color_cmds.c: regenerated. + +2004-06-28 Sven Neumann <sven@gimp.org> + + * app/gui/gui.c (gui_initialize_after_callback): select the + standard tool. + + * app/tools/tool_manager.c: cosmetics. + +2004-06-28 Michael Natterer <mitch@gimp.org> + + * app/tools/gimplevelstool.c: reverted fix for bug #141930. These + hacks are there because the enum used in levels doesn't match + the enum used by the combo box and the histogram widget. + +2004-06-28 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpclonetool.c (gimp_clone_tool_button_release): + removed again (tools must not draw outside GimpDrawTool::draw()). + + (gimp_clone_tool_draw): removed check for gimp_draw_tool_is_active() + because the draw function would not be called if the draw tool was + inactive. Simplified check for whether or not to draw the src + location. + + * app/tools/gimppainttool.c (gimp_paint_tool_button_release): + pause/resume the draw tool across all button_release actions so + tools (clone) have a chance to draw different things depending on + gimp_tool_control_is_active(tool->control). Fixes bug #145022. + +2004-06-28 Sven Neumann <sven@gimp.org> + + * app/actions/actions.c (action_select_object): added missing + return value. + +2004-06-28 Sven Neumann <sven@gimp.org> + + * plug-ins/common/dog.c: applied HIG rules to the GUI and slightly + rearranged it to get a more compact layout. Applied GIMP coding + style. + +2004-06-28 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawable.c: removed wrong note about using + _gimp_tile_cache_flush_drawable() from the API docs. + +2004-06-28 Sven Neumann <sven@gimp.org> + + * plug-ins/common/dog.c (dog): ifdef'ed out calls to + _gimp_tile_cache_flush_drawable() since it can't be used from a + plug-in. Removed trailing whitespace and redundant includes. + + * libgimp/gimp.def: removed _gimp_tile_cache_flush_drawable again. + +2004-06-28 Simon Budig <simon@gimp.org> + + * app/tools/gimpvectortool.c: fixed drawing code to properly + update after deleting nodes via BackSpace/Delete. + +2004-06-27 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimplevelstool.c: removed two small chunks of code. + Fixes bug #141930. Possibly unfixes bug #132322. + +2004-06-27 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimp/gimp.def: added _gimp_tile_cache_flush_drawable because + it is used in a plug-in. See bug #145051. + +2004-06-26 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/unsharp.c: Preview now works correctly with + RGBA and grayscale-alpha images. Fixes bug #144971. + +2004-06-26 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimpclonetool.c: added button_release callback + to fix bug #145022. + +2004-06-26 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/unsharp.c: Use GTK_PREVIEW_GRAYSCALE if source + is grayscale or grayscale-alpha. Partial fix for bug #144971. + +2004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/unsharp.c: speed up preview by allocating tile + cache before creating dialog. Should fix bug #144972. + +2004-06-25 Philip Lafleur <plafleur@cvs.gnome.org> + + * plug-ins/common/zealouscrop.c: Moved Zealous Crop from + <Image>/Layer/Crop to <Image>/Image/Crop because it affects the + entire image. + +2004-06-25 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/dog.c: added Difference of Gaussians edge + detect plug-in. + + * plug-ins/common/plugin-defs.pl: + * plug-ins/common/Makefile.am: added dog and regenerated + Makefile. + +2004-06-25 Michael Natterer <mitch@gimp.org> + + * app/actions/context-actions.c: added GIMP_ACTION_SELECT_SET + actions which set a generated brush's properties directly. + + * app/actions/context-commands.c: adjust the range of possible + brush radius and aspect_ratio values to be actually usable. + +2004-06-25 Michael Natterer <mitch@gimp.org> + + * app/core/gimpbrushgenerated.[ch]: reordered parameters and + members to be consistent with other places where generated + brushes are used. Check for errors when loading a brush and + utf8-validate its name. Cleanup. + + * app/core/gimpbrush.c + * app/core/gimpbrushpipe.c: cleanup. + +2004-06-25 Michael Natterer <mitch@gimp.org> + + * app/gui/preferences-dialog.c (prefs_dialog_new): work around + GTK+ bug #143270 (set the cursor on the selected model path + instead of selecting the iter in the selection). Fixes random + theme switching when selecting the "Theme" page. + +2004-06-25 Michael Natterer <mitch@gimp.org> + + * app/core/gimpbrushgenerated.c: added properties for all brush + parameters. + + * app/widgets/gimpbrusheditor.c: listen to property changes of the + edited brush and update the scales accordingly. + +2004-06-25 Michael Natterer <mitch@gimp.org> + + * app/gui/preferences-dialog.c: more work on the controller page, + made integer controller properties editable. + + * modules/controller_midi.c: allow to specify the MIDI channel to + generate events from. Default to -1 (all channels). + +2004-06-24 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/gfig/gfig.[ch]: + * plug-ins/gfig/gfig-preview.c: Let gfig use a thumbnail of the + image as background for its preview, if the image is RGB and "Show + image" is checked in the Options tab. (Next best thing to + previewing in the image.) + +2004-06-25 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontrollerinfo.[ch]: added a boolean property + "debug-events" and honor it when printing debugging output. + Should add an event console window so the user doesn't need to + have a terminal to inspect input module output. + + * app/gui/prefereces-dialog.c: HIGified some forgotten labels. + Renamed the "Pointer Movement Feedback" frame to "Mouse Cursors". + Replaced some forgotten "Dir" with "Folder". + Made more GimpControllerInfo and GimpController properties + editable and cleaned up the controller page. + +2004-06-25 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimppropwidgets.[ch]: added gimp_prop_label_new(). + + * app/widgets/gimpgrideditor.c: HIGified capitalization. + +2004-06-25 Michael Natterer <mitch@gimp.org> + + * modules/controller_linux_input.c + * modules/controller_midi.c: remember the source ID returned by + g_io_add_watch() and remove it when changing the device, so the + file descritor gets actually closed. Minor cleanups. + +2004-06-24 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontrollerwheel.[ch]: renamed function + gimp_controller_wheel_scrolled() to + gimp_controller_wheel_scroll(). + + * app/display/gimpdisplayshell-callbacks.c + (gimp_display_shell_canvas_tool_events): changed accordingly. + +2004-06-24 Michael Natterer <mitch@gimp.org> + + * etc/controllerrc: fix typo in wheel controller mapping. + +2004-06-24 Michael Natterer <mitch@gimp.org> + + * app/tools/gimptool.[ch] + * app/tools/tool_manager.[ch]: added boolean return value to + GimpTool::key_press() which indicates if the event was handled. + + * app/tools/gimpcroptool.c + * app/tools/gimpeditselectiontool.[ch] + * app/tools/gimptransformtool.c + * app/tools/gimpvectortool.c: return TRUE if the key event was handled. + + * app/tools/gimppainttool.c: removed key_press() implementation. + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcontrollerkeyboard.[ch]: new controller class + which takes GdkEventKey and emits controller events for all + combinations of modifiers and cursor keys. + + * app/widgets/gimpcontrollers.[ch]: added new function + gimp_controllers_get_keyboard(). + + * app/display/gimpdisplayshell-callbacks.c: if a key event was not + handled by the active tool, dispatch it to the keyboard controller. + + * etc/controllerrc: add a keyboard controller which is configured + to do the same as the removed gimp_paint_tool_key_press(). + +2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * libgimp/gimpdrawable.c: added some documentation for + a few important functions with no API docs. + +2004-06-24 Sven Neumann <sven@gimp.org> + + * Made 2.1.1 release. + +2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/actions/file-commands.c: make "Revert" only ask for + confirmation if image is dirty. Fixes bug #141971. + +2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/gui/*.c: + * app/widgets/*.c: + * etc/templaterc: HIGify capitalization. Should finish bug #123699 + except for everything I missed or got wrong. + +2004-06-24 Sven Neumann <sven@gimp.org> + + * etc/controllerrc: commented out the linux_input controller + configuration. + +2004-06-23 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/*.c: HIGify capitalization for dialogs. More + progress on bug #123699. + +2004-06-23 Michael Natterer <mitch@gimp.org> + + * modules/controller_midi.c: added utility function midi_event() + which assembles a GimpControllerEventValue and emits it. + +2004-06-23 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpenumaction.[ch] + * app/widgets/gimppluginaction.[ch] + * app/widgets/gimpstringaction.[ch]: added parameters to the + gimp_*_action_selected() function so the "selected" signal can be + emitted with value != action->value. Changed GtkAction::activate() + implementations accordingly (pass action->value). + + * app/widgets/gimpcontrollers.c: call gimp_enum_action_selected() + and pass the value of the GimpControllerEventValue instead of + temporarily replacing action->value and calling + gtk_action_activate(). + + * app/widgets/gimpcontrollerinfo.c: fixed debugging output. + +2004-06-23 Michael Natterer <mitch@gimp.org> + + * app/paint/gimpbrushcore.[ch]: added signal "set-brush" which is + G_SIGNAL_RUN_LAST so we can connect before and after the default + implementation. Moved the brush setting and outline invalidation + stuff to its default implementation. Also remember the outline's + width and height. Call gimp_brush_core_set_brush() from + gimp_brush_core_invalidate_cache() so "set-brush" is emitted + whenever a generated brush becomes dirty. + + * app/tools/gimppainttool.c (gimp_paint_tool_button_press): don't + pause/resume but rather stop/start the draw_tool. Fixes straight + line preview aretefacts. + + (gimp_paint_tool_oper_update): set the brush_core's brush before + starting the draw_tool. + + (gimp_paint_tool_draw): never free the brush_core's cached brush + outline because the brush_core does that by itself now. + + (gimp_paint_tool_set_brush) + (gimp_paint_tool_set_brush_after): new callbacks which pause and + resume the draw_tool. Fixes brush outline artefacts when modifying + the current brush e.g. by using the mouse wheel. + +2004-06-23 Michael Natterer <mitch@gimp.org> + + * app/actions/context-commands.h: removed enum GimpContextSelectType. + + * app/actions/actions-types.h: added enum GimpActionSelectType. + + * app/actions/actions.[ch]: added utility functions + action_select_value() and action_select_object(). + + * app/actions/context-actions.c + * app/actions/context-commands.c: changed accordingly. + + * app/actions/layers-actions.c + * app/actions/layers-commands.[ch]: merged the layer select + callbacks into one using the GimpActionSelectType functions. Added + actions and callbacks for modifying the active layer's opacity. + + * app/menus/menus-types.h: #incude "actions/action-types.h". + + * app/gui/gui-types.h: #incude "menus/menus-types.h". + + * app/gui/preferences-dialog.c: allow to enable/disable input + controllers. + +2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimpcurvestool.c: try again to revert. + +2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimpcurvestool.c: reverted. + +2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/script-fu/scripts: HIG-ified capitalization on + all. Finishes this for everything in plug-ins. Bug #123699 is + now mostly fixed. + +2004-06-22 Sven Neumann <sven@gimp.org> + + * app/composite/gimp-composite-regression.c: define timersub() + macro in case it's undefined. Patch by Tim Mooney, fixes 'make + check' on Tru64 (bug #144780). + +2004-06-22 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimpcurvestool.c: added Store/Recall buttons for + one-click saving and loading of curves. Should create stock + labels for them. Hopefully resolves bug #75558. + +2004-06-22 Michael Natterer <mitch@gimp.org> + + * app/actions/view-actions.c + * app/actions/view-commands.[ch]: added actions & callbacks to + configure the canvas padding color. + + * app/widgets/gimphelp-ids.h + * menus/image-menu.xml.in: added the actions' help IDs and menu entries. + + * app/display/display-enums.h: added /*< skip >*/'ed enum value + GIMP_CANVAS_PADDING_MODE_RESET. + + * app/display/gimpdisplayshell-appearance.c + * app/display/gimpdisplayshell-callbacks.[ch] + * app/display/gimpdisplayshell-handlers.c + * app/display/gimpdisplayshell.[ch]: removed the canvas padding + button and its popup menu (fixes bug #142996). Instead, added a + toggle button which allows to zoom the image when the window is + resized (as known from sodipodi, except it doesn't work as nice + yet :-) improvements to the algorithm are welcome). + Cleaned up the GimpDisplayShell struct a bit and renamed some + of its members. + + * libgimpwidgets/gimpstock.[ch] + * themes/Default/images/Makefile.am + * themes/Default/images/stock-zoom-follow-window-12.png: added new + icon for the new display toggle button. + +2004-06-22 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpclonetool.c (gimp_clone_tool_draw): chain up + unconditionally now that we draw the brush outline while + painting. Fixes brush outline artefacts on button_press and + button_release. Spotted by sjburges. + +2004-06-22 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpfiledialog.c (gimp_file_dialog_set_image): unset + the filename if the image is unnamed. + + * configure.in + * app/sanity.c: depend on gtk+ >= 2.4.1. + + * app/widgets/gimpthumbbox.[ch]: changed gimp_thumb_box_set_uris() + to gimp_thumb_box_take_uris() since the function takes ownership + of the list, + + * app/widgets/gimpfiledialog.c: changed accordingly. Removed code + that worked around a problem in gtk+ < 2.4.1. + +2004-06-22 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpcolorarea.c (gimp_color_area_set_color): use + gimp_rgb_distance() for flat color areas. Fixes bug #144786. + +2004-06-22 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/fileops.pdb: app/pdb/fileops_cmds.c is a + generated file, need to do the documentation change here. + + * app/pdb/fileops_cmds.c + * libgimp/gimpfileops_pdb.c: regenerated. + +2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimptransformoptions.c: use radio buttons + for constraint options. Makes all options visible, + should resolve bug #68106. + +2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/gui/file-save-dialog.c: to reduce clutter, hide overwrite + query dialog after user has responded. + +2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/noisify.c: changed handling of alpha + channel in an attempt to deal with bug #72853. + Changed menu entry from "Noisify" to "Scatter RGB". + +2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/pdb/fileops_cmds.c: fixed incorrect documentation for + gimp_file_load, which was the root cause of bug #118811. + +2004-06-21 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins: finish implementing HIG capitalization in dialogs. + Scripts remain to be done. More progress on bug #123699. + +2004-06-21 Michael Natterer <mitch@gimp.org> + + * app/widgets/widgets-enums.[ch] (enum GimpCursorFormat): removed + value GIMP_CURSOR_FORMAT_PIXBUF_PREMULTIPLY because it's the job + of GDK to do that (it was GDK that was broken, not some of the X + servers). + + * app/widgets/gimpcursor.c (gimp_cursor_new): premultiply the + cursor's pixels for GTK+ < 2.4.4. + +2004-06-21 Sven Neumann <sven@gimp.org> + + * app/gui/gui.c (gui_exit_callback): improved message in quit + dialog just in case that we don't manage to redo this dialog + before 2.2. + +2004-06-21 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpwidgets.[ch] + * libgimpwidgets/gimpwidgets.def: added new utility function + gimp_label_set_attributes(). + + * app/display/gimpdisplayshell.c + * app/gui/preferences-dialog.c + * app/gui/resolution-calibrate-dialog.c + * app/widgets/gimpviewabledialog.c + * app/widgets/gimpwidgets-utils.c: use the new function. + + * app/widgets/gimpcontainergridview.c + * app/widgets/gimphistogrameditor.c: display the name in italic. + + * plug-ins/common/jpeg.c: display the file size in italic. + +2004-06-20 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/url.c: if url does not end in a recognized + extension, open it as an unnamed image. Fixes bug #118811. + +2004-06-20 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphistogrambox.[ch]: removed the label between the + spinbuttons, it looks silly. Converted tabs to spaces, removed + trailing whitespace. + + * app/widgets/gimphistogrameditor.c + * app/tools/gimpthresholdtool.c: changed accordingly. + +2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins: changed dialogs to follow HIG capitalization style + wherever they didn't. Scripts remain to be done. Partially + fixes bug #123699. + +2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/widgets/gimphistogrambox.[ch]: + * app/tools/gimpthresholdtool.c: Changed the threshold tool dialog + so that it uses a two-triangle-slider scale of the sort used in the + levels tool. Almost all of the changes are actually in the + histogram-box widget code, which is only used by the threshold + tool. Fixes bug #137521. + +2004-06-20 Sven Neumann <sven@gimp.org> + + * plug-ins/common/jpeg.c: removed redundant hboxes and other + layout cleanups. + +2004-06-20 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/display/gimpdisplayshell-scale.[ch]: + * app/display/gimpnavigationview.[ch]: + * app/actions/view-actions.c: + * app/actions/view-commands.[ch]: + * app/widgets/gimphelp-ids.h: + * menus/image-menu.xml.in: Changed "Zoom to Fit Window" command + to "Fit Image in Window" and added another command, "Fit Image + to Window", that zooms according to the opposite dimension. Fixes + bug #144597. + +2004-06-19 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimpwidgets/gimpwidgets.def: added missing + gimp_controller_* entries + +2004-06-19 Michael Schumacher <schumaml@cvs.gnome.org> + + * modules/controller_midi.c: #ifdef G_OS_WIN32 for an O_NONBLOCK + +2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/jpeg.c: more changes to save dialog. Moved + comment field to Advanced area. Don't set restart marker + frequency stuff insensitive. Changed range for quality + scale from 0-1 to 0-100 to follow the jpeg spec (but left + allowable range for pdb at 0-1 to avoid breaking anything). + +2004-06-19 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimpscaletool.c: fixed my fix for bug # 68106, which + worked incorrectly for two of the control points. + +2004-06-19 Michael Natterer <mitch@gimp.org> + + * modules/controller_midi.c (midi_read_event): simplified + swallowing of SysEx messages and unwanted data bytes. Reordered + and commented stuff to be more readable. + +2004-06-19 Michael Natterer <mitch@gimp.org> + + * modules/Makefile.am + * modules/controller_midi.c: new controller for MIDI input. Maps + all note on and note off events and all MIDI controllers to + GimpContollerEvents. Should parse any MIDI stream. Code based on + blinkenmedia stuff from Daniel Mack. + +2004-06-19 Sven Neumann <sven@gimp.org> + + Applied a patch from Geert Jordaens that implements the + GtkStatusbar functionality in GimpStatusbar so that we can redo it + in order to fix bug #120175: + + * app/core/gimpmarshal.list: added VOID: UINT, STRING. + + * app/display/gimpstatusbar.[ch]: copied GtkStatusbar code. + + * app/display/gimpdisplayshell.c: changed accordingly. + +2004-06-19 Sven Neumann <sven@gimp.org> + + * plug-ins/ifscompose/ifscompose_utils.c (create_brush): use + G_SQRT2; some coding style cleanups. + +2004-06-19 Sven Neumann <sven@gimp.org> + + * app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): moved + array initialization out of variable declaration (bug #144632). + +2004-06-19 Sven Neumann <sven@gimp.org> + + * app/vectors/gimpbezierstroke.c (arcto_ellipsesegment): use + G_SQRT2 to make circlemagic a constant value so we can initialize + the array on declaration. Fixes bug #144632. + +2004-06-19 Sven Neumann <sven@gimp.org> + + * devel-docs/parasites.txt: document "exif-data" parasite. + +2004-06-18 Manish Singh <yosh@gimp.org> + + * plug-ins/common/film.c: Don't use deprecated gimp_text functions, + clean up font name string handling a bit, default is now "Monospace" + instead of "Courier". + +2004-06-19 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontrollers.c (gimp_controllers_event_mapped): + start supporting GIMP_CONTROLLER_EVENT_VALUE of type gdouble. + Assume the double value is in a [0.0..1.0] range and temporarily + change the value of the called GimpEnumAction to a range of + [0..1000] when invoking it. All still very hackish... + +2004-06-19 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontrollerinfo.c (gimp_controller_info_event): + more debugging output. + +2004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * app/tools/gimpscaletool.c: changed algorithm for scaling when + aspect ratio is constrained, to fix strange behavior described + in bug # 68106. + +2004-06-18 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/jpeg.c: redid save dialog along lines suggested + in bug # 138929 + + Only create an exif data parasite on loading file if the file actually + contains exif data. + + Call exif data parasite "exif-data" instead of "jpeg-exif-data", + because it should be interchangeable with TIFF exif data. + +2004-06-18 Michael Natterer <mitch@gimp.org> + + * app/actions/context-actions.c + * app/actions/context-commands.[ch]: added tons of new actions to + modify the current FG/BG color's RGB components. + + Added new enum value GIMP_CONTEXT_SELECT_SET which allows to set + values, not only increase/decrease them. + + Changed context_select_value() utility function to interpret + GimpEnumAction::value being >= GIMP_CONTEXT_SELECT_SET as settings + in a range from 0 to 1000. Yes, that's a hack... + +2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/tools/gimptransformtool.c: reverted my fix to bug #144570. + +2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/tools/gimpfuzzyselecttool.c: Fix fuzzy select menu label. + +2004-06-18 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/tools/gimptransformtool.c (gimp_transform_tool_bounds): + If transforming a path, use the path bounds rather than the mask + bounds. Fixes bug #144570. + +2004-06-17 Michael Natterer <mitch@gimp.org> + + * app/core/gimp-utils.[ch]: added gimp_boolean_handled_accum(). + + * app/core/gimp.c + * app/widgets/gimpcontrollerinfo.c: use it. + +2004-06-17 Michael Natterer <mitch@gimp.org> + + * app/core/gimpcontainer.c (gimp_container_deserialize): add newly + created children to the container *after* deserializing them so + GimpContainer::add() callbacks get the already deserialized + object. + + * app/widgets/gimpcontrollers.c: connect to "add" and "remove" of + the controller list and remember / clear the wheel controller when + it appears / disappears. + +2004-06-17 Sven Neumann <sven@gimp.org> + + * autogen.sh: check for xsltproc and mention that the intltool + version mismatch is harmless. + +2004-06-17 Pedro Gimeno <pggimeno@wanadoo.es> + + * tools/pdbgen/pdb/paths.pdb: Fix typos and improve documentation. + Addresses bug #144267. + + * app/pdb/paths_cmds.c + * libgimp/gimppaths_pdb.c: regenerated. + +2004-06-17 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcontroller.[ch]: removed "enabled" + property. Removed GIMP_CONTROLLER_PARAM_SERIALIZE from the "name" + property because it's the hardware-determined name of this + controller instance. + + * app/widgets/gimpcontrollerwheel.c + * modules/controller_linux_input.c: set the name. + + * libgimpwidgets/gimpwidgets.h: #include gimpcontroller.h. + + * app/widgets/gimpcontrollerinfo.[ch]: added "enabled" here + instead. Don't dispatch events if the controller is + disabled. Made everything work (not crash) with info->mapping + being NULL. + + * etc/controllerrc: updated again with the changed format. + + * app/widgets/gimpcontrollers.[ch]: added + gimp_controllers_get_list() which returns the container of + controllers. + + * app/widgets/gimphelp-ids.h + * app/gui/preferences-dialog.c: added controller configuration + (can't change anything yet, just view the current settings). + Resurrected the "Input Devices" page and removed the "Session" + page by moving its widgets to other pages. Pack the various + "Save now"/"Clear now" buttons vertically, not horizontally. + Fixes bug #139069. + + * themes/Default/images/preferences/Makefile.am + * themes/Default/images/preferences/controllers.png + * themes/Default/images/preferences/theme.png: new icons for new + prefs pages. Someone needs to make them nice... + +2004-06-17 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell.c: GtkUIManager makes the menu bar + visible by default, hide it if options->show_menubar is FALSE. + Fixes bug #143243. + +2004-06-17 Sven Neumann <sven@gimp.org> + + * configure.in: bumped version to 2.1.1. Allow to disable the + build of the linux_input controller module. + +2004-06-17 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/core/gimpdrawable-transform.c + (gimp_drawable_transform_tiles_affine): Make transforms (most + notably perspective transforms) conform exactly to specified + edges. Includes a patch by David Gowers. Fixes bug #144352. + +2004-06-16 Manish Singh <yosh@gimp.org> + + * modules/controller_linux_input.c: put BTN_{WHEEL,GEAR_DOWN,GEAR_UP} + usage in #ifdefs, since pre-2.6 kernels do not have them. + + * modules/controller_linux_input.c (linux_input_read_event): n_bytes + should be a gsize. + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * app/actions/context-actions.c + * app/actions/context-commands.[ch]: added actions & callback + to select the first/last/prev/next tool. + +2004-06-16 Simon Budig <simon@gimp.org> + + * modules/controller_linux_input.c: removed BTN_MISC, + since it is the same as BTN_0 in the input.h header file. + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcontroller.c (gimp_controller_get_event_name) + (gimp_controller_get_event_blurb): always return a non-NULL + string (return "<invalid event id>" as fallback). + + * modules/controller_linux_input.c: reenabled button event + dispatching. + + * app/widgets/gimpcontrollerinfo.c: fixed debugging output. + +2004-06-16 Simon Budig <simon@gimp.org> + + * modules/controller_linux_input.c: break out of the + loop after we handled the first matching rel_event. + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcontroller.[ch]: added #define + GIMP_CONTROLLER_PARAM_SERIALIZE. Made all properties serializable. + + * modules/controller_linux_input.c: made "device-name" + serializable. + + * app/config/gimpconfig-params.h: added macro + GIMP_CONFIG_INSTALL_PROP_POINTER() which needs to be handled + by custom (de)serialize_property() implementations. + + * app/config/gimpconfig-deserialize.c + * app/config/gimpconfig-serialize.c: made object (de)serialization + work for object properties which are *not* GIMP_PARAM_AGGREGATE. + Write/parse the exact type of the object to create to enable this. + + * app/core/gimpmarshal.list: new marshaller for GimpControllerInfo. + + * app/widgets/gimpcontrollerinfo.[ch]: implement GimpConfigInterface + and add "controller" and "mapping" properties. Add "event-mapped" + signal which carries the action_name. + + * app/widgets/gimpcontrollers.c: removed all deserialization code + and simply (de)serialize the controller container. Install a + container handler for "event-mapped" and do the action_name -> + action mapping in the callback. + + * etc/controllerrc: regenerated with new syntax. Delete your old one! + +2004-06-16 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcontrollerwheel.c + (gimp_controller_wheel_get_event_name): don't use gettext() here. + + * modules/controller_linux_input.c: added more button events, set + the device name, some cleanup. + +2004-06-16 Sven Neumann <sven@gimp.org> + + * plug-ins/common/plugin-defs.pl: changed dependencies for blur. + + * plug-ins/common/Makefile.am: regenerated. + + * plug-ins/common/blur.c: no need to include libgimpui.h any longer. + +2004-06-16 Bill Skaggs <weskaggs@primate.ucdavis.edu> + + * plug-ins/common/blur.c: removed randomize and repeat options; + made to run without popping a dialog. (bug #142318) + +2004-06-16 Simon Budig <simon@gimp.org> + + * modules/controller_linux_input.c: enable dial-events for + e.g. the powermate. Fixed typo. + +2004-06-16 Sven Neumann <sven@gimp.org> + + * menus/image-menu.xml.in: added missing menu entries (bug #144449). + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcontroller.[ch]: added + GimpController::get_event_blurb() which returns the strings that + were returned by get_event_name(). The latter returns + untranslatable event identifiers now. + + * app/widgets/gimpcontrollerwheel.c + * modules/controller_linux_input.c: changed accordingly. + + * app/widgets/gimpcontrollerinfo.c + * app/widgets/gimpcontrollers.c: changed the event mapping from + event-id -> action-name to event-name -> action-name. + + * etc/controllerrc: changed accordingly (finally readable now). + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcontrollerinfo.[ch]: made an object out of + the GimpControllerInfo struct. + + * app/widgets/gimpcontrollers.c: changed accordingly. + +2004-06-16 Jakub Steiner <jimmac@ximian.com> + + * etc/controllerrc: fix typo + +2004-06-16 Sven Neumann <sven@gimp.org> + + * modules/controller_linux_input.c + * etc/controllerrc: preliminary wheel event support. + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontrollers.c: better debugging output. + +2004-06-16 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcontrollers.c: bug fix. + + * configure.in: check for linux/input.h. + + * modules/Makefile.am + * modules/controller_linux_input.c: added a prototype controller + module using the linux input event interface. + + * etc/controllerrc: added example config for linux input device. + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontrollers.c: load the controller's + properties from the controllerrc file. + + * etc/controllerrc: set the wheel's properties. + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * etc/controllerrc: use the 10% actions for opacity. + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontrollers.c: ref the actions when putting + them in the mapping table. + + * app/actions/context-actions.c: added actions to change the + opacity in 10% steps. + +2004-06-16 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcontroller.[ch]: added a "name" property. + Dispatch events only if the controller is enabled. + + * app/widgets/gimpcontrollerwheel.c: added controller events for + all possible modifier combinations. + + * etc/Makefile.am + * etc/controllerrc: default controllerrc which maps all unused + wheel+modifier combinations to more-or-less usefull stuff. + +2004-06-16 Michael Natterer <mitch@gimp.org> + + Started to fix bug #106920 in a more genreral way: + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgetstypes.h + * libgimpwidgets/gimpwidgetsmarshal.list + * libgimpwidgets/gimpcontroller.[ch]: new abstract base class + which provides an API for pluggable input controller modules + (mouse wheel, usb/midi stuff etc.). + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcontrollerwheel.[ch]: subclass of the above + which maps wheel mouse scroll events to controller events. + + * app/widgets/gimpcontrollers.[ch]: manager for controllers. + reads $(gimpdir)/controllerrc and keeps a mapping of controller + events to GtkActions. + + * app/gui/gui.c: initialize and shut down the controller stuff. + + * app/display/gimpdisplayshell-callbacks.c + (gimp_display_shell_canvas_tool_events): if a wheel controller + exists, dispatch GdkEventScroll to it first and return if it was + handled. + +2004-06-15 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/text_tool.pdb: deprecate the XLFD-based API + gimp_text() and gimp_text_get_extents(). + + * app/pdb/text_tool_cmds.c + * libgimp/gimptexttool_pdb.[ch]: regenerated. + +2004-06-15 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/pdbgen.pl + * tools/pdbgen/lib.pl: some simplistic code to add a $deprecated + flag to pdb definitions, which translates into GIMP_DISABLE_DEPRECATED + guards in lib headers. + +2004-06-15 Michael Natterer <mitch@gimp.org> + + * app/actions/Makefile.am + * app/actions/context-actions.[ch] + * app/actions/context-commands.[ch]: added new action group to + modify all GimpContext properties. So far there are actions to + cycle through the lists of brushes, patterns etc., to change the + opacity, to swap and default colors and to edit generated brushes. + + * app/actions/actions.c: register the new "context" action group. + + * app/actions/tools-actions.c + * app/actions/tools-commands.[ch]: removed "tools-default-colors" + and "tools-swap-colors" actions and callbacks because they are + in the "context" action group now. + + * app/menus/menus.c: add the "context" group to the <Image> and + <Dock> UI managers. + + * menus/image-menu.xml.in: changed accordingly. Added a temporary + "Context" menu to test and debug the new actions. + +2004-06-15 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/tools/gimpcroptool.c (crop_selection_callback): Force + aspect ratio to match selection when 'From Selection' is clicked. + Fixes bug #144361. Also converted tabs to spaces. + +2004-06-15 Sven Neumann <sven@gimp.org> + + * plug-ins/common/mng.c (respin_cmap): applied the fix for empty + colormaps (bug #143009) here as well. + +2004-06-15 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/core/gimpdrawable-transform.c + (gimp_drawable_transform_tiles_affine): Don't round texture + coordinates when not using interpolation. Fixes bug #144352 for + the nearest neighbor case only. + +2004-06-14 Sven Neumann <sven@gimp.org> + + * app/paint/gimpinkoptions.c: replaced some arbitrary values with + larger but still arbitrary values (default and limit for ink size). + +2004-06-14 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintcore.[ch]: removed PRETRACE_PAINT and + POSTTRACE_PAINT from the GimpPaintCoreState enum. Removed + "gboolean traces_on_window" from GimpPaintCoreClass. + + * app/paint/gimpclone.[ch] + * app/paint/gimpink.c + * app/tools/gimpclonetool.c: changed accordingly. + + * app/tools/gimppainttool.c: ditto. Show the brush outline + while painting. Fixes bug #118348. + +2004-06-14 Michael Natterer <mitch@gimp.org> + + * app/tools/gimptransformtool.c: use gimp_draw_tool_is_active() + instead of GIMP_IS_DISPLAY(draw_tool->gdisp). + +2004-06-14 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions): + do the workaround for "" accelerators only if the GTK+ version + is smaller than 2.4.3. Fixes bug #144342 for GTK+ >= 2.4.3. + +2004-06-14 Sven Neumann <sven@gimp.org> + + * app/core/gimpdrawable-transform.c: declared + gimp_drawable_transform_cubic() as inline function. Makes + sample_cubic() run about 10% faster and causes a 7% speedup on + cubic transformations. + + * app/paint-funcs/paint-funcs.c (border_region): avoid an + unnecessary memory allocation. + +2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/tools/gimptransformtool.c: Disable preview in corrective + mode, and notify preview when switching transform type and + direction. + +2004-06-14 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintcore.[ch]: added new virtual function + GimpPaintCore::post_paint() and call it after calling + GimpPaintCore::paint(). + + * app/paint/gimpbrushcore.[ch]: renamed brush_core->grr_brush + to brush_core->main_brush and reset brush_core->brush + to brush_core->main_brush in GimpPaintCore::post_paint(). + + * app/paint/gimpbrushcore.c + * app/paint/gimppaintcore-stroke.c + * app/tools/gimppainttool.c: removed all code which restores + the brush_core's old brush after painting since post_paint() + does this automatically now. + + * app/paint/gimpclone.[ch]: moved static variables to the + GimpClone struct. + +2004-06-14 Sven Neumann <sven@gimp.org> + + * app/paint-funcs/paint-funcs-generic.h (color_pixels): some code + cleanup I did while attempting to optimize this code further. + +2004-06-14 Henrik Brix Andersen <brix@gimp.org> + + * app/plug-in/plug-in-run.c: let extensions run synchronously when + called via PDB. Fixes bug #140112. + +2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/tools/gimptransformtool.c: Preview is now only used for + layer transformations. + +2004-06-14 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpperspectivetool.c + * app/tools/gimprotatetool.c + * app/tools/gimpscaletool.c + * app/tools/gimpsheartool.c: removed calls to + gimp_transform_tool_expose_preview() from all + GimpTransformTool::motion() implementations... + + * app/tools/gimptransformtool.c: ...and call it after calling + tr_tool_class->preview(). + +2004-06-14 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell.[ch]: remember the last used + GimpCursorFormat so changing the format in prefs applies + instantly, and not after the next tool change. + + * app/display/gimpdisplayshell-cursor.[ch] + * app/tools/gimptool.[ch] + * app/tools/gimptoolcontrol.[ch] + * app/tools/gimpclonetool.c + * app/tools/gimpcolortool.c + * app/tools/gimpcroptool.c + * app/tools/gimpcurvestool.c + * app/tools/gimpiscissorstool.c + * app/tools/gimpmeasuretool.c + * app/tools/gimpmovetool.c + * app/tools/gimptransformtool.c: s/GdkCursorType/GimpCursorType/g + +2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/tools/gimptransformtool.c (gimp_transform_tool_doit): Preview + wasn't being turned off before performing a transformation. Also + converted tabs to spaces. + +2004-06-14 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/display/gimpdisplayshell-preview.c: Transformation previews now + use the selection mask if it is present. + +2004-06-13 Manish Singh <yosh@gimp.org> + + * configure.in: Make sure PangoFT2 is using a recent enough fontconfig + since many people have broken and confused setups. + +2004-06-13 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/pdb/gradient_edit.pdb: cleans ups so generated + output doesn't warn about uninitialize variable use, and whitespace + cosmetic cleanups. + + * app/pdb/gradient_edit_cmds.c: regenerated. + +2004-06-13 Manish Singh <yosh@gimp.org> + + * app/base/cpu-accel.c: Reorged, to address bug #142907 and + bug #143069. Accel implementations #define HAVE_ACCEL, and cpu_accel() + keys on that. Both PPC and X86 implementations check for __GNUC__. + X86 stuff is only used with USE_MMX is defined. The SSE OS check + is now checked in arch_accel(), not cpu_accel(). Finally, the + arch x86_64 checks now are EM64T aware (which didn't matter in + practice). + +2004-06-13 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/display/gimpdisplayshell-preview.c: use drawable_mask_bounds() + for texture coordinates instead of the drawable's width and height. + +2004-06-13 Sven Neumann <sven@gimp.org> + + * app/paint-funcs/paint-funcs.c (shapeburst_region): don't call + tile_ewidth() three times from the inner loop. + + * app/base/tile-manager.c (tile_manager_get): don't call + tile_size() twice on the same tile. + + * app/base/tile-private.h: added tile_size_inline(), an inline + version of the tile_size() function. + + * app/base/tile-cache.c + * app/base/tile-manager.c + * app/base/tile-swap.c + * app/base/tile.c: use tile_size_inline() from inside the tile + subsystem. + +2004-06-13 Simon Budig <simon@gimp.org> + + * app/tools/gimpiscissorstool.c: Minor tweaks to two macros. + Shouldn't change anything. + +2004-06-13 Jakub Steiner <jimmac@ximian.com> + + * cursors/tool-zoom.png: + * cursors/cursor-zoom.png: minor fsckup + +2004-06-13 Jakub Steiner <jimmac@ximian.com> + + * cursors/gimp-tool-cursors.xcf + * cursors/tool-burn.png: the burn tool doesn't really have an + inverted handle + +2004-06-13 Sven Neumann <sven@gimp.org> + + * app/paint-funcs/paint-funcs.[ch] (shapeburst_region): added + progress callback. + + * app/core/gimpdrawable-blend.c: show a progress while calculating + the Shapeburst. Not perfect but better than not showing any + progress at all. + +2004-06-13 Michael Natterer <mitch@gimp.org> + + * app/widgets/widgets-enums.[ch]: added enum GimpCursorFormat + which can be one of { BITMAP, PIXBUF, PIXBUF-PREMULTIPLY } to + work around broken X servers. + + * app/config/gimpguiconfig.[ch] + * app/config/gimprc-blurbs.h: added GimpGuiConfig::cursor-format. + + * app/gui/preferences-dialog.c: added a GUI for the new option. + + * app/widgets/gimpcursor.[ch]: added cursor_format parameter + to gimp_cursor_new() and _set(). + + * app/display/gimpdisplayshell-cursor.c + * app/tools/gimpcurvestool.c + * app/widgets/gimpdialogfactory.c: pass an appropriate cursor_mode. + +2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/core/gimpdrawable-blend.c: added missing semicolon. + +2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/display/gimpdisplayshell-callbacks.c: Fixed incorrect logic that + caused perfect-but-slow pointer tracking to be used in tools that + don't request exact mode. + + * app/display/Makefile.am: + * app/display/gimpdisplayshell-appearance.[ch]: + * app/display/gimpdisplayshell-callbacks.c: + * app/display/gimpdisplayshell.[ch]: + * app/display/gimpdisplayshell-preview.[ch]: added + * app/tools/gimpperspectivetool.c: + * app/tools/gimprotatetool.c: + * app/tools/gimpscaletool.c: + * app/tools/gimpsheartool.c: + * app/tools/gimptransformoptions.[ch]: + * app/tools/gimptransformtool.[ch]: Implemented live transformation + previews, available through tool options. Fixes bug #108172. + +2004-06-13 Sven Neumann <sven@gimp.org> + + * app/core/gimpdrawable-blend.c (gradient_render_pixel): inline + the repeat functions. + + * app/core/gimpgradient.c: inline the curve functions. + +2004-06-13 Jakub Steiner <jimmac@ximian.com> + + * cursors/gimp-tool-cursors.xcf + * cursors/tool-zoom.png: make more transparent + +2004-06-13 Jakub Steiner <jimmac@ximian.com> + + * cursors/gimp-tool-cursors.xcf + * cursors/tool-blur.png + * cursors/tool-bucket-fill.png + * cursors/tool-dodge.png + * cursors/tool-eraser.png + * cursors/tool-hand.png: fix a few problems hidden by low opacity + +2004-06-13 Jakub Steiner <jimmac@ximian.com> + + * cursor/*png: updated the cursors + +2004-06-13 Michael Natterer <mitch@gimp.org> + + * cursors/gimp-tool-cursors.xcf: added nice new antialiased + cursor layers made by Jimmac. + +2004-06-13 Sven Neumann <sven@gimp.org> + + * app/core/gimppalette.c (gimp_palette_load): don't use the rather + inefficient gimp_palette_add_entry() when loading a palette. + +2004-06-13 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdata.[ch]: added "gint freeze_count" and + gimp_data_freeze()/thaw() functions. Emit "dirty" only if + freeze_count either is 0 or drops to 0. + + * app/core/gimpbrushgenerated.[ch] + * app/core/gimpgradient.[ch]: removed freeze/thaw stuff that + was duplicated in these two subclasses and use the new + GimpData API instead. + + * app/widgets/gimpbrusheditor.c + * app/widgets/gimpgradienteditor.c: changed accordingly. + +2004-06-12 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcolorbar.c (gimp_color_bar_expose): don't copy + the first row onto itself. + +2004-06-12 Simon Budig <simon@gimp.org> + + * app/tools/gimptransformtool.c: Make Enter/Return apply the + transformation, Backspace/Delete resets the transformation. + + * app/tools/gimpcroptool.c: Simplify the key_press callback. + +2004-06-12 Simon Budig <simon@gimp.org> + + * app/tools/gimpcroptool.c: Make the Enter/Return key do + the crop action. + + * app/tools/gimpeditselectiontool.c + * app/tools/gimpvectortool.c: Make the _key_press functions + safe for non-arrow keys. + +2004-06-12 Sven Neumann <sven@gimp.org> + + * app/composite/gimp-composite.[ch]: just some cleanup. + +2004-06-12 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-callbacks.c + (gimp_display_shell_events): ported some forgotten #if 0'ed + GtkItemFactory stuff to GtkUIManager. + +2004-06-12 Simon Budig <simon@gimp.org> + + * app/tools/gimptool.[ch]: renamed the "arrow_key" member + to "key_press", since it is now no longer about just the arrow + keys. + + * app/tools/gimpcroptool.c + * app/tools/gimpeditselectiontool.c + * app/tools/gimpeditselectiontool.h + * app/tools/gimpmovetool.c + * app/tools/gimppainttool.c + * app/tools/gimpselectiontool.c + * app/tools/gimptexttool.c + * app/tools/gimpvectortool.c + * app/tools/tool_manager.c: Changed accordingly. + +2004-06-12 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell.c (gimp_display_shell_init): add + the file DND destination before all others so the DND code will + implicitly use its destination properties. Works around Konqueror + offering only file MOVE, not COPY and fixes bug #144168. + +2004-06-12 Sven Neumann <sven@gimp.org> + + * plug-ins/common/sample_colorize.c: reindented, some minor cleanup. + +2004-06-12 Simon Budig <simon@gimp.org> + + * app/tools/tool_manager.[ch]: renamed + tool_manager_arrow_key_active to tool_manager_key_press_active. + + * app/display/gimpdisplayshell-callbacks.c: Also dispatch + GDK_Return/KP_Enter/BackSpace/Delete to the tools, the + "arrow_key" member of GimpTool probably should be renamed. + + * app/tools/gimpvectortool.c: Use Enter/Return to convert the + current path to a selection, use Backspace/Delete to delete the + currently active anchors in a path. + + Implemented on Jimmacs request - thanks to him and Iva for being + a great host :) + +2004-06-12 Sven Neumann <sven@gimp.org> + + * app/widgets/gimphistogrameditor.c (gimp_histogram_editor_init): + set the initially selected channel on the histogram combobox. + Fixes bug #144225. + +2004-06-12 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/paint/gimppaintoptions.[ch]: renamed all "pressure-pressure" + variables to "pressure-hardness". + + * app/paint/gimpairbrush.c: + * app/tools/gimppaintoptions-gui.c: changed accordingly. + +2004-06-10 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpcolorarea.c: replaced destroy() by + finalize(), converted tabs to spaces, cleanup. + +2004-06-10 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpthumbbox.c (gimp_thumb_box_new): line-wrap the + filename label if it's too long instead of cutting it off. + +2004-06-10 Michael Natterer <mitch@gimp.org> + + * app/widgets/widgets-enums.h (enum GimpCursorModifier): + s/GIMP_LAST_CURSOR_MODIFIER_ENTRY/GIMP_CURSOR_MODIFIER_LAST/. + + * app/widgets/gimpcursor.c: changed accordingly. Renamed struct + GimpBitmapCursor to GimpCursor. More cleanup. + +2004-06-10 Michael Natterer <mitch@gimp.org> + + * app/actions/image-actions.c + * app/actions/image-commands.[ch] + * app/actions/layers-actions.c + * app/actions/layers-commands.[ch]: made the + "image-convert-rgb/grayscale/indexed" and the + "layers-mask-apply/delete" actions GimpEnumActions and merged + their callbacks. + +2004-06-10 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/gui/preferences-dialog.c: restored the 'Show Paint Tool + Cursor' option that was removed during clean-up. + +2004-06-10 Philip Lafleur <plafleur@cvs.gnome.org> + + * app/paint/gimpbrushcore.c (gimp_brush_core_pressurize_mask): + avoided some redundant calculations. + +2004-06-10 Sven Neumann <sven@gimp.org> + + * app/gui/user-install-dialog.c: removed the monitor calibration + from the user installation process. It's not a vital setting and + can be done from the Preferences dialog later. + + * app/gui/resolution-calibrate-dialog.[ch]: simplified the + resolution calibration dialog by removing the hacks that were + needed for drawing it in the user-installation style. + + * app/gui/preferences-dialog.c: changed accordingly. Also removed + the separator from the Display page. + +2004-06-10 Sven Neumann <sven@gimp.org> + + * app/widgets/gimptemplateeditor.[ch]: added an API to + expand/collapse the "Advanced Options" frame. + + * app/gui/preferences-dialog.c + * app/widgets/gimphelp-ids.h: applied a patch done by William + Skaggs that cleans up and reorganizes the Preferences dialog + (bug #144060). + +2004-06-09 Simon Budig <simon@gimp.org> + + * app/core/gimpcoords.[ch]: renamed gimp_coords_length2 to + gimp_coords_length_squared. + + * app/vectors/gimpbezierstroke.c: Changed accordingly + +2004-06-09 Sven Neumann <sven@gimp.org> + + * app/tools/gimppenciltool.c (gimp_pencil_tool_init): no need to + request GIMP_MOTION_MODE_EXACT here since the parent class does + that already. + + * app/tools/gimpinktool.c (gimp_ink_tool_init): ditto. Enable the + color picker feature for the ink tool. + +2004-06-09 Sven Neumann <sven@gimp.org> + + * menus/image-menu.xml.in: added "Selection Editor" to the + Selection menu. Still hoping for the great menu reorganization + though... + + * app/actions/select-actions.c (select_actions_update): "Save to + Channel" makes sense without a selection also, so don't set it + insensitive. + +2004-06-07 Sven Neumann <sven@gimp.org> + + * plug-ins/common/glob.c: the glob(3) function is not available on + Win32 and also isn't necessarily UTF-8 safe. Started to add an + alternative implementation. Right now there's just some code taken + from GTK+ (an UTF-8 save fnmatch() implementation) and the plug-in + does nothing useful. I will add some stripped-down glob code based + on the code in glibc later. + +2004-06-07 Michael Natterer <mitch@gimp.org> + + * app/core/gimplayer.c (gimp_layer_set_tiles): don't set + layer->mask's offsets. It is wrong because GimpDrawable::set_tiles() + is a lowlevel function which is used by stuff like scale and + resize which keep the mask in sync explicitely and don't expect it + to be moved in the middle of chaining up. Fixes bug #143860. + +2004-06-07 Michael Natterer <mitch@gimp.org> + + * app/actions/view-actions.c + * app/actions/view-commands.[ch]: added separate callback for + "view-zoom-other" and connect GtkAction::activate manually so + "Other..." can be selected even if it's the active item in the + zoom radio group. Fixes bug #143850. + +2004-06-07 Sven Neumann <sven@gimp.org> + + * plug-ins/common/tileit.c (tileit_dialog): fixed a typo. + +2004-06-07 Sven Neumann <sven@gimp.org> + + * app/menus/plug-in-menus.c (plug_in_menus_setup): sort the menus + by the translated menu path stripped from underscores. + +2004-06-06 Sven Neumann <sven@gimp.org> + + * plug-ins/common/gauss.c (gauss): fixed a stupid cut'n'paste bug + I introduced yesterday. + +2004-06-06 Sven Neumann <sven@gimp.org> + + * plug-ins/common/gauss.c (query): register the menu entry the new + way and install a mnemonic for Gaussian Blur. + +2004-06-05 Sven Neumann <sven@gimp.org> + + * plug-ins/common/curve_bend.c: applied a patch from Henrik Brix + Andersen that tells the user that Curve Bend cannot operate on + layers with masks instead of silently applying the mask + (bug #134748). + +2004-06-05 Sven Neumann <sven@gimp.org> + + * plug-ins/common/plugin-defs.pl + * plug-ins/common/Makefile.am + * plug-ins/common/gauss_iir.c + * plug-ins/common/gauss_rle.c: removed the two gaussian blur + plug-ins... + + * plug-ins/common/gauss.c: and added a merged version done by + William Skaggs. Fixes bug #134088. + +2004-06-05 Sven Neumann <sven@gimp.org> + + * plug-ins/sgi/sgi.c: applied a patch from Philip Lafleur that + makes the plug-in handle images with more than 4 channels. At the + moment the extra information is discarded (bug #143673). + +2004-06-05 Sven Neumann <sven@gimp.org> + + * plug-ins/common/unsharp.c: applied a modified patch from Geert + Jordaens that adds a preview to the Unsharp Mask plug-in. Fixes + bug #140974. + +2004-06-05 Sven Neumann <sven@gimp.org> + + * app/paint/gimppaintcore.c + * app/paint-funcs/paint-funcs-generic.h + * app/paint-funcs/paint-funcs.[ch]: applied a patch from Philip + Lafleur that changes the way that paint is applied during a paint + stroke. Fixes bug #124225. + +2004-06-05 Sven Neumann <sven@gimp.org> + + * plug-ins/common/Makefile.am + * plug-ins/common/plugin-defs.pl + * plug-ins/common/glob.c: added a simple glob plug-in based on + some old code by George Hartz. This plug-in is very useful when + you need to do batch processing, especially from Script-Fu. + Fixes bug #143661. + +2004-06-05 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpgradienteditor.c: applied a patch from David + Gowers that makes the gradient editor display the perceptual + intensity of the color under the cursor (bug #135037). + +2004-06-05 Sven Neumann <sven@gimp.org> + + * plug-ins/common/snoise.c: applied a modifed patch from Yeti that + adds a preview to the Solid Noise plug-in (bug #142587). + +2004-06-05 Sven Neumann <sven@gimp.org> + + * plug-ins/common/tiff.c: save the proper value for type of alpha + channel. Fixes bug #143522; patch by Philip Lafleur. + +2004-06-05 Manish Singh <yosh@gimp.org> + + * app/gui/preferences-dialog.c (prefs_dialog_new): update call + to prefs_spin_button_add for num-processors too. + +2004-06-05 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.c (script_fu_interface): + left align toggle buttons. + +2004-06-05 Sven Neumann <sven@gimp.org> + + * app/text/gimptextlayer-transform.[ch]: updated the (still unused) + text transformation code. + + * app/text/gimptext-bitmap.c: removed a redundant transformation. + +2004-06-05 Michael Natterer <mitch@gimp.org> + + * cursors/Makefile.am + * cursors/cursor-none.png + * cursors/xbm/cursor-none.xbm: new empty cursor images. + + * app/config/gimpdisplayconfig.[ch] + * app/config/gimprc-blurbs.h + * app/widgets/widgets-enums.h + * app/widgets/gimpcursor.c + * app/display/gimpdisplayshell-cursor.c + * app/tools/gimppainttool.[ch] + * app/tools/gimpinktool.c + * app/gui/preferences-dialog.c: applied patches from Philip + Lafleur which implement hiding the cursor completely for paint + tools. Changed the name of the config option from + "hide-paint-tool-cursor" to "show-paint-tool-cursor" and default + to TRUE because this needs the brush outline being visible while + painting to be really usable. Fixes bug #132163. + + * app/widgets/widgets-enums.h: renamed all GimpCursorType and + GimpToolCursorType enum values to GIMP_CURSOR_* and + GIMP_TOOL_CURSOR_*. + + * app/widgets/gimpcursor.c + * app/display/gimpdisplayshell-callbacks.c + * app/display/gimpdisplayshell-cursor.c + * app/tools/gimp*tool.c; changed accordingly. + +2004-06-04 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcursor.c: changed create_cursor_foo() utility + functions to get_cursor_foo() and use them as accessors instead of + using cursor->member. Use gdk_pixbuf_copy() instead of compositing + the initial image onto an empty pixbuf. + +2004-06-04 Sven Neumann <sven@gimp.org> + + * app/widgets/gimptexteditor.c (gimp_text_editor_new): set the + focus on the text area. + +2004-06-04 Sven Neumann <sven@gimp.org> + + * app/tools/gimptexttool.c (gimp_text_tool_class_init): allow to + move a text layer using the cursor keys. + +2004-06-04 Michael Natterer <mitch@gimp.org> + + * cursors/*.xbm: removed... + + * cursors/xbm/*.xbm: ...and added here instead. Renamed them + all to match the PNG file names. + + * cursors/Makefile.am: changed accordingly. + + * app/widget/gimpcursor.c: ditto. Merged the two cursor creating + functions again because they duplicated too much code. + +2004-06-04 Sven Neumann <sven@gimp.org> + + * app/menus/plug-in-menus.c (plug_in_menus_setup): populate the + tree with collation keys and use strcmp() instead of + g_utf8_collate() as the tree's sort function. + +2004-06-04 Sven Neumann <sven@gimp.org> + + * app/paint/gimppaintoptions.c (DEFAULT_PRESSURE_PRESSURE): + applied a patch by Philip Lafleur that changes the default to + FALSE. Fixes bug #143626. + +2004-06-03 Michael Natterer <mitch@gimpmp.org> + + * app/widgets/gimptoolbox.c (gimp_toolbox_size_allocate): use + gtk_widget_size_request() instead of _get_child_requisition() + because we need to know the size of the toolbox' areas + even if they are invisible. Fixes SIGFPE spotted by Jimmac. + +2004-06-03 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcursor.c: some cleanup. Make the tool_cursor + and cursor_modifier components slightly transparent. + + * cursors/cursor-mouse.png: was the wrong image. + +2004-06-03 Michael Natterer <mitch@gimp.org> + + * cursors/Makefile.am + * cursors/*.png: added PNG version of all cursors. + + * cursors/gimp-tool-cursors.xcf: reordered and renamed all layers + to match the new PNG filenames. + + * app/widgets/gimpcursor.[ch]: create cursors with alpha and color + if the GdkDisplay supports it. Fall back to the old stuff + otherwise. + +2004-06-03 Sven Neumann <sven@gimp.org> + + * app/core/gimppattern.c (gimp_pattern_load_pixbuf): if a Title is + set, use that as the pattern name. + +2004-06-03 Sven Neumann <sven@gimp.org> + + * app/core/gimpdatafactory.c (gimp_data_factory_load_data): + removed commented-out message. + + * app/core/gimppattern.[ch]: fixed handling of errors and PNG + comments in new pattern loader. Renamed functions for consistency + with other data loaders. + + * app/core/gimp.c: changed accordingly. + +2004-06-03 Dave Neary <bolsh@gimp.org> + + * app/core/gimp.c: + * app/core/gimpdatafactory.c: + * app/core/gimppattern.[ch]: Add support for GdkPixbuf patterns, + so now all of png, jpex, pnm, xbm, bmp, gif, ico, pcx, ras, tga, + xpm and tiff can be used for patterns. + +2004-06-03 Michael Natterer <mitch@gimp.org> + + * app/actions/vectors-actions.c: added alternative actions + "vectors-selection-from-vectors" and + "vectors-selection-to-vectors-short" with different labels suited + for the "Select" menu. + + * app/actions/select-actions.c: removed "select-from-vectors" + and "select-to-vectors" (to vectors was crashing anyway). + + * app/actions/select-commands.[ch]: removed + select_from_vectors_cmd_callback(). Fixes code dupliction. + + * menus/image-menu.xml.in + * menus/selection-editor-menu.xml: changed accordingly. + +2004-06-03 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpgradienteditor.c (control_motion): use the newly + added GimpGradient API to set the segment's handles instead of + setting the values directly. Dirties the gradient correctly and + makes the preview update instantly again. Fixes bug #143605. + +2004-06-03 Sven Neumann <sven@gimp.org> + + * app/gui/file-open-location-dialog.c + (file_open_location_completion): check for NULL pointer before + passing it to g_utf8_normalize(). Just a workaround for a problem + in GimpContainerView. + +2004-06-02 Sven Neumann <sven@gimp.org> + + * INSTALL: more updates. + +2004-06-02 Sven Neumann <sven@gimp.org> + + * Made 2.1.0 development release. + +2004-06-02 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-scale.c + * app/gui/info-window.c + * app/gui/preferences-dialog.c + * app/gui/resize-dialog.c + * app/tools/gimpcolorbalancetool.c + * app/tools/gimpcurvestool.c + * app/tools/gimphuesaturationtool.c + * app/tools/gimplevelstool.c + * app/tools/gimpthresholdtool.c + * app/widgets/gimpdockable.c + * app/widgets/gimpfiledialog.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimphistogrambox.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimpstrokeeditor.c: tweaked some spacings for + consistency and better HIG compliance. + +2004-06-02 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/gradient_edit.pdb: set_blending_function() and + set_coloring_type() work on segment ranges, renamed them + accordingly. Spotted by Shlomi Fish. + + * app/pdb/gradient_edit_cmds.c + * libgimp/gimpgradientedit_pdb.[ch]: regenerated. + +2004-06-02 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdnd.[ch]: removed utility funtion + gimp_dnd_open_files(). + + * app/widgets/gimptoolbox-dnd.c: added gimp_toolbox_drop_files() + instead. + + * app/display/gimpdisplayshell-dnd.c (gimp_display_shell_drop_files): + show the error message if opening a dropped file fails. + +2004-06-02 Sven Neumann <sven@gimp.org> + + * libgimpthumb/gimpthumbnail.c: plugged a small memory leak. + +2004-06-02 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdnd.h: removed enum GimpDndType... + + * app/widgets/widgets-enums.h: ...and added it here. + + * app/widgets/gimpdnd.c: added more g_return_if_fail(). Allow + all gimp_dnd_foo_dest_add() functions to be called without + callback (just add the target if callback is NULL). + + (gimp_dnd_open_files): removed the checks for validity of the + passed filenames/uris... + + (gimp_dnd_set_file_data): ...and added it here so all callbacks + get an already sanitized list of strings. + +2004-06-02 Sven Neumann <sven@gimp.org> + + * app/actions/Makefile.am (EXTRA_DIST) + * app/menus/Makefile.am (EXTRA_DIST): removed makefile.msc until + they have been added. + +2004-06-02 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcontainerview.c: create the hash table when + inserting items; removes redundant create/destroy cycles and plugs + a memory leak. + +2004-06-02 Sven Neumann <sven@gimp.org> + + * INSTALL: updated for gimp-2.1. Suggest to use gimp-print + version 4.2.7-pre1 in case of problems (see bug #138273). + +2004-06-02 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-dnd.c + (gimp_display_shell_drop_files): copy the merged layer, not the + first one. Preserve the type of the layer to make e.g. dropping an + XCF with a single text layer work. + +2004-06-02 Sven Neumann <sven@gimp.org> + + * NEWS + * README: updated. + +2004-06-02 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell.c (gimp_display_shell_init): accept + file/uri drops. + + * app/display/gimpdisplayshell-dnd.[ch] + (gimp_display_shell_drop_files): open any kind of image and turn + it into a single layer which is added to the image (suggested by + Antenne Springborn). + +2004-06-02 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/gradient_edit.pdb + * tools/pdbgen/pdb/gradients.pdb: mark new API as new using $since. + + * libgimp/gimpgradientedit_pdb.c + * libgimp/gimpgradients_pdb.c: regenerated. + +2004-06-02 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/gradient_edit.pdb: forgot two more s/int32/enum/. + + * app/pdb/gradient_edit_cmds.c + * libgimp/gimpgradientedit_pdb.[ch]: regenerated. + +2004-06-01 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/image.pdb + * app/pdb/image_cmds.c + * app/core/gimpimage.[ch]: reverted changes I did to the image + unit earlier. As in 2.0, it will continue to not accept pixels. + This makes the PDB API and the XCF format compatible again and + fixes bug #142961 (and to some extent bug #137704). + + * app/core/Makefile.am + * app/core/gimpimage-unit.[ch]: removed these files. The + convenience accessors defined here aren't commonly used any + longer. + + * app/display/gimpdisplay.[ch] + * app/display/gimpdisplayshell.[ch]: added a unit parameter to + gimp_display_new(). Made "unit" and "scale" properties of + GimpDisplayShell. + + * app/actions/image-commands.c + * app/actions/images-commands.c + * app/actions/layers-commands.c + * app/actions/select-commands.c + * app/actions/view-commands.c + * app/core/gimp-edit.c + * app/core/gimp.[ch] + * app/core/gimptemplate.c + * app/display/gimpdisplayshell-handlers.c + * app/display/gimpdisplayshell-scale.c + * app/display/gimpdisplayshell-title.c + * app/display/gimpstatusbar.c + * app/file/file-open.c + * app/gui/gui-vtable.c + * app/gui/info-window.c + * app/gui/offset-dialog.c + * app/gui/resize-dialog.[ch] + * app/pdb/display_cmds.c + * app/tools/gimpcroptool.c + * app/tools/gimpmeasuretool.c + * app/tools/gimppainttool.c + * app/tools/gimprectselecttool.c + * app/tools/gimprotatetool.c + * app/tools/gimpscaletool.c + * app/vectors/gimpvectors-export.c + * app/widgets/gimptoolbox-dnd.c + * tools/pdbgen/pdb/display.pdb: changed accordingly. Use the + display unit where the image unit was used before. + +2004-06-01 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/gradient_edit.pdb: use enums instead of + integers, cleanup. + + * app/pdb/gradient_edit_cmds.c + * libgimp/gimpgradientedit_pdb.[ch]: regenerated. + +2004-06-01 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdatafactory.[ch]: added new function + gimp_data_factory_data_delete(). + + * app/actions/data-commands.c (data_delete_callback): use it. + + * tools/pdbgen/pdb/gradients.pdb: applied (slightly modified) + patch from Shlomi Fish which adds PDB wrappers to create, delete, + duplicate and rename gradients. Fixes bug #143528. + + * app/pdb/gradients_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpgradients_pdb.[ch]: regenerated. + +2004-06-01 Michael Natterer <mitch@gimp.org> + + * app/core/core-enums.h: renamed the values of the + GimpGradientSegment* enums from GIMP_GRAD_* to + GIMP_GRADIENT_SEGMENT_* because they are exported now. + + * app/core/gimp-gradients.c + * app/core/gimpgradient.c + * app/actions/gradient-editor-actions.c: changed accordingly. + + * libgimp/gimpenums.h + * plug-ins/pygimp/gimpenums.py + * plug-ins/script-fu/script-fu-constants.c + * tools/pdbgen/enums.pl: regenerated. + +2004-06-01 Sven Neumann <sven@gimp.org> + + * plug-ins/common/tiff.c: don't call gtk_entry_set_text() with a + NULL text. + +2004-06-01 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainertreeview-dnd.c + * app/widgets/gimpitemtreeview.c: some cleanup in the tree view + DND code. + +2004-06-01 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpsessioninfo.c (gimp_session_info_restore): added + a horrible hack that sets the paned's position after the first + "size-allocate" after "map". Makes position remembering work for + the toolbox and fixes bug #142697. + + * app/widgets/gimpdockable.[ch]: added new function + gimp_dockable_set_tab_style() + + * app/actions/dockable-commands.c (dockable_tab_style_cmd_callback) + * app/widgets/gimpsessioninfo.c (gimp_session_info_restore): + use gimp_dockable_set_tab_style(). + +2004-06-01 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimptoolbox.c (toolbox_area_notify): removed + unused variable. + +2004-06-01 Sven Neumann <sven@gimp.org> + + * plug-ins/common/autocrop.c (query): register as "Autocrop Image" + and "Autocrop Layer". + +2004-06-01 Sven Neumann <sven@gimp.org> + + * app/actions/image-commands.c (image_new_cmd_callback): + initialize the dialog by calling file_new_dialog_set(). Fixes bug + #143477. + +2004-05-31 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcontainerentry.[ch]: export the column enum. + + * app/gui/file-open-location-dialog.c: use a GimpContainerEntry + on the documents list. Use a custom match function that matches + without the leading protocol part. + +2004-05-31 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/gimptoolbox-image-area.[ch]: new toolbox area which + shows the active image. + + * app/config/gimpguiconfig.[ch] + * app/config/gimprc-blurbs.h: added config options to control the + visibility of the toolbox' color, indicator and image areas. + + * app/widgets/gimptoolbox.[ch]: added the image area and honor the + new config options. Put the various areas into their own wrap box. + + * app/widgets/gimptoolbox-dnd.c: changed accordingly. + + * app/widgets/gimphelp-ids.h: added a help ID for the image area. + + * app/widgets/gimptoolbox-indicator-area.c: made the previews + a bit larger, cleanup. + + * app/gui/preferences-dialog.c: added a "Toolbox" page as GUI for + the new config options. + + * themes/Default/images/preferences/Makefile.am + * themes/Default/images/preferences/toolbox.png: a (wrong) icon + for the "Toolbox" prefs page. Needs to be replaced. + +2004-05-31 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcontainerentry.[ch]: added new widget + GimpContainerEntry, a GtkEntry with completion that implements the + GimpContainerView interface. + + * app/tools/gimptextoptions.c (gimp_text_options_gui): added a + GimpContainerEntry to select the font. + +2004-05-31 Sven Neumann <sven@gimp.org> + + * app/Makefile.am + * app/actions/file-actions.c + * app/actions/file-commands.[ch] + * app/gui/Makefile.am + * app/gui/file-open-location-dialog.[ch] + * app/widgets/gimphelp-ids.h + * menus/image-menu.xml.in + * menus/toolbox-menu.xml.in: added a rudimentary "Open Location" + dialog. + +2004-05-31 Sven Neumann <sven@gimp.org> + + * plug-ins/common/mblur.c (mblur_zoom): push pixels outwards not + to the center as suggested by Chad Daelhousen (bug #142968). + +2004-05-31 Sven Neumann <sven@gimp.org> + + * plug-ins/common/mblur.c: applied patch from William Skaggs that + adds the possibility to choose the center of radial and zoom + motion blurs (bug #113711). + +2004-05-31 Sven Neumann <sven@gimp.org> + + * app/paint/gimpconvolve.c + * app/paint-funcs/paint-funcs.[ch] + * app/tools/gimpiscissorstool.c: reverted last change and applied + new patch instead (bug #72878). + +2004-05-31 Sven Neumann <sven@gimp.org> + + * app/paint/gimpconvolve.c + * app/paint-funcs/paint-funcs.[ch] + * app/tools/gimpiscissorstool.c: applied a patch from Philip + Lafleur that fixes RGBA resampling in Convolve tool (bug #72878). + +2004-05-31 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_cmd_gimp_guides.c + * plug-ins/imagemap/imap_edit_area_info.c + * plug-ins/imagemap/imap_preferences.c + * plug-ins/imagemap/imap_settings.c: need to include gimpwidgets.h. + +2004-05-31 Michael Natterer <mitch@gimp.org> + + * app/core/core-enums.h + * app/core/gimpgradient.[ch] + * app/pdb/Makefile.am + * app/widgets/gimpgradienteditor.c + * tools/pdbgen/Makefile.am + * tools/pdbgen/groups.pl + * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi + Fish that adds lots of gradient edit functions to + gimpgradient.[ch] and makes them available through the PDB. + Fixes bug #129675 and bug #129678. + + Did some cleanups / enhancments to the patch: + + * app/core/gimpgradient.[ch]: changed the naming scheme of the new + functions and changed old functions to match the new scheme. + Introduce a "freeze_count" and public freeze()/thaw() API which + enables subsequent gradient changes without "dirty" being emitted + all the time. Added GimpGradient parameters to all functions + which modify the gradient. + + * app/widgets/gimpgradienteditor.c: use the new freeze/thaw + stuff to keep the gradient from updating when not in + "Instant Update" mode. + + * app/actions/gradient-editor-commands.c: removed all gradient + editing code and call the new core functions. + + * libgimp/Makefile.am + * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all + added functions. Generate libgimp wrappers for them.. + + * app/pdb/gradient_edit_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimp_pdb.h + * libgimp/gimpenums.h + * libgimp/gimpgradientedit_pdb.[ch] + * plug-ins/pygimp/gimpenums.py + * plug-ins/script-fu/script-fu-constants.c + * tools/pdbgen/enums.pl: (re)generated. + +2004-05-29 Sven Neumann <sven@gimp.org> + + * plug-ins/common/autocrop.c: applied patch from Philip Lafleur + that makes Autocrop register a new procedure that autocrops a + single layer as requested in bug #142618. + + * tools/pdbgen/pdb/layer.pdb + * app/pdb/layer_cmds.c + * libgimp/gimplayer_pdb.c: fixed documentation for gimp_resize_layer. + Patch provided by Philip Lafleur (bug #142618). + +2004-05-29 Sven Neumann <sven@gimp.org> + + * app/widgets/gimptemplateeditor.c + (gimp_template_editor_constructor): add the spinbuttons to the + size entry in the correct order. Fixes bug #143347. + +2004-05-28 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdnd.c (gimp_dnd_open_files): if the dropped + stuff is a local filename (no file URI), convert it to an + URI instead of forwarding it unmodified. + +2004-05-28 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimppreview.c (gimp_preview_button_press_event): + don't invoke the popup preview if there is no viewable. + +2004-05-28 Sven Neumann <sven@gimp.org> + + * app/widgets/gimppropwidgets.c: same workaround for tooltips on + combo boxes. + +2004-05-28 Sven Neumann <sven@gimp.org> + + * plug-ins/Lighting/lighting_ui.c + * plug-ins/MapObject/mapobject_ui.c + * plug-ins/common/warp.c + * plug-ins/gfig/gfig.c: tooltips can't be set on a GtkComboBox so + we need to pack it into a GtkEventBox when a tooltip is needed. + +2004-05-28 Michael Natterer <mitch@gimp.org> + + * app/text/gimpfont.c (gimp_font_get_popup_size) + (gimp_font_get_new_preview): take both logical and ink rectangle + into account to avoid clipping away parts of the font preview. + Fixes bug #142277. + +2004-05-28 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainerview.[ch]: added "preview-size" and + "preview-border-width" properties. Cleanup. + + * app/widgets/gimpcontainerbox.c + * app/widgets/gimpcontainercombobox.c: implement them. + +2004-05-28 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainergridview.[ch] + * app/widgets/gimpcontainertreeview.[ch]: removed "reorderable" + from gimp_container_foo_view_new(). + + * app/widgets/gimpcontainereditor.[ch]: removed "reorderable" from + gimp_container_editor_construct(). Automatically set the view to + reorderable if the viewed container has no sort_func. + + * app/widgets/gimpbufferview.c + * app/widgets/gimpdatafactoryview.c + * app/widgets/gimpdocumentview.c + * app/widgets/gimpimageview.c + * app/widgets/gimptemplateview.c + * app/widgets/gimptoolview.c + * app/widgets/gimpundoeditor.c: removed reoderable stuff because + GimpContainerEditor does this generically now. + + * app/widgets/gimpcontainerpopup.c + * app/widgets/gimpfontview.c: set reorderable to FALSE because + they should not be reodered even if they don't have a sort_func. + + * app/gui/font-select.c: removed reorderable stuff. Some cleanup. + + * app/gui/brush-select.c + * app/gui/gradient-select.c + * app/gui/palette-select.c + * app/gui/pattern-select.c: same cleanups as in font-select.c + +2004-05-28 Michael Natterer <mitch@gimp.org> + + * app/paint/gimpbrushcore.c + * app/paint/gimpdodgeburn.c + * app/paint/gimppaintcore.[ch] + * app/tools/gimpairbrushtool.c + * app/tools/gimpclonetool.c + * app/tools/gimpconvolvetool.c + * app/tools/gimpdodgeburntool.c + * app/tools/gimpinktool.c + * app/tools/gimppaintbrushtool.c + * app/tools/gimppenciltool.c + * app/tools/gimpsmudgetool.c: code review / cleanup. + +2004-05-28 Sven Neumann <sven@gimp.org> + + * plug-ins/common/CML_explorer.c + * plug-ins/maze/maze_face.c: added size groups. + + * plug-ins/common/sinus.c: HIG-ified. + +2004-05-28 Sven Neumann <sven@gimp.org> + + * plug-ins/Lighting/lighting_ui.c: tuned dialog layout for + consistency. + + * plug-ins/common/warp.c: added size groups to nicely align the + widgets. + +2004-05-27 Michael Natterer <mitch@gimp.org> + + * app/paint/gimp-paint.c (gimp_paint_init): register ink between + airbrush and clone so the stroke dialog's menu of paint functions + has the same order as the default toolbox order. + +2004-05-27 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintcore.[ch]: removed enum GimpPaintCoreFlags + and member GimpPaintCore::flags. Added "gboolean traces_on_window" + to GimpPaintCoreClass (defaults to FALSE). + + * app/paint/gimpclone.c: set traces_on_window = TRUE. + + * app/paint/gimpbrushcore.[ch]: added + "gboolean handles_changing_brush" to GimpBrushCoreClass (defaults + to FALSE). + + * app/paint/gimpclone.c + * app/paint/gimpdodgeburn.c + * app/paint/gimperaser.c + * app/paint/gimppaintbrush.c + * app/paint/gimppaintcore.c: set handles_changing_brush = TRUE. + + * app/tools/gimppainttool.c: changed accordingly. + +2004-05-27 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/common/ccanalyze.c: code clean-up. Improved speed a lot + (500 percent for 1000 x 1000 RGB image) by replacing O(n^2) algorithm + with O(n) version. + + * plug-ins/common/gif.c + * plug-ins/common/gih.c + * plug-ins/common/glasstile.c + * plug-ins/common/gqbist.c + * plug-ins/common/gradmap.c + * plug-ins/common/gtm.c + * plug-ins/common/guillotine.c: Use HIG capitalization style plus + minor code clean-up. + +2004-05-27 Sven Neumann <sven@gimp.org> + + * plug-ins/common/png.c (respin_cmap): handle an empty colormap. + Fixes bug #143009. + +2004-05-27 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimppickbutton.c: applied patch from Philip + Lafleur that fixes color picking for XInput devices (bug #143166). + +2004-05-27 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid): + fixed handling of grid offsets in the grid drawing routine. + +2004-05-27 Michael Natterer <mitch@gimp.org> + + * app/widgets/widgets-enums.[ch]: added enum GimpActiveColor which + can be one of { FOREGROUND, BACKGROUND }. + + * app/widgets/Makefile.am + * app/widgets/gimpfgbgeditor.[ch]: new widget implementing the + FG/BG/Swap/Default color area known from the toolbox. + + * app/widgets/gimptoolbox-color-area.c: use the new widget. + + * app/widgets/gimpcoloreditor.[ch]: replaced the FG/BG buttons and + the color area by a GimpFgBgEditor. + +2004-05-27 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdocumentview.c (gimp_document_view_new): + gimp_editor_add_action_button() takes a va_list, terminate + it with NULL. Fixes bug #143258. + +2004-05-26 Michael Natterer <mitch@gimp.org> + + * app/paint/gimpink.c: restored old time/speed sensitivity + behaviour by doing nothing except figuring if we draw a straight + line in INIT_PAINT. Instead, do all the Blob creating in + MOTION_PAINT and special case the initial (null) "motion" + accordingly. + +2004-05-26 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/common/video.c: code clean-up. Twice as fast now. + + * plug-ins/common/flarefx.c: removed timing stuff. + +2004-05-26 Sven Neumann <sven@gimp.org> + + * app/core/core-enums.[ch]: shorter names for the gradient types + to reduce the width of the blend tool options. + +2004-05-26 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/common/decompose.c + * plug-ins/common/deinterlace.c + * plug-ins/common/depthmerge.c + * plug-ins/common/despeckle.c + * plug-ins/common/destripe.c + * plug-ins/common/diffraction.c + * plug-ins/common/displace.c + * plug-ins/common/edge.c + * plug-ins/common/emboss.c + * plug-ins/common/engrave.c + * plug-ins/common/exchange.c + * plug-ins/common/film.c + * plug-ins/common/flarefx.c: Use HIG capitalization style. + Added GPL license in a few places. Minor code clean-up. + +2004-05-26 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcolordisplayeditor.c + * modules/cdisplay_colorblind.c + * modules/cdisplay_gamma.c + * modules/cdisplay_highcontrast.c + * modules/cdisplay_proof.c: HIG-ified color display filters. + +2004-05-26 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintcore.[ch]: added "guint32 time" parameters + to GimpPaintCore::paint() and ::interpolate(). + + * app/paint/gimpairbrush.c + * app/paint/gimpbrushcore.c + * app/paint/gimpclone.c + * app/paint/gimpconvolve.c + * app/paint/gimpdodgeburn.c + * app/paint/gimperaser.c + * app/paint/gimppaintbrush.c + * app/paint/gimpsmudge.c: changed accordingly. + + * app/paint/gimpink.c: ditto and use the passed time instead of + hardcoded dummy values. + + * app/paint/gimppaintcore-stroke.c: pass '0' as time. + + * app/tools/gimppainttool.c: pass the GdkEvent time. + +2004-05-26 Michael Natterer <mitch@gimp.org> + + * app/paint/Makefile.am + * app/paint/gimpink-blob.[ch] + * app/paint/gimpink.[ch] + * app/paint/gimpinkoptions.[ch]: new files. Ported the ink tool + to be a direct GimpPaintCore subclass without any GUI. + + * app/paint/gimp-paint.c: register GimpInk with the list of paint + cores. + + * app/tools/Makefile.am + * app/tools/gimpinkoptions.[ch] + * app/tools/gimpinktool-blob.[ch]: removed these files. + + * app/tools/gimpinkoptions-gui.[ch]: new files containing only + the GUI for GimpInkOptions. + + * app/tools/gimpinktool.[ch]: reduced to some few lines which + implement a simple GimpPaintTool subclass. + + * app/tools/gimp-tools.c: associate the GimpInk paint_core with + the GimpInkTool. + +2004-05-26 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintcore-stroke.c: check if we really have + a GimpBrushCore before casting and accessing its members. + +2004-05-26 Michael Natterer <mitch@gimp.org> + + * app/paint/gimpbrushcore.h + * app/paint/gimppaintcore.h: some cleanup. + +2004-05-26 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-layer-select.c + * app/display/gimpprogress.c + * app/gui/brush-select.c + * app/gui/color-notebook.c + * app/gui/convert-dialog.c + * app/gui/font-select.c + * app/gui/gradient-select.c + * app/gui/info-dialog.c + * app/gui/offset-dialog.c + * app/gui/palette-select.c + * app/gui/pattern-select.c + * app/gui/stroke-dialog.c + * app/gui/tips-dialog.c + * app/tools/gimpmeasuretool.c + * app/tools/gimptexttool.c + * app/widgets/gimpcolordisplayeditor.c + * app/widgets/gimpcolorframe.c + * app/widgets/gimpdevicestatus.c + * app/widgets/gimpviewabledialog.c: adjusted dialog spacings. + +2004-05-26 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintcore.c: don't do special stuff if a virtual + function doesn't exist. Instead, added default implementations + which do the special stuff and call the virtual functions + unconditionally. + + * app/tools/gimppainttool.c: some stylistic cleanup. + +2004-05-26 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintcore.[ch] (gimp_paint_core_paste) + (gimp_paint_core_replace): replaced the "MaskBuf *paint_mask" + parameters by "PixelRegion *mask_bufPR", so subclasses can pass in + any kind of paint_mask buffer and are not restricted to MaskBufs. + + Also removes implicit knowledge about the MaskBuf originating from + a brush in paint_mask_to_canvas_buf() and _to_canvas_tiles() which + don't need to offset the mask by width/2 height/2 any more. + + Made gimp_paint_core_validate_undo_tiles() and + gimp_paint_core_validate_canvas_tiles() protected functions. + + * app/paint/gimpbrushcore.c (gimp_brush_core_paste_canvas) + (gimp_brush_core_replace_canvas): create correctly positioned + PixelRegions from the MaskBufs before passing them to the + paint_core. + +2004-05-26 Michael Natterer <mitch@gimp.org> + + * app/paint/gimppaintcore.[ch]: removed "gdouble scale" parameter + and added "GimpPaintOptions" in GimpPaintCore::get_paint_area(). + Check if virtual functions exist befoe calling them. + + * app/paint/gimpbrushcore.[ch]: added "gdouble scale" to GimpBrushCore + and "gboolean use_scale" to GimpBrushCoreClass (defaults to TRUE). + Set scale from paint_options in GimpPaintCore::get_paint_area(). + Removed "scale" parameter from gimp_brush_core_paste_canvas() + and _replace_canvas(). + + * app/paint/gimpsmudge.c (gimp_smudge_class_init): set use_scale + to FALSE. + + * app/paint/gimpclone.c + * app/paint/gimpconvolve.c + * app/paint/gimpdodgeburn.c + * app/paint/gimperaser.c + * app/paint/gimppaintbrush.c: removed all scale calculations and + simply pass paint_options to GimpPaintCore::get_paint_area(). + +2004-05-26 Michael Natterer <mitch@gimp.org> + + * app/tools/gimppainttool.c (gimp_paint_tool_button_press): check + if the GimpPaintCore really is a GimpBrushCore before casting and + fiddling with internaly. + +2004-05-25 Michael Natterer <mitch@gimp.org> + + * app/paint/Makefile.am + * app/paint/gimpbrushcore-kernels.h + * app/paint/gimpbrushcore.[ch]: new GimpPaintCore subclass + containing all the brush painting specific stuff. + + * app/paint/gimppaintcore-kernels.h: removed this file. + + * app/paint/gimppaintcore.[ch]: removed all brush stuff. + + * app/paint/gimpairbrush.c + * app/paint/gimpclone.[ch] + * app/paint/gimpconvolve.[ch] + * app/paint/gimpdodgeburn.[ch] + * app/paint/gimperaser.[ch] + * app/paint/gimppaintbrush.[ch] + * app/paint/gimppencil.c + * app/paint/gimpsmudge.[ch]: changed accordingly. Derive all + classes which used to derive directly from GimpPaintCore from + GimpBrushCore now. Lots of cleanup. + + * app/paint/paint-types.h + * app/paint/gimp-paint.c + * app/paint/gimppaintcore-stroke.c + * app/tools/gimppainttool.c + * tools/kernelgen.c: changed accordingly. + +2004-05-25 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/common/align_layers.c + * plug-ins/common/animoptimize.c + * plug-ins/common/animationplay.c + * plug-ins/common/apply_lens.c + * plug-ins/common/autocrop.c + * plug-ins/common/autostretch_hsv.c + * plug-ins/common/blinds.c + * plug-ins/common/blur.c + * plug-ins/common/borderaverage.c + * plug-ins/common/bz2.c + * plug-ins/common/c_astretch.c + * plug-ins/common/ccanalyze.c + * plug-ins/common/channel_mixer.c + * plug-ins/common/color_enhance.c + * plug-ins/common/colorify.c + * plug-ins/common/colortoalpha.c + * plug-ins/common/csource.c + * plug-ins/common/cubism.c + * plug-ins/common/curve_bend.c: Use HIG capitalization style. + Added GPL license in a few places. Minor code clean-up. + +2004-05-25 Sven Neumann <sven@gimp.org> + + Sorry, couldn't resist to finish this task... + + * plug-ins/script-fu/script-fu-console.c + * plug-ins/script-fu/script-fu-scripts.c + * plug-ins/script-fu/script-fu-server.c: HIG-ified. + +2004-05-25 Sven Neumann <sven@gimp.org> + + * plug-ins/gimpressionist/brush.c + * plug-ins/gimpressionist/color.c + * plug-ins/gimpressionist/general.c + * plug-ins/gimpressionist/gimpressionist.[ch] + * plug-ins/gimpressionist/orientation.c + * plug-ins/gimpressionist/orientmap.c + * plug-ins/gimpressionist/paper.c + * plug-ins/gimpressionist/placement.c + * plug-ins/gimpressionist/presets.c + * plug-ins/gimpressionist/preview.c + * plug-ins/gimpressionist/size.c + * plug-ins/gimpressionist/sizemap.c: HIG-ified. + +2004-05-25 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpitemtreeview.h: added GimpContext parameters + to GimpActivateItemFunc, GimpNewItemFunc and GimpEditItemFunc. + + * app/widgets/gimpdrawabletreeview.c + * app/widgets/gimpitemtreeview.c: pass the view's context to + the functions. + + * app/actions/actions.c (action_data_get_context): return + gimp_get_user_context() if "data" is a Gimp. + + * app/actions/channels-commands.[ch] + * app/actions/layers-commands.[ch] + * app/actions/vectors-commands.[ch]: added GimpContext parameters + to the resp. activate, new and edit functions and use the passed + context instead of gimp_get_user_context(). + + * app/actions/layers-commands.[ch]: removed the merge and flatten + callbacks. + + * app/actions/image-commands.[ch]: made public layer merge utility + function private and cleaned the whole file up a lot. + + * app/actions/layers-actions.c: use the callbacks from + image-commands.c for merge and flatten. + + * app/actions/edit-commands.c + * app/actions/file-commands.c + * app/actions/select-commands.c: use action_data_get_context() + instead of gimp_get_user_context(). + + * app/actions/edit-actions.c: some cleanup. + +2004-05-25 Sven Neumann <sven@gimp.org> + + * plug-ins/common/plugindetails.c + * plug-ins/dbbrowser/dbbrowser_utils.c + * plug-ins/pagecurl/pagecurl.c: HIG-ified. + +2004-05-25 Sven Neumann <sven@gimp.org> + + * plug-ins/print/gimp_color_window.c + * plug-ins/print/gimp_main_window.c: HIG-ified and ported to + GtkFileChooser. + + * plug-ins/ifscompose/ifscompose.c (ifsfile_load_response): ported + forgotten callback to GtkFileChooser. + + * plug-ins/imagemap/imap_browse.c + * plug-ins/imagemap/imap_file.c: finished port to GtkFileChooser. + +2004-05-25 Michael Natterer <mitch@gimp.org> + + * app/actions/file-actions.c + * app/actions/file-commands.[ch]: removed action "file-new", added + action "file-open-from-image". + + * app/actions/image-actions.c + * app/actions/image-commands.[ch]: added actions "image-new" and + "image-new-from-image". + + * menus/image-menu.xml.in: use the "-from-image" variants of + the "new" and "open" actions so the dialogs are preconfigured + from the image they were invoked from (regression fix). + + * menus/toolbox-menu.xml.in: s/file-new/image-new/. + +2004-05-24 Sven Neumann <sven@gimp.org> + + * plug-ins/rcm/rcm.h + * plug-ins/rcm/rcm_dialog.[ch]: rearranged and HIG-ified dialog. + +2004-05-24 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimptoolbox.c (toolbox_create_tools): added an evil + hack as workaround for the missing gtk_action_get_accel_closure(). + Re-enables accelerator display in the tool button tooltips. + +2004-05-24 Michael Natterer <mitch@gimp.org> + + * app/vectors/Makefile.am + * app/vectors/gimpcoordmath.[ch]: removed... + + * app/core/Makefile.am + * app/core/gimpcoords.[ch]: ...and added without the "bezier" + namespace. + + * app/vectors/gimpbezierstroke.c: changed accordingly. + + * app/Makefile.am: force it to link gimpcoords.o + +2004-05-24 Michael Natterer <mitch@gimp.org> + + * app/config/gimpconfigwriter.c + * app/core/gimpstrokeoptions.c + * app/widgets/gimpactiongroup.c + * app/widgets/gimpcolorframe.h + * app/widgets/gimpcolorpanel.h + * app/widgets/gimpcontainerview.[ch] + * app/widgets/gimptooldialog.h + * app/widgets/gimpuimanager.c + * app/widgets/widgets-types.h: fixed various small issues I + stumbled across when updating the API reference for app/. + +2004-05-24 Sven Neumann <sven@gimp.org> + + * app/display/gimpscalecombobox.c + (gimp_scale_combo_box_mru_remove_last): removed debugging output. + +2004-05-24 Sven Neumann <sven@gimp.org> + + * app/core/gimptoolinfo.[ch]: derive GimpToolInfo from + GimpViewable, it doesn't make sense for it to be a GimpData. + + * app/widgets/gimptooloptionseditor.c + (gimp_tool_options_editor_get_title): do not append " Options" to + the tool name. Fixes bug #142280. + +2004-05-24 Sven Neumann <sven@gimp.org> + + * plug-ins/common/mblur.c: fixed range check of blur type + parameter (bug #142965). + +2004-05-24 Sven Neumann <sven@gimp.org> + + * plug-ins/maze/maze_face.c: fixed a compiler warning. + +2004-05-24 Sven Neumann <sven@gimp.org> + + Applied a patch from Philip Lafleur (bug #142808): + + * app/paint/gimppaintcore.h: define PRESSURE_SCALE to 1.5 + + * app/paint/gimpairbrush.c + * app/paint/gimpclone.c + * app/paint/gimpconvolve.c + * app/paint/gimpdodgeburn.c + * app/paint/gimperaser.c + * app/paint/gimppaintbrush.c + * app/paint/gimpsmudge.c: use the PRESSURE_SCALE constant. + +2004-05-24 Michael Natterer <mitch@gimp.org> + + Long overdue core container cleanup: + + * app/core/gimplist.[ch]: added "unique-names" and "sort-func" + properties and merged the resp. code from GimpDataList into + GimpList. Removed "policy" parameters from gimp_list_new() and + added "unique_names". Added new constructor gimp_list_new_weak(). + Made public function gimp_list_uniquefy_name() private. + + * app/core/Makefile.am + * app/core/core-types.h + * app/core/gimpdatalist.[ch]: removed. Its functionality is + entirely in GimpList now. + + * app/core/gimpdata.[ch]: added gimp_data_name_compare() which + used to live in GimpDataList. + + * app/core/gimp.c + * app/core/gimpdatafactory.c + * app/core/gimpimage.c + * app/core/gimptoolinfo.c + * app/core/gimpundostack.c + * app/paint/gimp-paint.c + * app/tools/gimp-tools.c + * app/widgets/gimpdevices.c + * app/widgets/gimptemplateeditor.c + * app/widgets/gimpundoeditor.c: changed list creation accordingly. + + Made gimp->templates, gimp->named_buffers, tool_info->presets and + the image's lists of layers, channels and vectors automatically + ensure unique names. + + * app/widgets/gimptemplateview.c + * app/actions/file-commands.c + * app/actions/templates-commands.c + * app/actions/tool-options-commands.c: removed calls to + gimp_list_uniquefy_name(). + + * app/core/gimpitem.c: removed major insanity where the items + themselves where ensuring their unique names. Bah! + + * app/core/gimplayer.c (gimp_layer_name_changed): chain up + conditionally. + + * app/core/gimplayermask.c (gimp_layer_mask_name_changed): removed + because there is no need any more to keep the parent + implementation from being invoked. + +2004-05-23 Sven Neumann <sven@gimp.org> + + More fixes for bug #142996: + + * plug-ins/common/postscript.c + * plug-ins/common/sparkle.c + * plug-ins/common/sunras.c + * plug-ins/common/uniteditor.c + * plug-ins/fits/fits.c: fixed typos. + +2004-05-23 Sven Neumann <sven@gimp.org> + + Fixes for bug #142996: + + * app/gui/preferences-dialog.c: added missing gettext call. + + * app/config/gimprc-blurbs.h + * app/core/gimptemplate.c + * app/gui/gradient-editor-menu.c: fixed typos. + +2004-05-23 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdatalist.c: code cleanup, no logic changed. + +2004-05-23 Henrik Brix Andersen <brix@gimp.org> + + * app/config/gimprc-blurbs.h + * plug-ins/gfig/gfig-spiral.c (spiral_button_press) + * plug-ins/gimpressionist/orientation.c (create_orientationpage) + * plug-ins/common/diffraction.c (diffraction_dialog) + * plug-ins/common/bumpmap.c (bumpmap_dialog) + * plug-ins/maze/maze.h + * plug-ins/MapObject/mapobject_apply.c (compute_image) + * app/tools/gimpmeasuretool.c (gimp_measure_tool_dialog_update) + * plug-ins/print/gimp_main_window.c (create_scaling_frame): marked + strings for translation, corrected small typos. Fixes part of bug + #142996 + +2004-05-23 Žygimantas Beručka <uid0@akl.lt> + + * configure.in: Added "lt" to ALL_LINGUAS. + +2004-05-23 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimp/gimp.def: gimp_register_file_handler_mime added + +2004-05-23 Michael Natterer <mitch@gimp.org> + + * app/widgets/widgets-types.h: reoedered to somehow reflect the + class hierarchy. + + Some dockable context handling cleanup: + + * app/widgets/gimpdocked.[ch]: removed "prev_context" parameter + from GimpDocked::set_context(). Widgets which need the old context + to disconnect from should remember it themselves. + + * app/widgets/gimpdockable.c (gimp_dockable_set_context): don't + pass the old context to gimp_docked_set_context(). + Some cleanup. + + * app/widgets/gimpcontainerbox.c + * app/widgets/gimpcontainereditor.c: changed accordingly. + + * app/display/gimpnavigationview.[ch] + * app/widgets/gimpimageeditor.[ch] + * app/widgets/gimpitemtreeview.[ch]: added a "context" member + which holds the context set by GimpDocked::set_context(). + + * app/widgets/gimpdrawabletreeview.c: use the view's context + instead of gimp_get_user_context(). + + * app/widgets/gimpcoloreditor.[ch]: removed separate API to + set the context because it implements the GimpDockedInterface. + + * app/widgets/gimpcomponenteditor.c + * app/widgets/gimperrorconsole.c: pass "menu-factory", + "menu-identifier" and "ui-path" to g_object_new() instead of + calling gimp_editor_create_menu() later. + + Action cleanup partly related to the context stuff above: + + * app/actions/actions.c (action_data_get_gimp): get the Gimp from + context->gimp, not gimage->gimp because gimage may be NULL. + + (action_data_get_context): changed to use the new context members + added above. + + * app/actions/channels-actions.c (channels_actions_update): cleanup. + + * app/actions/edit-actions.c (edit_actions_update): fixed + sensitivity of "edit-undo-clear". + + * app/actions/vectors-actions.c (vectors_actions_update): make + "vectors-merge-visible" sensitive only if there is more than one + GimpVectors in the image. + + * app/actions/colormap-editor-actions.c + * app/actions/gradient-editor-actions.c + * app/actions/palette-editor-actions.c: added FG/BG color previews + to actions which take colors from them. Changed code to be safe + against "context" being NULL. + + * app/actions/drawable-commands.c: + s/active_drawable/drawable/g. Makes the code more readable. + + * app/actions/select-commands.[ch] + * app/actions/vectors-commands.[ch]: removed public stroke utility + functions and other stuff which is not needed any more because + dialog buttons invoke the correct actions now. Moved the + functions' code to the resp. action callbacks. + +2004-05-21 Nathan Summers <rock@gimp.org> + + Somehow some of the changes from my commit on 2004-05-18 seem to have + gotten lost, including the addition to the ChangeLog. Sorry about that. + Recommitted. + + * NEWS: Clarified end-user visible features. + Made sundry small grammar and consistancy fixes. + Reorganized list of changes slightly. + +2004-05-21 Sven Neumann <sven@gimp.org> + + * app/paint/gimppaintcore.c (gimp_paint_core_interpolate): better + fix for bug #123811; patch provided by Philip Lafleur. + +2004-05-21 Sven Neumann <sven@gimp.org> + + * app/gui/preferences-dialog.c: added some GtkSizeGroups and + changed spacings to improve the dialog layout. + + * app/gui/file-new-dialog.c + * app/widgets/gimpgrideditor.c + * app/widgets/gimptemplateeditor.c: minor changes for consistency. + +2004-05-21 Sven Neumann <sven@gimp.org> + + * plug-ins/gflare/gflare.c + * plug-ins/gfli/gfli.c + * plug-ins/ifscompose/ifscompose.c + * plug-ins/sel2path/sel2path.c + * plug-ins/sel2path/sel2path_adv_dialog.c + * plug-ins/sgi/sgi.c + * plug-ins/winicon/icodialog.c: HIG-ification. + +2004-05-21 Michael Natterer <mitch@gimp.org> + + * app/actions/data-commands.c (data_delete_callback): eek, delete + the data only if "OK" was pressed. + +2004-05-21 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimperrorconsole.c + (gimp_error_console_save_ext_clicked): use + gtk_widget_get_screen(), not window_get_screen() on a button. + +2004-05-20 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/imagemap/imap_*.[ch]: (partly) HIG-ified, replaced + deprecated widget GtkCList by GtkTreeModel/View (also fixes #136893), + use file choosers instead of file selectors, minor clean-up. + +2004-05-20 Sven Neumann <sven@gimp.org> + + * plug-ins/Lighting/lighting_ui.c + * plug-ins/MapObject/mapobject_ui.c + * plug-ins/bmp/bmpwrite.c + * plug-ins/fits/fits.c + * plug-ins/flame/flame.c + * plug-ins/fp/fp.c + * plug-ins/gfig/gfig-preview.c + * plug-ins/gfig/gfig.c: HIG-ified. + +2004-05-20 Sven Neumann <sven@gimp.org> + + * plug-ins/FractalExplorer/Dialogs.c + * plug-ins/FractalExplorer/FractalExplorer.c: HIG-ification and + some code cleanup. + +2004-05-19 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/gimpfu.py: Actually return values from the run + function. Fixes #141338. + +2004-05-20 Sven Neumann <sven@gimp.org> + + * plug-ins/maze/maze_face.c + * plug-ins/xjt/xjt.c: HIG-ified. Say goodbye to "Parameter Settings". + +2004-05-20 Sven Neumann <sven@gimp.org> + + * plug-ins/common/warp.c + * plug-ins/common/whirlpinch.c + * plug-ins/common/wmf.c + * plug-ins/common/xbm.c + * plug-ins/common/xpm.c: HIG-ified. + +2004-05-19 Manish Singh <yosh@gimp.org> + + * app/actions/file-actions.c: remove unnecessary G_OBJECT() casts. + + * tools/pdbgen/pdb/help.pdb + * tools/pdbgen/pdb/image.pdb + * tools/pdbgen/pdb/paths.pdb + * tools/pdbgen/pdb/plug_in.pdb: a bit of quoting clean up. + + * tools/pdbgen/pdb/plug_in.pdb: handle icon_data_length properly. + + * app/pdb/plug_in_cmds.c: regenerated. + +2004-05-20 Sven Neumann <sven@gimp.org> + + * plug-ins/common/tga.c + * plug-ins/common/threshold_alpha.c + * plug-ins/common/tiff.c + * plug-ins/common/tile.c + * plug-ins/common/tileit.c + * plug-ins/common/uniteditor.c + * plug-ins/common/unsharp.c + * plug-ins/common/video.c + * plug-ins/common/vpropagate.c: HIG-ified. + +2004-05-20 Sven Neumann <sven@gimp.org> + + * plug-ins/common/randomize.c + * plug-ins/common/ripple.c + * plug-ins/common/sample_colorize.c + * plug-ins/common/scatter_hsv.c + * plug-ins/common/sel_gauss.c + * plug-ins/common/sharpen.c + * plug-ins/common/shift.c + * plug-ins/common/smooth_palette.c + * plug-ins/common/snoise.c + * plug-ins/common/sobel.c + * plug-ins/common/sparkle.c + * plug-ins/common/spread.c + * plug-ins/common/struc.c + * plug-ins/common/sunras.c + * plug-ins/common/svg.c: HIG-ified. + +2004-05-19 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpaction.[ch]: new GtkAction subclass which can + show either a color or viewable preview in GtkImageMenuItem + proxies. + + * app/widgets/gimpenumaction.[ch] + * app/widgets/gimppluginaction.[ch] + * app/widgets/gimpstringaction.[ch]: derive them from GimpAction. + + * app/widgets/gimpactiongroup.c (gimp_action_group_add_actions): + add GimpActions, not GtkActions. + + (gimp_action_group_set_action_color) + (gimp_action_group_set_action_viewable): removed all hacks and + simply set the "color" or "viewable" properties of the GimpAction + to change. Fixes color/viewable previews in menus. + + * app/actions/file-actions.c: show previews in the "Open Recent" + menu items. + + Unrelated: + + * app/widgets/widgets-types.h: removed GimpDockedInterface typedef... + + * app/widgets/gimpdocked.h: ...and added it here. We don't have + class struct typedefs in the types header either. + + * app/actions/edit-actions.c: added <Ctrl>+semicolon as shortcut + for "edit-fill-pattern". + + * app/actions/gradient-editor-actions.c: added some stock IDs. + Please comment. + +2004-05-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/papertile.c + * plug-ins/common/pat.c + * plug-ins/common/pixelize.c + * plug-ins/common/png.c + * plug-ins/common/postscript.c + * plug-ins/common/psp.c: HIG-ified. + +2004-05-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/mapcolor.c + * plug-ins/common/mblur.c + * plug-ins/common/mng.c + * plug-ins/common/mosaic.c + * plug-ins/common/newsprint.c + * plug-ins/common/oilify.c: HIG-ified. + +2004-05-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/hot.c + * plug-ins/common/iwarp.c + * plug-ins/common/jpeg.c + * plug-ins/common/lic.c + * plug-ins/common/mail.c: HIG-ified. + +2004-05-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/gauss_iir.c + * plug-ins/common/gauss_rle.c + * plug-ins/common/gbr.c + * plug-ins/common/gee.c + * plug-ins/common/gee_zoom.c + * plug-ins/common/gif.c + * plug-ins/common/gih.c + * plug-ins/common/glasstile.c + * plug-ins/common/gtm.c: HIG-ified. + +2004-05-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/exchange.c: fixed minor dialog layout issues. + + * plug-ins/common/screenshot.c: added the camera icon to the dialog. + + * plug-ins/common/film.c + * plug-ins/common/fractaltrace.c: HIG-ified. + +2004-05-19 Sven Neumann <sven@gimp.org> + + * app/paint/gimppaintcore.c (gimp_paint_core_interpolate): make + sure that pressure never becomes negative. Fixes bug #123811; + thanks to Philip Lafleur for investigating this problem. + +2004-05-19 Sven Neumann <sven@gimp.org> + + * plug-ins/common/channel_mixer.c: added some stock icons. + + * plug-ins/common/edge.c + * plug-ins/common/emboss.c + * plug-ins/common/engrave.c + * plug-ins/common/exchange.c: HIG-ified. + + * plug-ins/common/sel_gauss.c: tiny changes for a more consistent + HIG-ification. + +2004-05-19 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/plug_in.pdb: made plugin_icon_register() an + underscore-prefixed function which needs to be wrapped. + + * libgimp/gimpplugin_pdb.[ch]: regenerated. + + * libgimp/Makefile.am + * libgimp/gimp.h + * libgimp/gimpplugin.[ch]: new files containing + gimp_plugin_icon_register() which has no "icon_data_length" + parameter and determines it from the passed icon data. + + * libgimp/gimp.def: added gimp_plugin_icon_register. + + * plug-ins/common/plugindetails.c + * plug-ins/common/screenshot.c + * plug-ins/common/uniteditor.c + * plug-ins/print/print.c: don't pass the icon_data_length. + +2004-05-18 Sven Neumann <sven@gimp.org> + + * plug-ins/common/checkerboard.c + * plug-ins/common/colorify.c + * plug-ins/common/colortoalpha.c + * plug-ins/common/compose.c + * plug-ins/common/convmatrix.c + * plug-ins/common/csource.c + * plug-ins/common/cubism.c + * plug-ins/common/decompose.c + * plug-ins/common/deinterlace.c + * plug-ins/common/depthmerge.c + * plug-ins/common/despeckle.c + * plug-ins/common/destripe.c + * plug-ins/common/diffraction.c + * plug-ins/common/displace.c: HIG-ified. + +2004-05-18 Michael Natterer <mitch@gimp.org> + + Allow plug-ins to register menu icons. Fixes bug #120500. + + * app/core/core-enums.[ch]: added enum GimpIconType which can + be one of { STOCK_ID, IMAGE_FILE, INLINE_PIXBUF }. + + * app/config/gimpconfigwriter.[ch] (gimp_config_writer_data) + * app/config/gimpscanner.[ch] (gimp_scanner_parse_data): new + functions which write/parse raw binary data. Needed for storing + inline pixbufs in pluginrc. + + * app/config/gimpconfigwriter.[ch] (gimp_config_writer_identifier): + new function which writes out an unquoted and unescaped string. + + * app/plug-in/plug-in-proc.[ch] (struct PlugInProcDef): added + new members "icon_type", "icon_data_length" and "icon_data". + Reordered members so file_proc specific stuff is at the end. + + (plug_in_proc_def_get_stock_id) + (plug_in_proc_def_get_pixbuf): new functions to access the + procedure's icon. + + * app/plug-in/plug-in-rc.c: save/restore the registered icons. + + * app/actions/file-dialog-actions.c + * app/actions/plug-in-actions.c: set the action's stock ID from + the procedure's stock ID. + + * app/widgets/gimppluginaction.c + (gimp_plug_in_action_connect_proxy): if the procedure provides a + pixbuf, set it as icon for the menu item. + + * app/menus/file-dialog-menu.[ch] + * app/menus/file-open-menu.c + * app/menus/file-save-menu.c + * app/xcf/xcf.c: changed accordingly. + + * tools/pdbgen/pdb/plug_in.pdb (plugin_icon_register): new PDB + function which can be called during query(). + + * tools/pdbgen/enums.pl + * app/pdb/internal_procs.c + * app/pdb/plug_in_cmds.c + * libgimp/gimpenums.h + * libgimp/gimpplugin_pdb.c + * libgimp/gimpplugin_pdb.h + * plug-ins/pygimp/gimpenums.py + * plug-ins/script-fu/script-fu-constants.c: regenerated. + + * plug-ins/common/plugindetails.c + * plug-ins/common/uniteditor.c + * plug-ins/print/print.c: register stock_id icons. + + * plug-ins/common/screenshot.c: register an inline_pixbuf icon for + testing purposes (used emblem-camera.png from gnome-icon-theme). + + * app/actions/dialogs-actions.c + * app/actions/file-actions.c: unrelated: added some more icons + to menu items. + +2004-05-18 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/common/sel_gauss.c: HIGified, fixed indendation, speed + improvement (around 70 %). + +2004-05-18 Sven Neumann <sven@gimp.org> + + * plug-ins/common/blur.c + * plug-ins/common/borderaverage.c + * plug-ins/common/bumpmap.c + * plug-ins/common/ccanalyze.c: HIG-ified. + +2004-05-18 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpsizeentry.[ch] (gimp_size_entry_attach_label): + return the created label widget so that it can for example be put + into a GtkSizeGroup. + + * plug-ins/libgimpoldpreview/gimpoldpreview.[ch]: removed the + optional "Preview" frame. Always put the preview into a sunken + frame. + + * plug-ins/common/AlienMap2.c + * plug-ins/common/blinds.c + * plug-ins/common/flarefx.c + * plug-ins/common/glasstile.c + * plug-ins/common/grid.c + * plug-ins/common/illusion.c + * plug-ins/common/jigsaw.c + * plug-ins/common/max_rgb.c + * plug-ins/common/nlfilt.c + * plug-ins/common/noisify.c + * plug-ins/common/nova.c + * plug-ins/common/plasma.c + * plug-ins/common/polar.c + * plug-ins/common/waves.c + * plug-ins/common/wind.c: changed accordingly, HIG-ified. + +2004-05-18 Sven Neumann <sven@gimp.org> + + * plug-ins/common/aa.c + * plug-ins/common/align_layers.c + * plug-ins/common/animationplay.c + * plug-ins/common/apply_lens.c: HIG-ified. + +2004-05-18 Michael Natterer <mitch@gimp.org> + + * app/core/gimptoolinfo.c: made the "visible" property serializable. + + * app/tools/gimp-tools.c: store the tools' order and visibility + in a new config file called "toolrc". + +2004-05-18 Sven Neumann <sven@gimp.org> + + * plug-ins/gimpressionist/brush.c: ported to GtkFileChooser. + + * plug-ins/gimpressionist/gimpressionist.h + * plug-ins/gimpressionist/ppmtool.[ch]: sprinkled some const + qualifiers. + +2004-05-18 Sven Neumann <sven@gimp.org> + + * plug-ins/common/curve_bend.c + * plug-ins/ifscompose/ifscompose.c: ported to GtkFileChooser and + HIG-ified. + +2004-05-18 Sven Neumann <sven@gimp.org> + + * plug-ins/common/channel_mixer.c + * plug-ins/common/gqbist.c: ported to GtkFileChooser and + HIG-ified. + + * plug-ins/common/spheredesigner.c: ditto, but needs more love. + +2004-05-18 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-proc.[ch] (plug_in_proc_def_get_label): new + function which returns a newly allocated string which is the menu + item's name stripped of mnemonics an ellipses. + + * app/actions/plug-in-actions.c (plug_in_actions_update) + * app/plug-in/plug-in.c (plug_in_get_undo_desc): use the function + instead of implementing the same twice slightly different. + +2004-05-17 Sven Neumann <sven@gimp.org> + + * plug-ins/common/CEL.c + * plug-ins/common/CML_explorer.c: ported to GtkFileChooser and + HIG-ified. + +2004-05-17 Sven Neumann <sven@gimp.org> + + * plug-ins/common/AlienMap2.c: HIG-ified (more or less). + +2004-05-17 Michael Natterer <mitch@gimp.org> + + * menus/menus.xsl: put the image popup menu into a dummy menubar + to work around the silly GtkUIManager restriction that popup menus + can't have tearoff items. + + * app/menus/menus.c + * app/menus/image-menu.c + * app/display/gimpdisplayshell-callbacks.c + * app/gui/gui-vtable.c + * app/menus/plug-in-menus.c: changed accordingly. + + * app/gui/gui.c (gui_restore_after_callback): connect to + "notify::tearoff-menus" of GimpGuiConfig and reconfigure the + global image UI manager accordingly. + + * app/config/gimpguiconfig.c: removed GIMP_PARAM_RESTART from the + "tearoff-menus" property because GtkUIManager can change this on + the fly. + + * app/display/gimpdisplayshell.[ch]: added the menubar to the + GimpDisplayShell struct. Some cleanup in gimp_display_shell_new(). + + * app/display/gimpdisplayshell-appearance.c + (gimp_display_shell_set_show_menubar): use shell->menubar instead + of asking the UI manager. + + * app/widgets/gimpuimanager.[ch]: changed gimp_ui_manager_ui_get() + to transparently load the XML files even if a sub-widget was + requested. Reordered parameters of gimp_ui_manager_ui_popup(). + Lots of internal cleanups. + + * app/widgets/gimpdockable.c + * app/widgets/gimptooloptionseditor.c: simplified accordingly. + + * app/widgets/gimpeditor.[ch]: added new function + gimp_editor_popup_menu() which takes a GimpMenuPositionFunc and + updates/shows the editor's menu. + + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimpcomponenteditor.c + * app/widgets/gimpcontainereditor.c + * app/widgets/gimpcontainergridview.c + * app/widgets/gimpcontainertreeview.c + * app/widgets/gimperrorconsole.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimppaletteeditor.c: use gimp_editor_popup_menu(). + + * app/widgets/gimptoolbox.c: moved all code from + gimp_toolbox_new() to GObject::constructor(). + +2004-05-17 Michael Natterer <mitch@gimp.org> + + * app/actions/tool-options-actions.c: added icons to the Save, + Load, Rename and Delete submenus. + +2004-05-17 Michael Natterer <mitch@gimp.org> + + * app/actions/edit-actions.c (edit_actions_update): don't forget + to set the sensitivity of "edit-named-copy". + +2004-05-17 Sven Neumann <sven@gimp.org> + + * app/core/gimpimage.c (gimp_image_init): initialize the image + unit to GIMP_UNIT_PIXEL. + + * app/pdb/image_cmds.c + * tools/pdbgen/pdb/image.pdb: allow GIMP_UNIT_PIXEL to be used + in the gimp_image_set_unit() PDB call. + +2004-05-16 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/old-photo.scm: fixed wrong use of + layer ID; bug #142326. + +2004-05-15 Sven Neumann <sven@gimp.org> + + * app/tools/gimpcurvestool.c: fixed position of vertical line + indicating the picked color. Patch from William Skaggs and + Søren Wedel Nielsen; fixes bug #142506. + +2004-05-15 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-params.c (plug_in_proc_args_check): changed + warnings to include the invalid menu path. Added check that makes + sure menu paths are either "<Prefix>" or "<Prefix>/foo" but *not* + "<Prefix>foo". + + * app/actions/plug-in-actions.c: added function + plug_in_actions_check_translation() which validates both the + original and translated menu paths and spits detailed error + messages if any of them is broken. Made action creation simpler + (?) and more robust. + + * app/menus/plug-in-menus.c: argh, the translated menu path must + be a sorting criteria *only*. Fixed the whole stuff to always use + the original menu path because translation is done entirely by + plug-in-actions.c. Fixes bad crashes for all locales. Added + boolean return value to plug_in_menus_build_path() and don't try + to create the menu item in an invalid location if creating the + submenus failed. + +2004-05-14 Sven Neumann <sven@gimp.org> + + * app/menus/file-dialog-menu.c: check if the file procedure + registered a menu path at all. The menu should probably be created + from the registered menu path, not from gimp->[load|save]_procs. + + * app/plug-in/plug-in-proc.[ch] + * app/plug-in/plug-ins.c: removed broken code that used to sort + the file procedures. + + * plug-ins/common/CEL.c + * plug-ins/common/bz2.c + * plug-ins/common/gz.c + * plug-ins/common/pcx.c + * plug-ins/common/pix.c + * plug-ins/common/sunras.c + * plug-ins/sgi/sgi.c + * plug-ins/xjt/xjt.c: register a mimetype, set a translatable + action name (mostly taken from shared-mime-info) and register to + the <Load> and <Save> menus using gimp_plugin_menu_register(). + +2004-05-14 Michael Natterer <mitch@gimp.org> + + * app/pdb/fileops_cmds.c + * libgimp/gimpfileops_pdb.c: regenerated. + +2004-05-14 Michael Natterer <mitch@gimp.org> + + * app/actions/select-actions.c (select_actions_update): don't + make "select-invert" insensitive if there is no selection. + +2004-05-14 Sven Neumann <sven@gimp.org> + + * plug-ins/common/aa.c + * plug-ins/common/gbr.c + * plug-ins/common/gih.c + * plug-ins/common/gtm.c + * plug-ins/common/header.c + * plug-ins/common/pat.c + * plug-ins/common/pnm.c + * plug-ins/common/psp.c + * plug-ins/fits/fits.c + * plug-ins/gfli/gfli.c: register a mimetype, set a translatable + action name (mostly taken from shared-mime-info) and register to + the <Load> and <Save> menus using gimp_plugin_menu_register(). + +2004-05-14 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/fileops.pdb: added new PDB function + gimp_register_file_handler_mime() that allows to associate a MIME + type with a file procecdurre. + + * app/pdb/fileops_cmds.c + * app/pdb/internal_procs.c + * libgimp/gimpfileops_pdb.[ch]: regenerated. + + * app/plug-in/plug-in-proc.[ch] + * app/plug-in/plug-in-rc.c + * app/plug-in/plug-ins.[ch]: store a mimetype with file procedures. + + * app/actions/file-commands.c + * app/core/gimpdocumentlist.[ch] + * app/core/gimpimagefile.[ch] + * app/file/file-open.[ch] + * app/file/file-save.c: set the thumbnail's mimetype from the file + procedure used to load/save the image. + + * app/xcf/xcf.c + * plug-ins/bmp/bmp.c + * plug-ins/common/csource.c + * plug-ins/common/dicom.c + * plug-ins/common/gif.c + * plug-ins/common/gifload.c + * plug-ins/common/jpeg.c + * plug-ins/common/mng.c + * plug-ins/common/png.c + * plug-ins/common/postscript.c + * plug-ins/common/psd.c + * plug-ins/common/psd_save.c + * plug-ins/common/sunras.c + * plug-ins/common/svg.c + * plug-ins/common/tga.c + * plug-ins/common/tiff.c + * plug-ins/common/wmf.c + * plug-ins/common/xbm.c + * plug-ins/common/xpm.c + * plug-ins/common/xwd.c + * plug-ins/faxg3/faxg3.c + * plug-ins/winicon/main.c: register a mimetype, set a translatable + action name (taken from shared-mime-info) and register to the <Load> + and <Save> menus using gimp_plugin_menu_register(). + +2004-05-13 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/lib.pl + * tools/pdbgen/pdbgen.pl: added new procedure variable 'since' + that allows to specify when a new function was added. Use that + info to generate an appropriate gtk-doc comment. + + * tools/pdbgen/pdb/plug_in.pdb: set since = '2.2' for the new + function gimp_plugin_menu_register(). + + * libgimp/gimpplugin_pdb.c: regenerated. + +2004-05-13 Michael Natterer <mitch@gimp.org> + + * menus/tool-options-menu.xml: added "name" attributes to all + submenus. + + * app/menus/tool-options-menu.c: use the menu names instead of the + overly long action names. + + * app/actions/colormap-editor-commands.c + * app/actions/tool-options-commands.c: added some callback + implementations. + + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimptooloptionseditor.c: removed the callbacks here + and use action buttons. + + * app/actions/actions.c + * app/actions/colormap-editor-actions.c + * app/actions/edit-actions.c: code review / cleanup. + +2004-05-13 Michael Natterer <mitch@gimp.org> + + * app/core/gimpcontainer.c (gimp_container_add_handler): don't + try to lookup detailed "notify::foo" signal specs. + +2004-05-13 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimptoolview.[ch]: if in list mode, add an "eye" + column which toggles tool visibility. + +2004-05-13 Michael Natterer <mitch@gimp.org> + + * app/actions/tools-actions.c (tools_actions_update): don't use + action_data_get_context() to update the "tools" action group + because it may return NULL. Use gimp_get_user_context() instead + because the active tool is global regardless of the action group's + context. Fixes accidential tool hiding when closing the last + display. + +2004-05-13 Sven Neumann <sven@gimp.org> + + * libgimpthumb/gimpthumbnail.c (gimp_thumbnail_save_thumb): oops. + +2004-05-13 Michael Natterer <mitch@gimp.org> + + Added GimpViewable infrastructure which enables migrating from + TempBuf to GdkPixbuf for both providing and getting previews: + + * app/core/gimpviewable.[ch]: added new virtual functions + GimpViewable::get_pixbuf() and GimpViewable::get_new_pixbuf() + which are implemented exactly as get_preview() and + get_new_preview() except that get_new_pixbuf() has a default + implementation which creates the pixbuf from a TempBuf. + + Renamed public functions _get_preview_pixbuf() and + _get_new_preview_pixbuf() to _get_pixbuf() and _get_new_pixbuf(). + + Added gimp_viewable_get_dummy_pixbuf() and use it from + gimp_viewable_get_dummy_preview(). + + * app/core/gimpimagefile.c (gimp_imagefile_save_thumb) + * app/display/gimpdisplayshell.c (gimp_display_shell_update_icon) + * app/gui/resize-dialog.c (resize_dialog_new): changed accordingly. + +2004-05-13 Sven Neumann <sven@gimp.org> + + * libgimpthumb/gimpthumbnail.[ch]: added mime-type support. + +2004-05-13 Michael Natterer <mitch@gimp.org> + + * app/menus/Makefile.am: added file-menu.[ch] and + file-dialog-menu.[ch] + + * app/menus/menus.[ch]: removed menus_open_recent_add()... + + * app/menus/file-menu.[ch]: ...and added it here as file_menu_setup(). + + * app/menus/image-menu.c + * app/menus/toolbox-menu.c: changed accordingly. + + * app/menus/file-dialog-menu.[ch]: added factored out code from the + file-open and file-save menus as file_dialog_menu_setup(). + + * app/menus/file-open-menu.c + * app/menus/file-save-menu.c: call file_dialog_menu_setup(). + +2004-05-12 Michael Natterer <mitch@gimp.org> + + * app/actions/documents-actions.c + * app/actions/documents-commands.c + * app/actions/edit-actions.c + * app/actions/edit-commands.[ch] + * app/actions/layers-actions.c + * app/actions/layers-commands.c + * app/actions/select-actions.c + * app/actions/select-commands.[ch] + * app/actions/vectors-actions.c + * app/actions/vectors-commands.[ch]: added tooltips for actions + which are now used for dialog buttons, added callback + implementations which formerly lived in various widgets, moved + some actions around and did some general cleanups. + + * menus/image-menu.xml.in: s/edit-stroke/select-stroke/ + + * menus/Makefile.am + * menus/selection-editor-menu.xml: new popup menu. + + * app/menus/menus.c: register <SelectionEditor> and <UndoEditor> + UI managers. + + * app/widgets/gimpeditor.[ch]: added construct properties + "menu-factory", "menu-identifier", "ui-path" and "popup-data". + Implement GObject::constructor() and create the UI manager + if all needed properties were set. Enables creating action + buttons at widget construction time because they need a + UI manager. + + (gimp_editor_add_action_button): extended to take a va_list of + "extended" actions which are invoked if the resp. button emits + "extended_clicked". Store the actions and their modifier masks in + a list attached to the button. + + * app/widgets/gimpcontainerview.c + (gimp_container_view_item_selected): if the view has container + *and* context, simply change the context and return. + + (gimp_container_view_context_changed): don't emit "select_item" + manually but simply call gimp_container_view_select_item(). + + (gimp_container_view_viewable_dropped): use + gimp_container_view_item_selected() instead of changing the + context directly. + + * app/widgets/gimpcontainereditor.c + (gimp_container_editor_select_item): update the UI manager. + + * app/widgets/gimpdockable.c: don't try to fiddle with the + dialog's menu if it doesn't have a ui_path (happens if the UI + manager is just a collection of actions for the dialog buttons and + has no menu registered). + + * app/widgets/gimpimageeditor.c: connect to the image's "flush" + signal and update the UI manager in the callback. + + * app/widgets/gimpitemtreeview.c: use GimpEditor's construct + properties to create the UI manager so GimpItemTreeView subclasses + can have action buttons. Update the UI manager in + gimp_item_tree_view_select_item(). + + * app/widgets/gimpbufferview.c + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimpcontainergridview.c + * app/widgets/gimpdatafactoryview.c + * app/widgets/gimpfontview.c + * app/widgets/gimpimageview.c + * app/widgets/gimptemplateview.c + * app/widgets/gimptoolview.c: changed calls to + gimp_editor_add_action_button() accordingly and removed some + unneeded select_item() implementations. + + * app/widgets/gimpchanneltreeview.c + * app/widgets/gimpvectorstreeview.[ch] + * app/widgets/gimpdocumentview.[ch] + * app/widgets/gimplayertreeview.c + * app/widgets/gimpselectioneditor.[ch] + * app/widgets/gimpundoeditor.[ch]: use action buttons and removed + lots of callbacks which went to the resp. action callbacks. + + * app/widgets/widgets-types.h: removed some now unneeded function + prototypes. + + * app/gui/dialogs-constructors.c: changed (simplified) many dialog + constructors accordingly. + +2004-05-12 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpwidgets.c (gimp_scale_entry_new_internal) + * app/widgets/gimpwidgets-utils.c (gimp_table_attach_stock): + left-align the label. + + * app/actions/channels-commands.c + * app/actions/layers-commands.c + * app/actions/qmask-commands.c + * app/actions/vectors-commands.c + * app/display/gimpdisplayshell-scale.c + * app/gui/brush-select.c + * app/gui/file-new-dialog.c + * app/gui/info-dialog.c + * app/gui/info-window.c + * app/gui/module-browser.c + * app/gui/offset-dialog.c + * app/gui/palette-import-dialog.c + * app/gui/preferences-dialog.c + * app/gui/resize-dialog.c + * app/tools/gimpblendoptions.c + * app/tools/gimpcroptool.c + * app/tools/gimpmeasuretool.c + * app/tools/gimppaintoptions-gui.c + * app/tools/gimpscaletool.c + * app/tools/gimpselectionoptions.c + * app/tools/gimpsheartool.c + * app/tools/gimptextoptions.c + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimpgrideditor.c + * app/widgets/gimphistogrameditor.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimpstrokeeditor.c + * app/widgets/gimpwidgets-utils.c: left-align labels as suggested + by the HIG. + +2004-05-12 Michael Natterer <mitch@gimp.org> + + * app/config/gimpconfig-deserialize.c + * app/config/gimpscanner.c + * app/core/gimp-edit.c + * app/core/gimpchannel-combine.c + * app/core/gimpcontainer.c + * app/core/gimpdrawable-bucket-fill.c + * app/core/gimpdrawable-combine.c + * app/core/gimpdrawable.c + * app/core/gimpgradient.c + * app/core/gimpimage-flip.c + * app/core/gimpimage-merge.c + * app/core/gimpimage-projection.c + * app/core/gimpimage.c + * app/display/gimpdisplay-handlers.c + * app/display/gimpdisplayshell-callbacks.c + * app/display/gimpprogress.c + * app/gui/info-dialog.c + * app/gui/module-browser.c + * app/gui/offset-dialog.c + * app/plug-in/plug-in.c + * app/tools/gimpdrawtool.c + * app/tools/tool_manager.c + * app/widgets/gimpactiongroup.c + * app/widgets/gimpdialogfactory.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimpitemfactory.c + * app/widgets/gimppropwidgets.c + * app/widgets/gimpwidgets-utils.c + * app/xcf/xcf-save.c + * libgimp/gimpexport.c + * libgimpwidgets/gimphelpui.c + * libgimpwidgets/gimppixmap.c + * libgimpwidgets/gimpunitmenu.c: replaced G_GNUC_FUNCTION, + G_GNUC_PRETTY_FUNCTION, G_STRLOC and hardcoded function names in + g_warning()s by G_STRFUNC. + +2004-05-12 Michael Natterer <mitch@gimp.org> + + * app/actions/gradients-actions.c + * app/actions/palettes-actions.c + * app/actions/patterns-actions.c: added/fixed tooltips. + +2004-05-11 Michael Natterer <mitch@gimp.org> + + * configure.in: define G*_DISABLE_DEPRECATED for all G* modules + except GTK+. Don't do so if compiling against GLib, GTK+ >= 2.5.0 + and Pango >= 1.5.0 + + * libgimpwidgets/gimpoffsetarea.c: s/gdk_gc_unref/g_object_unref/ + + * app/config/gimpconfig-deserialize.c + * app/widgets/gimpdeviceinfo.c: + s/g_value_set_foo_take_ownership/g_value_take_foo/ + + * app/text/gimptext-vectors.c + * app/text/gimptext-bitmap.c: + s/pango_ft2_font_get_face/pango_fc_font_lock,unlock_face/ + +2004-05-11 Michael Natterer <mitch@gimp.org> + + * app/actions/images-commands.c: added missing #includes. + +2004-05-11 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcontainermenu.[ch] + * app/widgets/gimpcontainermenuimpl.[ch] + * app/widgets/gimpmenuitem.[ch]: removed. Obsoleted by + GimpContainerViewInterface implemented by GimpContainerComboBox. + +2004-05-11 Michael Natterer <mitch@gimp.org> + + * app/actions/actions.[ch]: added action_data_get_context() and + macro return_if_no_context(). + + * app/actions/brushes-actions.c + * app/actions/buffers-actions.c + * app/actions/buffers-commands.c + * app/actions/data-commands.c + * app/actions/fonts-actions.c + * app/actions/fonts-commands.c + * app/actions/gradients-actions.c + * app/actions/images-actions.c + * app/actions/images-commands.c + * app/actions/palettes-actions.c + * app/actions/patterns-actions.c + * app/actions/templates-actions.c + * app/actions/templates-commands.[ch] + * app/actions/tools-actions.c + * app/actions/tools-commands.c: moved lots of code from widgets/ + to the resp. action callbacks. + + * app/widgets/gimpeditor.[ch]: added gimp_editor_add_action_button() + which creates a GtkButton connected to the resp. action. + + * app/widgets/gimpdatafactoryview.[ch]: added "action_group" + parameters so we can distinguish brushes, patterns etc. actions. + + * app/widgets/gimpimageview.[ch] + * app/widgets/gimpbrushfactoryview.c + * app/widgets/gimpbufferview.c + * app/widgets/gimpfontview.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimppatternfactoryview.c + * app/widgets/gimptemplateview.[ch] + * app/widgets/gimptoolview.c: removed tons of GtkButton::clicked() + callbacks and use gimp_editor_add_action_button() instead + of simply _add_button(). + + * app/gui/dialogs-constructors.c + * app/gui/gradient-select.c + * app/gui/palette-select.c + * app/gui/pattern-select.c: changed accordingly. + +2004-05-11 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpcontainercombobox.c: correctly get the default + GimpContainerViewInterface implementation and chain up to it for + clear_items(). Update the preview renderers on "update", enable + deselecting everything. + + * app/widgets/gimpimagedock.[ch] + * app/gui/file-new-dialog.c + * app/gui/palette-import-dialog.c + * app/gui/preferences-dialog.c + * app/gui/stroke-dialog.c: use GimpContainerComboBox instead of + GimpContainerMenuImpl. + + * app/gui/palette-import-dialog.c: cleanup. + +2004-05-11 Sven Neumann <sven@gimp.org> + + * docs/gimptool.1.in: fixed spelling. + +2004-05-11 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpcontainertreeview.c: minor cleanup. + +2004-05-11 Michael Schumacher <schumaml@cvs.gnome.org> + + * libgimp/gimp.def + * libgimpbase/gimpbase.def: updated + +2004-05-11 Sven Neumann <sven@gimp.org> + + * app/gui/user-install-dialog.c: removed the "Aborting + Installation" page. We added it as a nice little gimmick but + obviously people don't understand it's purpose. Fixes bug #142281. + +2004-05-11 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcontainercombobox.[ch]: added new widget, almost + finished. + + * app/widgets/gimpcontainerview.[ch]: added convenience functions + to get and set the GimpContainerView properties. + + * app/widgets/gimpcontainerbox.c: use the convenience functions. + + * app/gui/file-new-dialog.c: use the new GimpContainerComboBox. + + * etc/templaterc: use "pixels" as the unit for pixel sized templates. + +2004-05-11 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpchanneltreeview.c + * app/widgets/gimpcontainerbox.[ch] + * app/widgets/gimpcontainereditor.c + * app/widgets/gimpcontainergridview.[ch] + * app/widgets/gimpcontainerpopup.c + * app/widgets/gimpcontainertreeview.[ch] + * app/widgets/gimpdatafactoryview.c + * app/widgets/gimpdocumentview.c + * app/widgets/gimpfontview.c + * app/widgets/gimpimageview.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimppatternfactoryview.c + * app/widgets/gimptemplateview.c + * app/widgets/gimpvectorstreeview.c: code review / cleanup. + +2004-05-11 Michael Natterer <mitch@gimp.org> + + * app/widgets/widgets-types.h + * app/widgets/gimpcontainerview.[ch]: made GimpContainerView an + interface. Added accessors for all members in the private struct + and made it really private. + + * app/widgets/gimpcontainerbox.[ch]: derive it from GimpEditor and + implement GimpContainerViewInterface and its properties. + + * app/widgets/gimpchanneltreeview.c + * app/widgets/gimpcontainergridview.c + * app/widgets/gimpcontainertreeview.c + * app/widgets/gimpcontainertreeview-dnd.c + * app/widgets/gimpdrawabletreeview.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimpvectorstreeview.c: implement + GimpContainerViewInterface and use the new accessor functions. + + * app/widgets/gimpcontainerpopup.c + * app/widgets/gimpdocumentview.c: changed accordingly. + + * app/widgets/gimptemplateview.c + * app/widgets/gimpcontainereditor.c + * app/widgets/gimpundoeditor.c + * app/actions/palettes-commands.c: #include "gimpcontainerview.h" + +2004-05-11 Sven Neumann <sven@gimp.org> + + * libgimp/gimp.def + * libgimp/gimpui.def + * libgimpbase/gimpbase.def + * libgimpwidgets/gimpwidgets.def: updated. + +2004-05-10 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpframe.c (gimp_frame_style_set): removed a + redundant call to gtk_widget_queue_resize(). + +2004-05-10 Sven Neumann <sven@gimp.org> + + * app/xcf/xcf-save.c (xcf_save_prop): fixed size of colormap + property. Patch by Daniel Kobras, fixes bug #142149. + +2004-05-10 Henrik Brix Andersen <brix@gimp.org> + + * plug-ins/common/screenshot.c (shoot_dialog): fixed the spacing + of the dialog, thanks to Sven for pointing out my mistake. + +2004-05-10 Sven Neumann <sven@gimp.org> + + * app/widgets/gimptexteditor.c (gimp_text_editor_set_direction): + don't call gtk_widget_set_direction() on a non-existant widget. + Fixes bug #141792. + +2004-05-10 Sven Neumann <sven@gimp.org> + + * app/gui/tips-dialog.c: added missing newline in error message. + +2004-05-10 Michael Natterer <mitch@gimp.org> + + More GimpContainerView chopping: + + * app/widgets/gimpcontainerview.[ch]: added + GimpContainerViewPrivate struct (which is currently public :-) and + removed all members from the GimpContainerView struct. Added + accessors for "context", "container" and "preview_size / + preview_border_width". Added macro to get the private struct + (*not* via G_TYPE_INSTANCE_GET_PRIVATE because that's unavailable + for interfaces). + + * app/widgets/gimpbrushfactoryview.c + * app/widgets/gimpbufferview.c + * app/widgets/gimpchanneltreeview.c + * app/widgets/gimpcontainerbox.c + * app/widgets/gimpcontainereditor.c + * app/widgets/gimpcontainergridview.c + * app/widgets/gimpcontainerpopup.c + * app/widgets/gimpcontainertreeview-dnd.c + * app/widgets/gimpcontainertreeview.c + * app/widgets/gimpdatafactoryview.c + * app/widgets/gimpdocumentview.c + * app/widgets/gimpfontview.c + * app/widgets/gimpimageview.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimpsessioninfo.c + * app/widgets/gimptemplateview.c + * app/widgets/gimptoolview.c + * app/actions/brushes-actions.c + * app/actions/buffers-actions.c + * app/actions/dockable-actions.c + * app/actions/dockable-commands.c + * app/actions/documents-actions.c + * app/actions/fonts-actions.c + * app/actions/gradients-actions.c + * app/actions/gradients-commands.c + * app/actions/images-actions.c + * app/actions/palettes-actions.c + * app/actions/palettes-commands.c + * app/actions/patterns-actions.c + * app/actions/templates-actions.c + * app/actions/tools-actions.c + * app/actions/tools-commands.c: changed accordingly. + +2004-05-10 Sven Neumann <sven@gimp.org> + + * app/tools/gimpmagnifyoptions.[ch] + * app/tools/gimpmagnifytool.c: applied a patch from William Skaggs + that changes a misleading option label. Fixes bug #137508. + +2004-05-10 Sven Neumann <sven@gimp.org> + + * app/config/gimpdisplayconfig.c (DEFAULT_IMAGE_TITLE_FORMAT): + removed the display scale from the default image title because + it's now displayed in the statusbar. Show the image pixel size + instead. + + * app/gui/preferences-dialog.c: include a preset for the title + format string that shows the image size (bug #141720). + +2004-05-10 Michael Natterer <mitch@gimp.org> + + Prepare for making an interface out of GimpContainerView: + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpcontainerbox.[ch]: new GimpContainerView + subclass which implements GimpDocked interface and contains the + vbox-with-scrolled-window stuff common to GimpContainerGridView + and GimpContainerTreeView. + + * app/widgets/gimpcontainerview.[ch]: removed that functionality + here. + + * app/widgets/gimpcontainergridview.[ch] + * app/widgets/gimpcontainertreeview.[ch]: derive them from + GimpContainerBox. + + * app/gui/brush-select.c + * app/gui/font-select.c + * app/gui/gradient-select.c + * app/gui/palette-select.c + * app/gui/pattern-select.c + * app/widgets/gimpcontainerpopup.c: changed accordingly. + +2004-05-10 Sven Neumann <sven@gimp.org> + + * app/actions/view-actions.c: added a stock icon for "view-zoom-1-1". + + * app/widgets/gimpunitcombobox.[ch]: added functions to get and + set the active unit. + + * app/widgets/gimpunitstore.c (gimp_unit_store_tree_model_get_value): + need to special case GIMP_UNIT_PIXEL. + + * app/display/Makefile.am + * app/display/display-types.h + * app/display/gimpscalecombobox.[ch]: new widget to be used in the + display's statusbar. + + * app/display/gimpdisplayshell-cursor.[ch]: always display the + cursor position, not only if the cursor is inside the image. Added + new function gimp_display_shell_clear_cursor() to clear the cursor + label. + + * app/display/gimpdisplayshell-callbacks.c: changed accordingly. + + * app/display/gimpstatusbar.[ch] + * app/display/gimpdisplayshell.c + * app/display/gimpdisplayshell-handlers.c + * app/display/gimpdisplayshell-scale.c: do not explicitely resize + the statusbar cursor label, connect to GimpDisplayShell::scaled + instead. Added a GimpScaleComboBox to the status bar. + +2004-05-10 Michael Natterer <mitch@gimp.org> + + Started making the toolbox configurable. + Addresses bug #105764. Not finished yet. + + * app/core/gimptoolinfo.[ch]: renamed "in_toolbox" to "visible" + and made it a GObject property. + + * app/tools/gimp-tools.[ch]: added new function + gimp_tools_get_default_order() which returns a GList of tool + identifiers. + + * app/actions/tools-actions.c + * app/actions/tools-commands.[ch]: added actions & callbacks for + toggling the "visible" boolean and for resetting all tools. + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimptoolview.[ch]: new widget which allows to + toggle a tool's visibility and to reorder the tools. + + * app/widgets/gimptoolbox.[ch]: removed member "GtkWidget *trash" + and pack all tool buttons into the same wrap box. Connect to + "reoder" of the tool container and to "notify::visible" of all + tool infos and update the toolbox accordingly. + + * app/gui/dialogs-constructors.c: create a GimpToolView for the + tools list/grid. + + * app/menus/menus.c: register a <Tools> menu for the dialog above. + + * menus/Makefile.am + * menus/tools-menu.xml: added the menu. + +2004-05-10 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpuimanager.c: re-added help for menu items. Still + incomplete because there is no fallback help ID yet when pressing + F1 over a menu item which has a submenu. Added evil workaround and + version check for signal brokenness of GtkUIManager in GTK+ 2.4.1. + +2004-05-09 Hans Breuer <hans@breuer.org> + + Merge from stable branch : + + * plug-ins/common/winclipboard.c : support gray images; + fixes bug #141382 + + * plug-ins/common/winprint.c : dito; fixes bug #141145 + +2004-05-09 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/common/aa.c + * plug-ins/common/apply_lens.c + * plug-ins/common/autocrop.c + * plug-ins/common/autostretch_hsv.c: HIGified, GPL license added in + some plug-ins, minor code clean-up. + +2004-05-08 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/common/spread.c: HIGified, simplified and fixes #141733 + +2004-05-08 Henrik Brix Andersen <brix@gimp.org> + + * plug-ins/common/screenshot.c (shoot_dialog): HIGify the + screenshot plug-in. Fixes part of bug #141772. + +2004-05-08 Sven Neumann <sven@gimp.org> + + * app/display/gimpstatusbar.c (gimp_statusbar_resize_cursor): + added 1 pixel horizontal padding around the label. + +2004-05-08 Sven Neumann <sven@gimp.org> + + * app/display/gimpstatusbar.[ch]: renamed struct member combo to + unit_combo. Place the combobox into the cursor frame. + +2004-05-08 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpunitcombobox.[ch] + * app/widgets/gimpunitstore.[ch]: added a prototype of a unit menu + based on GtkComboBox. Will move this to libgimpwidgets later... + + * app/display/gimpstatusbar.[ch]: use the new GimpUnitComboBox and + GimpUnitStore. + + * themes/Default/gtkrc + * themes/Small/gtkrc: hardcode the appearance of the + GimpUnitComboBox. It uses a hack that doesn't work in list mode. + +2004-05-07 Sven Neumann <sven@gimp.org> + + * app/core/gimpimage-colormap.[ch]: added a const qualifier. + + Changed how the image unit and dot-for-dot mode is handled. Might + break things and certainly needs more changes (mainly in tools): + + * app/core/gimptemplate.c: allow GIMP_UNIT_PIXEL as image unit. + + * app/display/gimpdisplayshell-handlers.c + * app/display/gimpdisplayshell-scale.c + * app/display/gimpdisplayshell-title.c + * app/display/gimpstatusbar.c: always use the image unit for the + rulers and to display lengths. + + * app/widgets/gimptemplateeditor.c: redone GimpTemplateEditor + based on a dialog mockup from Jimmac and Tigert. + + * app/core/core-enums.[ch]: changed some descriptions used by the + template editor. + +2004-05-07 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/AlienMap2.c + * plug-ins/common/CML_explorer.c + * plug-ins/common/animationplay.c + * plug-ins/common/despeckle.c + * plug-ins/fp/fp.c + * plug-ins/gfig/gfig.c + * plug-ins/gflare/gflare.c + * plug-ins/script-fu/script-fu.c + * plug-ins/twain/twain.c: forgot some gimp_plugin_menu_register(). + +2004-05-07 Michael Natterer <mitch@gimp.org> + + * plug-ins/FractalExplorer/FractalExplorer.c + * plug-ins/Lighting/lighting_main.c + * plug-ins/MapObject/mapobject_main.c + * plug-ins/dbbrowser/dbbrowser.c + * plug-ins/flame/flame.c + * plug-ins/gimpressionist/gimp.c + * plug-ins/ifscompose/ifscompose.c + * plug-ins/imagemap/imap_main.c + * plug-ins/maze/maze.c + * plug-ins/pagecurl/pagecurl.c + * plug-ins/print/print.c + * plug-ins/rcm/rcm.c + * plug-ins/winsnap/winsnap.c + * plug-ins/common/[g-z]*.c: use gimp_plugin_menu_register(). Some + formatting cleanups in some query() functions. + +2004-05-07 Michael Natterer <mitch@gimp.org> + + * app/plug-in/plug-in-proc.[ch]: removed member "accelerator". + It was never set and this is the conceptually wrong place to store + it anyway. + + * app/actions/file-dialog-actions.c + * app/actions/plug-in-actions.c + * app/plug-in/plug-in-message.c + * app/xcf/xcf.c: changed accordingly. + + * tools/pdbgen/pdb/plug_in.pdb (plugins_query): always return NULL + as accelerator. Cleaned up the function a bit and made it aware of + proc_def->menu_label added below. + + * app/pdb/plug_in_cmds.c: regenerated. + +2004-05-07 Michael Natterer <mitch@gimp.org> + + Changed plug-in menu registration again to allow passing just the + menu item's label (not the full path) in gimp_install_procedure() + and only the path (excluding the item's label) in + gimp_plugin_menu_register(). Matches the internal action system + better and makes translating the menu paths much easier. + + (Of yourse it's still possible to use the old syntax for backward + compatibility). + + * app/plug-in/plug-in-proc.[ch]: added "gchar *menu_label". + + * app/plug-in/plug-in-params.[ch]: added new functions + plug_in_param_defs_check() and plug_in_proc_args_check() which + check if a procedure's parameters match its menu location + (e.g. <Image> needs RUN-MODE, IMAGE, DRAWABLE). + + * app/plug-in/plug-in-message.c (plug_in_handle_proc_install): if + registering an old-style (full) menu_path, use + plug_in_param_defs_check(), set proc_def->menu_label otherwise. + + * tools/pdbgen/pdb/plug_in.pdb (plugin_menu_register): use + plug_in_proc_args_check() on the passed menu_path and make sure + old and new style menu registration are not mixed. + + * app/pdb/plug_in_cmds.c: regenerated. + + * app/plug-in/plug-in-rc.c: save/restore "menu_label". + + * app/actions/file-dialog-actions.c + * app/actions/plug-in-actions.c + * app/menus/plug-in-menus.c: changed action/menu creation + accordingly. Some hacks needed to allow both old and new style + menu_label/menu_paths. + + * app/plug-in/plug-in.c + * app/widgets/gimpfiledialog.c + * app/xcf/xcf.c: changed accordingly. + + * plug-ins/common/align_layers.c + * plug-ins/common/animationplay.c + * plug-ins/common/animoptimize.c + * plug-ins/common/apply_lens.c + * plug-ins/common/autocrop.c + * plug-ins/common/autostretch_hsv.c + * plug-ins/common/blinds.c + * plug-ins/common/blur.c + * plug-ins/common/borderaverage.c + * plug-ins/common/bumpmap.c + * plug-ins/common/c_astretch.c + * plug-ins/common/ccanalyze.c + * plug-ins/common/channel_mixer.c + * plug-ins/common/checkerboard.c + * plug-ins/common/color_enhance.c + * plug-ins/common/colorify.c + * plug-ins/common/colortoalpha.c + * plug-ins/common/compose.c + * plug-ins/common/convmatrix.c + * plug-ins/common/cubism.c + * plug-ins/common/curve_bend.c + * plug-ins/common/decompose.c + * plug-ins/common/deinterlace.c + * plug-ins/common/depthmerge.c + * plug-ins/common/destripe.c + * plug-ins/common/diffraction.c + * plug-ins/common/displace.c + * plug-ins/common/edge.c + * plug-ins/common/emboss.c + * plug-ins/common/engrave.c + * plug-ins/common/exchange.c + * plug-ins/common/film.c + * plug-ins/common/flarefx.c + * plug-ins/common/fractaltrace.c + * plug-ins/common/screenshot.c: ported the first few plug-ins + to the new registration scheme. + +2004-05-06 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/pdb/app.pl: make libgimp* headers always included + before any app headers. + + * tools/pdbgen/pdb/paint_tools.pdb: Fix silly "Dodgebure" typo. + + * app/pdb/*_cmds.c: regenerated. + +2004-05-06 Sven Neumann <sven@gimp.org> + + * app/core/gimpdrawable-preview.c + * app/core/gimpimage-projection.c: added sanity so we don't just + plain crash when an indexed image doesn't have a colormap. + + * plug-ins/common/png.c: keep at least one entry in the colormap. + Fixes bug #142029. + +2004-05-06 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/common/sobel.c: replaced RMS macro by smarter one, + resulting in a doubling in speed for this plug-in. + + * plug-ins/fp/fp.c: include stdlib for free, malloc and abs. + +2004-05-06 Maurits Rijk <m.rijk@chello.nl> + + * plug-ins/fp/fp_gdk.c + * plug-ins/fp/fp_gtk.c + * plug-ins/fp/fp_misc.c + * plug-ins/fp/fp.h: removed + + * plug-ins/fp/Makefile.am: changed accordingly + + * plug-ins/fp/fp.c: merged into one single file to get rid of all + global variables and functions. Major clean-up. Still more to come. + +2004-05-06 Sven Neumann <sven@gimp.org> + + * app/gui/about-dialog.c: center the about dialog on the monitor, + not on the screen. Fixes window position on xinerama setups. + +2004-05-06 Michael Natterer <mitch@gimp.org> + + * tools/pdbgen/pdb/plug_in.pdb: renamed gimp_plugin_menu_add() to + gimp_plugin_menu_register() for consistency with other + gimp_plugin_foo_register() functions which can be called during + query(). + + * app/pdb/plug_in_cmds.c + * libgimp/gimpplugin_pdb.[ch]: regenerated. + + * plug-ins/common/ccanalyze.c + * plug-ins/common/colortoalpha.c + * plug-ins/common/screenshot.c + * plug-ins/winsnap/winsnap.c: changed accordingly. + +2004-05-06 Michael Natterer <mitch@gimp.org> + + Enabled multiple menu entries per plug-in procedure: + + * app/plug-in/plug-in-proc.[ch]: changed "gchar *menu_path" to + "GList *menu_paths". + + * app/plug-in/plug-in-message.c + * app/plug-in/plug-in-rc.c + * app/plug-in/plug-in.c + * app/plug-in/plug-ins.c + * app/menus/menus.c + * app/widgets/gimpfiledialog.c + * app/xcf/xcf.c: changed accordingly. + + * app/actions/file-dialog-actions.c + * app/actions/plug-in-actions.c: create an action for the first + element of proc_def->menu_paths. + + * app/gui/gui-vtable.c + * app/menus/plug-in-menus.[ch]: create proxy widgets for each + element of proc_def->menu_paths. + + * tools/pdbgen/pdb/plug_in.pdb: added new function + gimp_plugin_menu_add() which can be called during query() and adds + a menu path to a procedure registered by the calling plugin. + + * app/pdb/internal_procs.c + * app/pdb/plug_in_cmds.c + * libgimp/gimpplugin_pdb.[ch]: regenerated. + + * menus/image-menu.xml.in + * menus/toolbox-menu.xml.in: added lots of <placeholder>s for + logical groups (like Image/Resize, Image/Scale, Image/Crop + etc.). Added empty placeholder File/Send for stuff like print and + mail. Added an "Acquire" menu under <Image>/File + + * plug-ins/common/mail.c + * plug-ins/print/print.c + * plug-ins/common/winprint.c: register under File/Send. + + * plug-ins/common/screenshot.c + * plug-ins/winsnap/winsnap.c: also register under + <Image>/File/Acquire. + + * plug-ins/common/autocrop.c + * plug-ins/common/ccanalyze.c + * plug-ins/common/colortoalpha.c + * plug-ins/common/threshold_alpha.c + * plug-ins/common/zealouscrop.c: register additional menu entries + under placeholders in the "Image" and "Layer" menus. This is not + meant to be final but just a hint to keep in mind when + reorganizing the plug-in menus. + +2004-05-06 Sven Neumann <sven@gimp.org> + + * app/gui/resize-dialog.[ch]: cleaned up variable names and + external API. Still quite a mess. + + * app/Makefile.am + * app/actions/image-commands.c + * app/actions/layers-commands.c: changed accordingly. + +2004-05-06 Sven Neumann <sven@gimp.org> + + * app/menus/menus.c: no need for including gimp-intl.h. + +2004-05-06 Michael Natterer <mitch@gimp.org> + + * configure.in + * app/Makefile.am + * app/menus/.cvsignore + * app/menus/Makefile.am + * app/menus/menus-types.h + * app/menus/menus.[ch] + * app/menus/file-open-menu.[ch] + * app/menus/file-save-menu.[ch] + * app/menus/image-menu.[ch] + * app/menus/plug-in-menus.[ch] + * app/menus/tool-options-menu.[ch] + * app/menus/toolbox-menu.[ch]: moved all menus files to their + own directory. + + * app/gui/Makefile.am + * app/gui/menus.[ch] + * app/gui/file-open-menu.[ch] + * app/gui/file-save-menu.[ch] + * app/gui/image-menu.[ch] + * app/gui/plug-in-menus.[ch] + * app/gui/tool-options-menu.[ch] + * app/gui/toolbox-menu.[ch]: removed them here. + + * app/actions/debug-commands.c + * app/actions/file-commands.c + * app/gui/brush-select.c + * app/gui/dialogs.c + * app/gui/font-select.c + * app/gui/gradient-select.c + * app/gui/gui-vtable.c + * app/gui/gui.c + * app/gui/palette-select.c + * app/gui/pattern-select.c + * app/gui/preferences-dialog.c: changed #includes accordingly. + +2004-05-05 Sven Neumann <sven@gimp.org> + + * app/gui/file-new-dialog.c: use a normal GimpDialog instead of a + GimpViewableDialog that never has a viewable set. + +2004-05-05 Michael Natterer <mitch@gimp.org> + + * app/gui/brush-select.[ch] (brush_select_new): reordered parameters + so the first four are the same for all foo_select_new() functions. + + * tools/pdbgen/pdb/brush_select.pdb: changed accordingly. + + * app/pdb/brush_select_cmds.c: regenerated. + + * app/gui/font-select.c (font_select_new): set the vbox' + border width to 6 to match the other foo_select dialogs. + +2004-05-05 Michael Natterer <mitch@gimp.org> + + * app/actions/debug-actions.c + * app/actions/debug-commands.[ch] + * menus/toolbox-menu.xml.in: added action & callback which XML-dump + all UI managers. + +2004-05-05 Michael Natterer <mitch@gimp.org> + + * app/actions/plug-in-actions.c (plug_in_actions_add_proc): fixed + bug which would have leaked broken menu translations. + + * app/gui/plug-in-menus.c: removed useless #includes. + +2004-05-05 Michael Natterer <mitch@gimp.org> + + * app/actions/file-actions.c + * app/actions/file-commands.[ch]: remove "file-close" action and + callback... + + * app/actions/view-actions.c + * app/actions/view-commands.[ch]: ...and added it here as + "view-close" because that's what it does. + + * app/actions/qmask-actions.c + * app/actions/qmask-commands.c: s/QMask/QuickMask/g + + * app/gui/menus.c: add the "channels" action group to the <Image> + and <Dock> UI managers, renamed UI manager <Dialogs> to + <Dockable>. + + * app/widgets/gimpdockbook.c: s/<Dialogs>/<Dockable>/. + + * menus/image-menu.xml.in: s/file-close/view-close/, added + separators at the end of most menus, moved the bottom group of the + "View" menu after the zoom group. + +2004-05-05 Michael Natterer <mitch@gimp.org> + + * app/actions/select-actions.c: removed action "select-by-color". + + * app/tools/gimpbycolorselecttool.c: add the shortcut here. + + * app/actions/tools-actions.c: added alternative tool actions for + "by-color-select" and "rotate" which are identical to the ones + generated from the GimpToolInfo except for their label. Make sure + they have the same accelerators as the generated ones. + + * menus/image-menu.xml.in: use the alternative actions for + "<Image>/Select/By Color" and + "<Layer>/Transform/Arbitrary Rotation...". + +2004-05-05 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimphelpui.c: documentation. + +2004-05-05 Michael Natterer <mitch@gimp.org> + + Finally enable global accelerators in all docks: + + * app/widgets/gimpimagedock.c (gimp_image_dock_constructor): + iterate all of the UI manager's actions and enable their + accelerators manually. Fixes bug #119878. + +2004-05-05 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpviewabledialog.c: added construct properties to + make it possible to derive from GimpViewableDialog. + + * app/widgets/gimptooldialog.[ch]: make GimpToolDialog a real + object, not just a convenience constructor. + + * themes/Default/gtkrc + * themes/Small/gtkrc: set a smaller border_width of 6 pixels for + the action area of tool dialogs. + + * app/tools/gimpcolorpickertool.c + * app/tools/gimpimagemaptool.c: set a smaller border_width of 6 + pixels on tool dialogs to make them more compact. + +2004-05-05 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimpoffsetarea.[ch]: added new function + gimp_offset_area_set_pixbuf(). Started to clean up the + code a bit. + + * app/gui/resize-dialog.c (resize_widget_new): use the new feature + and set a preview of the image. Fixes bug #78733. + +2004-05-05 Sven Neumann <sven@gimp.org> + + * app/gui/info-dialog.c + * app/tools/gimpcolorbalancetool.c + * app/tools/gimpcolorizetool.c + * app/tools/gimpcurvestool.c + * app/tools/gimphuesaturationtool.c + * app/tools/gimpimagemaptool.c + * app/tools/gimplevelstool.c: use GimpFrame widgets, changed spacings. + + * app/widgets/gimptexteditor.c: tweaked. + +2004-05-05 Jakub Steiner <jimmac@ximian.com> + + * data/images/gimp_splash.png: ustable splash + +2004-05-04 Michael Natterer <mitch@gimp.org> + + * app/gui/menus.c: register a <Dock> UI manager which has all + action groups <Image> has except "view". + + * app/widgets/gimpimagedock.[ch]: re-enabled the global shortcuts, + using UI manager instead of item factory. Unfortunately actions + without proxy widgets can't be activated so this change is pretty + useless. Oh well, will find a hack to work around this later... + +2004-05-04 Sven Neumann <sven@gimp.org> + + * app/tools/gimpblendoptions.c + * app/tools/gimpbucketfilloptions.c + * app/tools/gimpcoloroptions.c + * app/tools/gimpinkoptions.c + * app/tools/gimppaintoptions-gui.c + * app/tools/gimpselectionoptions.c + * app/tools/gimptooloptions-gui.c + * app/tools/gimptransformoptions.c: use GimpFrames where GtkFrame + was used. Put "Pressure Sensitivity" frame into a GtkExpander. + +2004-05-04 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpframe.c: added a style property to control + boldening of the frame title. + + * themes/Default/gtkrc + * themes/Small/gtkrc: suppress the bold title for GimpFrames in + GimpDockables, + +2004-05-04 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): allocate + the full width for the label widget, looks better and is more + convenient to use with activatable widgets such as toggle buttons. + +2004-05-04 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpfiledialog.c: removed debugging output, added + #warning about runtime version check that can be removed as soon + as we depend on GTK+ 2.4.1. + +2004-05-04 Michael Natterer <mitch@gimp.org> + + * app/actions/file-dialog-actions.c (file_dialog_actions_setup): + don't forget to set the action's accelerator. + +2004-05-04 Sven Neumann <sven@gimp.org> + + * app/actions/channels-commands.c + * app/actions/gradient-editor-commands.c + * app/actions/image-commands.c + * app/actions/layers-commands.c + * app/actions/qmask-commands.c + * app/actions/templates-commands.c + * app/actions/vectors-commands.c + * app/display/gimpdisplayshell-filter-dialog.c + * app/gui/convert-dialog.c + * app/gui/module-browser.c + * app/gui/offset-dialog.c + * app/gui/palette-import-dialog.c + * app/gui/resize-dialog.c + * app/gui/resolution-calibrate-dialog.c + * app/gui/tips-dialog.c + * app/gui/user-install-dialog.c + * app/widgets/gimpwidgets-utils.c + * libgimpwidgets/gimpquerybox.c: set dialog border spacing to 12. + +2004-05-04 Sven Neumann <sven@gimp.org> + + * app/gui/preferences-dialog.c + * app/widgets/widgets-enums.[ch] + * app/widgets/gimpwidgets-utils.c (gimp_window_set_hint): added + new window hint "keep-above" to force toolbox and/or dock windows + to be kept above (if the WM supports this hint). Fixes bug #131672. + +2004-05-04 Michael Natterer <mitch@gimp.org> + + Fix bug #141719: + + * app/tools/gimpmovetool.c (gimp_move_tool_motion): use RINT() + instead of ROUND() to round double coords to guide positions. + + * app/display/gimpdisplayshell-callbacks.c + (gimp_display_shell_canvas_tool_events): pass RINT()-rounded + coords to gimp_display_shell_update_cursor() instead of implicitly + truncating by casting to int. + +2004-05-04 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpundoeditor.c: removed code duplication by adding + utility function gimp_undo_editor_update_buttons(), some general + cleanups. + +2004-05-04 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage.c (gimp_image_undo_freeze,thaw): emit the + "undo-freeze" and "undo-thaw" signals only on the first freeze and + last thaw, not on any of them. + + * app/widgets/gimphelp-ids.h: added GIMP_HELP_EDIT_UNDO_CLEAR. + + * app/widgets/gimpundoeditor.[ch]: added a "Clear Undo History" + button. Fixes bug #136300. + + Also don't attach to the image's undo stack if the image's undo is + disabled and set the buttons' sensitivity accordingly. Should fix + all kinds of unpredictable undo history brokenness. + +2004-05-04 Michael Natterer <mitch@gimp.org> + + Treat FG/BG just like all other context properties: + + * app/paint/gimppaintoptions.h: added GIMP_CONTEXT_FOREGROUND_MASK + and _BACKGROUND_MASK to GIMP_PAINT_OPTIONS_CONTEXT_MASK to specify + that they are used by GimpPaintOptions (automatically affects all + paint tools). + + * app/tools/gimpblendtool.c + * app/tools/gimpbucketfilltool.c + * app/tools/gimpinktool.c: set FOREGROUND_MASK and BACKGROUND_MASK + manually here. + + * app/tools/tool_manager.c (tool_manager_tool_changed): decide + about the globality of FG and BG at the same place where we decide + about the brush's, pattern's etc. globality, but hardcode them to + global = TRUE instead of looking at GimpConfig. + + Fixes bug #141786. + +2004-05-04 Sven Neumann <sven@gimp.org> + + * plug-ins/common/sobel.c (sobel_dialog): removed frame, adjusted + spacing, fixes bug #141773. + +2004-05-04 Sven Neumann <sven@gimp.org> + + * app/gui/stroke-dialog.c: + * app/widgets/gimpstrokeeditor.c: moved line style options into a + GtkExpander. Changed dialog spacings. + +2004-05-03 Manish Singh <yosh@gimp.org> + + * app/actions/qmask-actions.c: initialize is_active for qmask-toggle. + + * app/actions/tools-actions.c: set entry help_id from tool_info, + since gimp_action_group_add_string_actions expects it to be there + now. + +2004-05-03 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpframe.c (gimp_frame_new): added a hack that + allows to get the label_spacing but no label. Useful when the frame + is packed into a GtkExpander. + + * app/widgets/gimptemplateeditor.c: pack the "Image Comment" frame + into a GtkExpander to reduce clutter and dialog size. + +2004-05-03 Michael Natterer <mitch@gimp.org> + + * libgimpwidgets/gimphelpui.[ch]: added gimp_help_id_quark() + which is G_GNUC_CONST and a new macro GIMP_HELP_ID as shortcut. + + * app/widgets/gimpactiongroup.c (gimp_action_group_add_*_actions): + attach the help ID to the action using the new quark key. Call + gtk_action_group_add_action() instead of the _with_accel() variant + if the accel is the empty string (== if we explicitely want no + accel even if the stock item specifies one). Fixes warning flood + with GTK+ 2.4.1. + +2004-05-03 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpframe.c: if the label_widget is a button, set + the button label as bold. Cache the indentation instead of + calculating it over and over again. + + * themes/Default/gtkrc: set HIG-compliant spacing for the + action_area. + + * app/widgets/gimppropwidgets.[ch]: added + gimp_prop_enum_radio_box_new() for a radio group that is no + embedded in a frame. + + * app/widgets/gimpstrokeeditor.c: use a frame-less radio box for + the Stroke style. + + * app/gui/file-new-dialog.c + * app/gui/grid-dialog.c + * app/gui/stroke-dialog.c: HIG-compliant spacings. + +2004-05-03 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdock.c (gimp_dock_key_press_event): new function + which overrides GtkWindow's default handler in order to give the + focus widget precedence over accelerators for keys without any + modifier or with <Shift> modifier. Enables e.g. having a <Shift>+s + accelerator while still being able to enter 'S' in an entry. + Thanks to Tim Janik for the code. + +2004-05-03 Michael Natterer <mitch@gimp.org> + + * app/actions/actions.h. added the various return_if_no_foo() + macros here. + + * app/actions/channels-commands.c + * app/actions/dialogs-commands.c + * app/actions/drawable-commands.c + * app/actions/edit-commands.c + * app/actions/file-commands.c + * app/actions/image-commands.c + * app/actions/layers-commands.c + * app/actions/qmask-commands.c + * app/actions/select-commands.c + * app/actions/vectors-commands.c + * app/actions/view-commands.c: removed them here. Some cleanup. + +2004-05-03 Michael Natterer <mitch@gimp.org> + + * app/actions/actions.[ch]: added some utility functions to get a + Gimp, GimpImage, GimpDisplay and GtkWidget from the "data" pointer + passed to action callbacks. + + * app/actions/channels-actions.c + * app/actions/channels-commands.c + * app/actions/drawable-actions.c + * app/actions/drawable-commands.c + * app/actions/edit-actions.c + * app/actions/edit-commands.c + * app/actions/file-actions.c + * app/actions/file-commands.c + * app/actions/help-commands.c + * app/actions/image-actions.c + * app/actions/image-commands.c + * app/actions/layers-actions.c + * app/actions/layers-commands.c + * app/actions/plug-in-actions.c + * app/actions/plug-in-commands.c + * app/actions/qmask-actions.c + * app/actions/qmask-commands.c + * app/actions/select-actions.c + * app/actions/select-commands.c + * app/actions/tools-commands.c + * app/actions/vectors-actions.c + * app/actions/vectors-commands.c + * app/actions/view-commands.c: use the new functions instead of + duplicating insane macros and if() constructs over and over again. + +2004-05-03 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpwidgets.c: use a GimpFrame for + gimp_radio_group_new() and friends. + + * themes/Default/gtkrc + * themes/Small/gtkrc: set a smaller label_spacing for GimpFrame + widgets in GimpDockables. Lame hack to keep the tool options + compact. + + * app/actions/image-commands.c: changed spacing. + + * app/gui/offset-dialog.c: merged check and radio buttons into a + single radio button group; changed spacing. + +2004-05-03 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpframe.c (gimp_frame_size_allocate): respect + the frame's border width. + + * app/widgets/gimpcolorframe.[ch]: derive from GimpFrame. + + * app/gui/convert-dialog.c + * app/gui/info-window.c + * app/gui/palette-import-dialog.c + * app/gui/resize-dialog.c: use GimpFrames, changed some spacings. + +2004-05-03 Michael Natterer <mitch@gimp.org> + + * app/actions/dockable-commands.c (dockable_add_tab_cmd_callback): + truncate the passed dialog identifier at the first '|'. Fixes + creating brushes, paterns etc. dialogs from the dockables' + "Add Tab" menu. + +2004-05-02 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpframe.c (gimp_frame_size_request): take the + left margin into account. + + * app/widgets/gimpgrideditor.c + * app/widgets/gimptemplateeditor.c: removed container borders that + aren't needed any longer. + +2004-05-02 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpenumwidgets.c + * app/widgets/gimpgrideditor.c + * app/widgets/gimptemplateeditor.c: use the GimpFrame widget, + changed some spacings to better comply with the HIG. + +2004-05-02 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgets.h + * libgimpwidgets/gimpwidgetstypes.h + * libgimpwidgets/gimpframe.[ch]: added new widget GimpFrame, a HIG + compliant variant of GtkFrame. + + * app/gui/preferences-dialog.c: enable the HIG compliant mode by + default and use the new GimpFrame widget for it. + + * themes/Small/gtkrc: set a smaller spacing between the GimpFrame + title label and the frame content. + +2004-05-02 Michael Natterer <mitch@gimp.org> + + * app/actions/qmask-actions.c: renamed action "qmask-toggle" to + "qmask-active" and added new action "qmask-toggle" with a label + and shortcut suited for the "Select" menu. + + * app/actions/select-actions.c: removed "select-toggle-qmask". + + * app/actions/select-commands.[ch]: removed callback + select_toggle_quickmask_cmd_callback(). + + * app/actions/channels-actions.c (channels_actions_update) + * app/actions/vectors-actions.c (vectors_actions_update): handle + "data" being both GimpDisplay and GimpDisplayShell so the actions + can be used in the image menu. + + * menus/image-menu.xml.in: s/select-toggle-qmask/qmask-toggle/. + + * menus/qmask-menu.xml: s/qmask-toggle/qmask-active/. + +2004-05-02 Sven Neumann <sven@gimp.org> + + * menus/image-menu.xml.in + * menus/tool-options-menu.xml + * menus/toolbox-menu.xml.in: use empty elements for empty menus. + Makes the XML somewhat easier to read. + +2004-05-02 Sven Neumann <sven@gimp.org> + + * menus/Makefile.am + * menus/dialogs-menuitems.xml: new file that holds menuitems that + appear in several places. + + * menus/dockable-menu.xml.in: new file used to generate + dockable-menu.xml. + + * menus/toolbox-menu.xml.in: new file used to generate + toolbox-menu.xml. + + * menus/image-menu.xml.in: include dialogs-menuitems.xml. + + * menus/menus.xsl: allow inclusion of menuitems using XInclude. + +2004-05-02 Michael Natterer <mitch@gimp.org> + + * app/actions/Makefile.am + * app/actions/file-dialog-actions.[ch]: new files containing + factored out code to set up the <Load> and <Save> actions. + Use GimpPlugInActions instead of just GtkActions. + + * app/actions/file-dialog-commands.[ch]: new files containing + file_dialog_type_cmd_callback() which is a + GimpPlugInAction::selected() callback now. + + * app/actions/file-commands.[ch]: removed the callback here. + + * app/actions/file-open-actions.c + * app/actions/file-save-actions.c: removed code duplication and + use file_dialog_actions_setup() instead. + +2004-05-02 Michael Natterer <mitch@gimp.org> + + * app/actions/*-actions.c: added help IDs to all actions + representing the toplevel popups and menus (as fallbacks for the + still-to-be-written help system intrgration of GimpUIManager). + + * app/display/gimpdisplayshell.c (gimp_display_shell_new): removed + call to gtk_ui_manager_ensure_update() because that's done by + gimp_ui_manager_ui_get() now. + + * app/widgets/gimpmenufactory.[ch]: removed API to register and + create item factories. + + * app/gui/menus.c: changed accordingly. + + * app/gui/dialogs.c + * app/actions/plug-in-commands.c + * app/gui/file-dialog-utils.c + * app/gui/file-save-dialog.c + * app/widgets/gimpdataeditor.c + * app/widgets/gimpdockable.c + * app/widgets/gimpdockbook.[ch] + * app/widgets/gimpimagedock.c + * app/widgets/gimpitemtreeview.c: removed leftover item factory + cruft. + + * app/widgets/widgets-types.h: removed item factory typedefs... + + * app/widgets/gimpitemfactory.h: ...and added them here. + + * app/widgets/gimpactiongroup.[ch]: added new function + gimp_action_group_add_plug_in_actions(). + + * app/actions/plug-in-actions.c: use it here instead of adding + the actions manually. + + * app/widgets/gimptoolbox.c: ported the code which dynamically + updates the tool button tooltips on accelerator changes to + GtkAction. Disabled the whole stuff because GTK+ lacks + gtk_action_get_accel_closure(). + +2004-05-02 Sven Neumann <sven@gimp.org> + + * menus/Makefile.am: added a rule to generate gtkuimanager XML + files using an XSL transformation. + + * menus/menus.xsl: a simple XSLT to generate a menubar and a popup + menu with identical content. + + * menus/image-menu.xml: removed this file from CVS ... + + * menus/image-menu.xml.in: ... and added this instead. + + * HACKING: xsltproc is now needed to build from CVS. + +2004-05-01 Sven Neumann <sven@gimp.org> + + * configure.in: check for xmllint and xsltproc but don't require + these tools. + + * menus/Makefile.am + * tips/Makefile.am: simplified "validate" targets. + +2004-04-30 Pedro Gimeno <pggimeno@wanadoo.es> + + * app/tools/gimprectselecttool.c: Cleanups. + (gimp_rect_select_tool_coords_to_integer): Undo my bogus fix for + bug #138103, which led to bug #140649. + + * app/pdb/procedural_db.c (procedural_db_init_procs): Add missing + compat procs: gimp_channel_ops_duplicate, gimp_channel_ops_offset. + +2004-04-30 Sven Neumann <sven@gimp.org> + + * app/gui/tool-options-menu.c: added casts to please the compiler. + +2004-04-30 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpuimanager.[ch]: added signal "update" which + is G_SIGNAL_RUN_LAST, so handlers can hook in before and after + the default implementation. Update the action groups + in the default implementations. + + (gimp_ui_manager_ui_get): make sure we always return a widget + by calling gtk_ui_manager_ensure_update(). + + * app/widgets/gimpdockable.c (gimp_dockable_show_menu): make + sure the dockable menu is loaded before trying to access its + widgets/actions. + + Resurrected the dynamic tool options menus: + + * app/actions/tool-options-actions.c: dynamically destroy/create + actions for the tool options' presets. + + * app/actions/tool-options-commands.[ch]: all callbacks are + GimpEnumAction::selected() callbacks now. + + * app/gui/tool-options-menu.[ch]: connect and connect_after to + GimpUIManager::update(). Remove the old preset menu items + in the former callback, create the new ones in the latter. + Removed the last item factory entries. + + * app/gui/menus.c + * app/widgets/gimptooloptionseditor.c: changed accordingly. + +2004-04-29 Simon Budig <simon@gimp.org> + + * app/main.c: when glibc is used, call mallopt, so that memory + chunks >= 4k (= 64*64 pixels, 1bpp - the smallest full tile) + get allocated via mmap. This ensures that after closing an image + the memory allocated for image data gets returned to the system. + + Thanks to Phil Blundell <pb@nexus.co.uk> for bringing mallopt + to my attention. + + Please watch closely for performance problems. + +2004-04-29 Michael Natterer <mitch@gimp.org> + + * app/actions/Makefile.am + * app/actions/file-open-actions.[ch] + * app/actions/file-save-actions.[ch]: actions for the <Load> and + <Save> menus... + + * menus/Makefile.am + * menus/file-open-menu.xml + * menus/file-save-menu.xml: ...and the menus. + + * app/gui/file-open-menu.[ch] + * app/gui/file-save-menu.[ch]: ported to UI Manager. + + * app/widgets/gimpfiledialog.[ch]: ditto. + + * app/actions/actions.c + * app/gui/menus.c + * app/gui/file-open-dialog.c + * app/gui/file-save-dialog.c: changed accordingly. + + * app/widgets/gimpuimanager.c: removed debugging code which + automatically loaded all registered menus. They are now loaded on + demand only. + +2004-04-29 Michael Natterer <mitch@gimp.org> + + * libgimpbase/gimputils.[ch] (gimp_escape_uline): new function + which does the opposite of gimp_strip_uline(). + + * app/actions/file-actions.c (file_actions_last_opened_update): + escape ulines in filenames so they don't end up as mnemonics. + Spotted by Pedro Gimeno. + +2004-04-29 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/plug-ins/py-slice.py: Quick fix to make uppercase + tags work properly. + +2004-04-29 Michael Natterer <mitch@gimp.org> + + * app/tools/gimp*tool.c (gimp_*_tool_register): stripped the menu + paths from the "menu_path". Will be renamed to "action_name" or + something soon... + + * plug-ins/dbbrowser/dbbrowser.c + * plug-ins/common/plugindetails.c + * plug-ins/common/uniteditor.c: register under the new + "Extensions" placeholder. + +2004-04-29 Michael Natterer <mitch@gimp.org> + + Switch from GtkItemFactory to GtkUIManager. The migration is + almost complete, still stuff missing/incomplete, definitely added + a bunch of new bugs... + + * app/actions/*-commands.[ch]: converted all callback from + GtkItemFactory callbacks to GtkAction callbacks. + + * app/actions/debug-actions.c + * app/actions/gradient-editor-actions.c + * app/actions/help-actions.c + * app/actions/plug-in-actions.c + * app/actions/qmask-actions.c + * app/actions/tool-options-actions.c: various fixes. + + * app/display/gimpdisplay.[ch] + * app/display/gimpdisplayshell-appearance.[ch] + * app/display/gimpdisplayshell-callbacks.c + * app/display/gimpdisplayshell.[ch]: move everything from + GtkItemFactory to GtkUIManager. + + * app/gui/dialogs.[ch]: added new function dialogs_get_toolbox(). + Needed because the action callbacks don't have a widget parameter + and sometimes we need a parent window for showing dialogs. + + * app/gui/Makefile.am + * app/gui/brushes-menu.[ch] + * app/gui/buffers-menu.[ch] + * app/gui/channels-menu.[ch] + * app/gui/colormap-editor-menu.[ch] + * app/gui/dialogs-menu.[ch] + * app/gui/documents-menu.[ch] + * app/gui/error-console-menu.[ch] + * app/gui/fonts-menu.[ch] + * app/gui/gradient-editor-menu.[ch] + * app/gui/gradients-menu.[ch] + * app/gui/images-menu.[ch] + * app/gui/layers-menu.[ch] + * app/gui/palette-editor-menu.[ch] + * app/gui/palettes-menu.[ch] + * app/gui/patterns-menu.[ch] + * app/gui/qmask-menu.[ch] + * app/gui/templates-menu.[ch] + * app/gui/vectors-menu.[ch]: removed these files. + + * app/gui/gui.c: create a global UI manager for the image popup + menu and the toolbox menubar. + + * app/gui/menus.[ch]: removed all GtkItemFactory code. + + * app/gui/image-menu.[ch] + * app/gui/toolbox-menu.[ch]: removed everything except the trivial + setup_funcs. + + * app/gui/file-open-menu.c + * app/gui/file-save-menu.c + * app/gui/tool-options-menu.c: don't use the macros from menus.h + any more, they are gone. + + * app/gui/gui-vtable.c + * app/gui/plug-in-menus.[ch]: create/destroy the dynamic plug-in + menu entries. + + * app/tools/gimpimagemaptool.c: s/gimp_item_factory_update/ + gimp_ui_manager_update/g + + * app/widgets/gimpuimanager.[ch]: added API to get an action + group by name. + + * app/widgets/gimpmenufactory.c: don't choke on the item_factory + entries being NULL. + + * app/widgets/gimpactiongroup.c: make sure booleans set using + g_object_set() only have TRUE or FALSE values. + + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimpcomponenteditor.c + * app/widgets/gimpcontainereditor.[ch] + * app/widgets/gimpcontainergridview.c + * app/widgets/gimpcontainertreeview.c + * app/widgets/gimpdockable.[ch] + * app/widgets/gimpdocked.[ch] + * app/widgets/gimpeditor.[ch] + * app/widgets/gimperrorconsole.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimppaletteeditor.c + * app/widgets/gimptoolbox.c + * app/widgets/gimptooloptionseditor.c: removed all GtkItemFactory + code and enable the #if 0'ed UI manager stuff. + + * menus/gradient-editor-menu.xml: fixed typos. + + * menus/image-menu.xml: duplicate everything so we have both + an image menubar and an image popup menu. Badly cries for an + XSL processor. + + * menus/toolbox-menu.xml: added an "Extensions" placeholder. + +2004-04-27 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimppluginaction.[ch]: new GtkAction subclass which + remembers the PlugInProcDef. + + * app/widgets/gimpactiongroup.[ch]: added "gpointer user_data" to + the GimpActionGroup struct and to gimp_action_group_new(). Removed + the user_data parameter from gimp_action_group_add_*_actions(). + + * app/widgets/gimpactionfactory.[ch]: changed accordingly. + + * app/actions/*-actions.[ch]: removed user_data from all setup_funcs. + + * app/actions/plug-in-actions.c: use a GimpPlugInAction and + finally use the right user_data for the callback so plug-in + callbacks have a proper context. + + * app/gui/plug-in-menus.[ch]: renamed plug_in_menus_create2() to + plug_in_menus_setup(). + + * app/gui/image-menu.c + * app/gui/toolbox-menu.c: changed accordingly. + +2004-04-27 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpactiongroup.[ch]: removed "translation-domain" + property and simply use gettext(). Plug-In domains are handled + by plug-in-actions.c + + The following change finally starts breaking the old menu system + while the new one is not fully in place yet. Have fun: + + * menus/image-menu.xml: added several <placeholder>s for plug-ins + to register their menu entries in the middle of already existing + menus. + + * app/gui/menus.c + * plug-ins/common/mail.c + * plug-ins/print/print.c + * plug-ins/script-fu/scripts/copy-visible.scm: use the new + placeholders to register menu entries. + +2004-04-27 Michael Natterer <mitch@gimp.org> + + Correctly translated & sorted plug-in actions & menu entries: + + * app/widgets/gimpuimanager.[ch]: added a "gchar *name" property + and a hash table which keeps all created UI managers (similar to + GimpActionGroup's hash table). Added function + gimp_ui_managers_from_name() which returns a list of all managers + with the given name. + + * app/widgets/gimpmenufactory.c: register a name per UI manager + and pass the name to gimp_ui_manager_new(). + + * app/actions/plug-in-actions.c: added code which correctly + translates the created plug-in actions and also creates translated + menu actions for the plug-in's menu_path elements. + + * app/gui/plug-in-menus.[ch]: sort the plug-ins' menu entries + using a GTree. For each entry, recursivlely create submenus + from the dynamic menu actions created above before creating + the plug-in's menu entry itself. + + * app/gui/image-menu.c (image_menu_setup2) + * app/gui/toolbox-menu.c (toolbox_menu_setup2): call + plug_in_menus_create2(). + + * app/gui/gui-vtable.c (gui_menus_create_entry) + (gui_menus_delete_entry): added some uglyness which maps old <Prefix> + menu identifiers to new-style UI manager plus ui_path tuples and + call plug_in_menus_add,remove_proc() accordingly. + + * menus/image-menu.xml + * menus/toolbox-menu.xml: added name="Foo" attributes to all menus + so plug-in entries find their place. + +2004-04-27 Michael Natterer <mitch@gimp.org> + + * app/gui/gui.c (gui_restore_callback): call actions_init() + (gui_exit_after_callback): call actions_exit(). + + * app/gui/menus.c (menus_init) + (menu_exit): don't call them here. + +2004-04-26 Michael Natterer <mitch@gimp.org> + + * app/widgets/widgets-types.h: added GimpUIManagerSetupFunc typedef. + + * app/widgets/gimpuimanager.[ch]: added the setup_func to the + GimpUIManagerUIEntry struct and to gimp_ui_manager_ui_register(). + Call the setup_func after creating the UI. Replaced the term + "identifier" by "ui_path". + + * app/widgets/gimpmenufactory.c: ditto. + + * app/gui/menus.c (menus_init): register the new setup_funcs below. + + * app/gui/menus.[ch] (menus_open_recent_add) + * app/gui/image-menu.[ch] (image_menu_setup2) + * app/gui/toolbox-menu.[ch] (toolbox_menu_setup2): new setup_funcs + which add the "Open Recent" menu items. + + * app/actions/file-actions.c: removed "file-open-recent-empty" + action because it's not needed. + + * menus/image-menu.xml + * menus/toolbox-menu.xml: removed "file-open-recent-empty" menu + items and added <placeholder>s for the "Open Recent" menu items. + +2004-04-26 Michael Natterer <mitch@gimp.org> + + * app/core/gimp.[ch]: removed "locale_domain" and "help_domain" + parameters from GimpMenusCreateFunc. + + * app/plug-in/plug-ins.c (plug_ins_temp_proc_def_add) + * app/actions/plug-in-actions.[ch] (plug_in_actions_add_proc_def): + changed accordingly. + + * app/widgets/gimpactiongroup.[ch]: remember all created action + groups is a hash table in GimpActionGroupClass. Added + gimp_action_groups_from_name() which returns a GList of all groups + with the given name. + + * app/actions/plug-in-actions.[ch] (plug_in_actions_setup): + removed the tree sorting code. Actions don't need to be ordered + alphabetically. + + (plug_in_actions_update): copied & ported plug_in_menus_update(). + + * app/gui/gui-vtable.c (gui_menus_create,delete_entry): + dynamically add/remove plug-in actions in all "plug-in" action + groups. + +2004-04-25 Michael Natterer <mitch@gimp.org> + + * app/core/gimp.[ch]: changed GimpMenusDeleteFunc to take + a PlugInProcDef* instead of a const gchar*. + + * app/plug-in/plug-ins.c + * app/gui/gui-vtable.c + * app/gui/plug-in-menus.[ch]: changed accordingly. + +2004-04-25 Sven Neumann <sven@gimp.org> + + * plug-ins/common/AlienMap2.c: some UI improvements based on a + patch by William Skaggs (bug #140079). + +2004-04-22 Sven Neumann <sven@gimp.org> + + * app/gui/dialogs-constructors.c + * app/gui/preferences-dialog.c: silent the compiler. + + * plug-ins/winicon/icodialog.c: simplified by using a + GimpIntComboBox. + +2004-04-22 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpuimanager.[ch]: remember and ref the created + widgets. Added gimp_ui_manager_ui_popup() which pops up a GtkMenu + with a custom GimpMenuPositionFunc and a GtkDestroyNotify which is + called on popdown. + + * app/widgets/gimpmenufactory.c (gimp_menu_factory_finalize): + don't forget to free the list of managed UIs. + + * app/widgets/gimpdockable.[ch] + * app/widgets/gimpdockbook.[ch] + * app/widgets/gimpdocked.[ch] + * app/widgets/gimpeditor.[ch]: added GimpUIManager stuff parallel + to the to-be-removed GtkItemFactory stuff. + + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimpcomponenteditor.c + * app/widgets/gimpcontainereditor.c + * app/widgets/gimpcontainergridview.c + * app/widgets/gimpcontainertreeview.c + * app/widgets/gimperrorconsole.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimpitemtreeview.c + * app/widgets/gimppaletteeditor.c + * app/widgets/gimptooloptionseditor.c: changed accordingly and added + #if 0'ed code which actually uses all the UI managers. + + * app/display/gimpdisplay.c + * app/display/gimpdisplayshell.c + * app/gui/gui-vtable.c: disabled some gimp_ui_manager_update() + calls because they were invoking toggle and radio callbacks + which still have the wrong signature. + +2004-04-22 Sven Neumann <sven@gimp.org> + + * plug-ins/gflare/gflare.c: ported the last plug-in from + GtkOptionMenu to GimpIntComboBox. + + * plug-ins/common/newsprint.c: changed a comment that was still + talking about option menus. + +2004-04-22 Michael Natterer <mitch@gimp.org> + + * app/gui/menus.c (menus_init): fixed some typos in the UI Manager + registration code. + +2004-04-22 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpactiongroup.[ch]: implemented + gimp_action_group_set_action_color() and + gimp_action_group_set_action_viewable(). + + * app/actions/*-actions.c: added stock IDs to all actions which + represent toplevel popup menus. Fixed typos. + + * menus/brushes-menu.xml + * menus/colormap-editor-menu.xml + * menus/dockable-menu.xml + * menus/gradients-menu.xml + * menus/patterns-menu.xml + * menus/toolbox-menu.xml: fixed typos. + +2004-04-22 Sven Neumann <sven@gimp.org> + + * plug-ins/rcm/rcm_callback.[ch] + * plug-ins/rcm/rcm_dialog.c: ported from GtkOptionMenu to + GimpIntComboBox. + +2004-04-22 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpintstore.[ch]: automatically add an "(Empty)" + item if the store is empty and remove it as soon as other items + are being added. + + * libgimp/gimpdrawablecombobox.c + * libgimp/gimpimagecombobox.c: removed handling of the empty list; + the store does this for us now. + +2004-04-22 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpintcombobox.c (gimp_int_combo_box_new): + removed the check for first_label != NULL. Passing a NULL label + makes a perfect empty combo_box. + + * plug-ins/common/newsprint.c + * plug-ins/common/spheredesigner.c: ported from GtkOptioMenu to + GimpIntComboBox. + +2004-04-22 Sven Neumann <sven@gimp.org> + + * plug-ins/flame/flame.c + * plug-ins/gimpressionist/brush.c: ported the last two users of + gimpmenu.h to GimpDrawableComboBox. + + * libgimp/gimpmenu.[ch]: declared the functions found here as + deprecated. + + * plug-ins/common/plugindetails.c + * plug-ins/ifscompose/ifscompose.c: silent the compiler. + +2004-04-21 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablecombobox.c + * libgimp/gimpimagecombobox.c + * libgimp/gimpmenu.c: changed the label for the empty menu from + "None" to "Empty" since that's what GTK+ uses. + + * libgimpwidgets/gimpintcombobox.[ch]: added convenience function + gimp_int_combo_box_connect(). + + * plug-ins/common/bumpmap.c + * plug-ins/common/compose.c + * plug-ins/common/depthmerge.c + * plug-ins/common/displace.c + * plug-ins/common/lic.c + * plug-ins/common/warp.c: ported to GimpDrawableComboBox. + + * plug-ins/Lighting/lighting_ui.c + * plug-ins/MapObject/mapobject_ui.c + * plug-ins/common/sample_colorize.c: use + gimp_int_combo_box_connect(). This restores the correct behaviour + of setting the drawable_ID to the first drawable from the list if + it's invalid. + +2004-04-21 Michael Natterer <mitch@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpuimanager.[ch]: new GtkUIManager subclass. Adds + API to update all action groups and knows which UIs it can create + from which XML files. + + * app/widgets/gimpmenufactory.[ch]: register the XML file + basenames along with path of their toplevel menus. Create + GimpUIManagers instead of GtkUIManagers and register the + XML files and menu paths with them. + + * app/gui/menus.c: register all XML files and their toplevel + menu paths. + + * app/widgets/gimpeditor.[ch]: also create a GimpUIManager when + creating the GtkItemFactory. Added "const gchar *ui_identifier" + parameter to gimp_editor_create_menu(). + + * app/widgets/gimpcontainereditor.[ch] + * app/widgets/gimpdataeditor.[ch] + * app/widgets/gimpdatafactoryview.[ch] + * app/widgets/gimpitemtreeview.[ch]: added "ui_identifier" + parameters to all constructors. + + * app/widgets/gimpbrusheditor.c + * app/widgets/gimpbrushfactoryview.c + * app/widgets/gimpbufferview.c + * app/widgets/gimpcolormapeditor.c + * app/widgets/gimpcomponenteditor.c + * app/widgets/gimpcontainerpopup.c + * app/widgets/gimpdocumentview.c + * app/widgets/gimperrorconsole.c + * app/widgets/gimpfontview.c + * app/widgets/gimpgradienteditor.c + * app/widgets/gimpimageview.c + * app/widgets/gimppaletteeditor.c + * app/widgets/gimppatternfactoryview.c + * app/widgets/gimptemplateview.c + * app/widgets/gimptooloptionseditor.c + * app/gui/dialogs-constructors.c + * app/gui/gradient-select.c + * app/gui/palette-select.c + * app/gui/pattern-select.c: pass UI identifiers to the changed + functions above. + + * app/display/gimpdisplayshell.[ch]: added a GimpUIManager for + the menubar (menubar creating code still commented out). + + * app/display/gimpdisplay.c + * app/gui/gui-vtable.c: update the ui manager. + +2004-04-21 Michael Natterer <mitch@gimp.org> + + * app/actions/actions.c: forgot to register the "patterns" actions. + + * app/actions/*-actions.c: added actions representing the toplevel + menus (popups and menubars). Fixed some typos. + + * menus/*-menu.xml: added action="foo" attributes to all toplevel + menus. Fixed typos here too. + + * menus/gtkuimanager.dtd: fixed possible attributes. + +2004-04-21 Sven Neumann <sven@gimp.org> + + * libgimp/gimpmenu.c (gimp_menu_add_none): use the same label as + in the new combo_box widgets. + + * libgimpwidgets/gimpintcombobox.[ch] + * libgimpwidgets/gimpintstore.[ch]: use LibGIMP copyright headers. + +2004-04-21 Sven Neumann <sven@gimp.org> + + * libgimp/gimpdrawablecombobox.c + * libgimp/gimpimagecombobox.c + * libgimp/gimppixbuf.c + * libgimpwidgets/gimpintcombobox.c + * libgimpwidgets/gimpintstore.c: API documentation. + +2004-04-21 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpintcombobox.[ch]: added new functions + gimp_int_combo_box_[prepend|append]. + + * plug-ins/common/sample_colorize.c: ported to GimpDrawableComboBox. + +2004-04-21 Michael Natterer <mitch@gimp.org> + + * app/actions/qmask-actions.c + * app/actions/qmask-commands.c: prepared qmask_actions_update() + and the qmask callbacks to be merged into the image ui manager. + + * app/actions/dialogs-actions.c + * app/actions/edit-actions.c + * app/actions/file-actions.c + * app/actions/image-actions.c + * app/actions/layers-actions.c + * app/actions/plug-in-actions.c + * app/actions/tools-actions.c + * app/actions/view-actions.c: fixed lots of typos and buglets + spotted in my first test run. + + * app/gui/menus.c: register the needed action groups with the + <Image> menu. + + * app/tools/gimp-tools.c + * app/tools/gimpdodgeburntool.[ch] + * app/tools/gimppaintoptions-gui.c: s/dodgeburn/dodge_burn/g. + + * app/widgets/gimpactionfactory.c + * app/widgets/gimpmenufactory.[ch]: s/G_GNUC_FUNCTION/G_STRFUNC/g, + updated copyright header. + + * menus/image-menu.xml: fixed typos and added the "Filters" + submenus. + +2004-04-21 Michael Natterer <mitch@gimp.org> + + More unused action stuff: + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpactionfactory.[ch]: added a simple factory which + produces GimpActionGroups. + + * app/widgets/gimpactiongroup.[ch]: added an "update_func" member + to the GimpActionGroup struct. Added it as parameter to + gimp_action_group_new(). Added function gimp_action_group_update(). + + * app/widgets/gimpmenufactory.[ch]: added an "action_factory" + member and constructor parameter. Added code to create + GtkUIManagers from registered action group identifiers. + + * app/actions/Makefile.am + * app/actions/actions.[ch]: new files: create a + "global_action_factory" and register all action groups with it. + + * app/actions/edit-actions.c: s/edit_action_update/edit_actions_update/ + + * app/actions/plug-in-actions.[ch]: added API to add/remove + plug-in procedure actions dynamically (unfinished). + + * app/gui/menus.c (menus_init): call actions_init(). + (menus_exit): call actions_exit(). + +2004-04-21 Sven Neumann <sven@gimp.org> + + * plug-ins/Lighting/lighting_ui.c + * plug-ins/MapObject/mapobject_ui.c: ported to the new API. + +2004-04-21 Sven Neumann <sven@gimp.org> + + * libgimp/Makefile.am + * libgimp/gimpui.h + * libgimp/gimppixbuf.[ch]: new file that holds pixbuf accessors + to gimp data (drawable and image thumbnails for now). + + * libgimp/gimpdrawablecombobox.[ch] + * libgimp/gimpimagecombobox.[ch]: new files with GimpIntComboBox + constructors for image, drawable, channel and layer menus. + + * plug-ins/script-fu/script-fu-scripts.c: use the new functions + instead of the gimpmenu API that is about to be deprecated. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * tools/pdbgen/pdb/fileops.pdb (file_load_thumbnail): removed + color cast. Merged from stable branch. + + * app/pdb/fileops_cmds.c: regenerated. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgets.h + * libgimpwidgets/gimpwidgetstypes.h + * libgimpwidgets/gimpintstore.[ch]: added a GimpIntStore, derived + from GtkListStore, to be used by GimpIntComboBox and also by the + image and drawable menus. + + * libgimpwidgets/gimpintcombobox.c: use the new GimpIntStore. + + * app/widgets/gimpenumstore.[ch]: derive from GimpIntStore, + removed API that is provided by the parent class. + + * app/widgets/gimpenumcombobox.[ch]: derive from GimpIntComboBox, + removed API that is provided by the parent class. + + * app/gui/resize-dialog.c + * app/tools/gimpcurvestool.c + * app/tools/gimplevelstool.c + * app/widgets/gimpcolorframe.c + * app/widgets/gimphistogrameditor.c + * app/widgets/gimppropwidgets.c + * app/widgets/gimpstrokeeditor.c: changed accordingly. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpenumstore.[ch] + * app/widgets/gimpenumcombobox.c: let the pixbuf renderer take care + of rendering the pixbuf from the stock_id. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/gimpmemsizeentry.c + * modules/cdisplay_colorblind.c + * modules/cdisplay_proof.c: ported to GimpIntComboBox. + + * libgimpwidgets/gimpwidgets.[ch]: declared the gimp option_menu + API as deprecated and removed the code here. + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpoldwidgets.[ch]: new files with deprecated + code, guarded with #ifndef GIMP_DISABLE_DEPRECATED ... #endif. + + * libgimpwidgets/gimpintcombobox.h: added G_BEGIN_DECLS, G_END_DECLS. + + * configure.in (CPP_FLAGS): added -DGIMP_DISABLE_DEPRECATED. + + * app/widgets/gimpwidgets-constructors.c: added a #warning and + #undef GIMP_DISABLE_DEPRECATED. The paint mode menu is the last + remaining user of gimp_int_option_menu_new(). + +2004-04-20 Michael Natterer <mitch@gimp.org> + + * app/gui/convert-dialog.[ch]: renamed convert_to_indexed() + to convert_dialog_new() and return the dialog. Removed + convert_to_rgb() and convert_to_grayscale(). + + * app/gui/offset-dialog.[ch]: renamed offset_dialog_create() + to offset_dialog_new() and return the dialog. + + * app/Makefile.am + * app/actions/drawable-commands.c + * app/actions/image-commands.c: changed accordingly. + +2004-04-20 Michael Natterer <mitch@gimp.org> + + * app/gui/*-commands.[ch]: removed... + + * app/actions/*-commands.[ch]: ...and added here. + + * app/gui/Makefile.am + * app/gui/*-menu.c + * app/gui/dialogs-constructors.c + * app/gui/gui.c + * app/gui/menus.c + * app/actions/Makefile.am + * app/actions/*-actions.c: changed accordingly. + + * app/actions/plug-in-actions.[ch] + * app/actions/tools-actions.[ch]: new files. + + * app/Makefile.am: had to add more -u evilness because gui/ + and actions/ have cyclic dependencies. + + * menus/image-menu.xml: added some more items. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpwidgets-constructors.[ch]: added new function + gimp_paint_mode_menu_set_history(). + + * app/gui/brush-select.c + * app/widgets/gimplayertreeview.c + * app/widgets/gimppropwidgets.c: use the new function instead of + the deprecated gimp_int_option_menu API. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * plug-ins/common/align_layers.c + * plug-ins/common/borderaverage.c + * plug-ins/common/channel_mixer.c + * plug-ins/common/gif.c + * plug-ins/common/mng.c + * plug-ins/flame/flame.c + * plug-ins/gfig/gfig.c: ported remaining plug-ins to GimpIntComboBox. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * plug-ins/common/iwarp.c (iwarp_get_pixel): check tile != NULL + before unrefing it. Fixes bug #140554; merged from stable branch. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpenumcombobox.c: added more sanity checks. + + * libgimpwidgets/gimpintcombobox.[ch]: added another GimpIntComboBox + constructor: gimp_int_combo_box_new_array(). + + * plug-ins/Lighting/lighting_ui.c + * plug-ins/MapObject/mapobject_ui.c + * plug-ins/common/CML_explorer.c: ported to GimpIntComboBox. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * libgimpwidgets/Makefile.am + * libgimpwidgets/gimpwidgets.h + * libgimpwidgets/gimpwidgetstypes.h + * libgimpwidgets/gimpintcombobox.[ch]: added new widget + GimpIntComboBox, a GtkComboBox with a simple list store to hold a + label and an associated integer value. This is going to replace + gimp_int_option_menu. + + * plug-ins/common/jpeg.c + * plug-ins/print/gimp_main_window.c: ported these two plug-ins to + the newly added widget. + +2004-04-20 Sven Neumann <sven@gimp.org> + + * plug-ins/gfig/gfig.c: removed unused return locations for menu + item pointers. + +2004-04-19 Sven Neumann <sven@gimp.org> + + * configure.in: set gimp_plugin_version, gimp_sysconf_version and + gimp_data_version to 2.1 so that the development version is + clearly separated from stable gimp 2.0. + +2004-04-19 Michael Natterer <mitch@gimp.org> + + * menus/Makefile.am + * menus/image-menu.xml + * menus/tool-options-menu.xml: more menus. + +2004-04-19 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpactiongroup.c + * app/widgets/gimpenumcombobox.c + * app/widgets/gimpenumstore.c: fixed inline docs. + + * app/widgets/gimpenumaction.c: fixed property declaration. + +2004-04-19 Michael Natterer <mitch@gimp.org> + + * app/gui/colormap-editor-commands.[ch] + * app/gui/debug-commands.[ch] + * app/gui/dockable-commands.[ch] + * app/gui/error-console-commands.[ch] + * app/gui/file-commands.[ch] + * app/gui/gradient-editor-commands.[ch] + * app/gui/help-commands.[ch] + * app/gui/qmask-commands.[ch] + * app/gui/tool-options-commands.[ch]: removed "guint action" + parameter from all callbacks which don't need it. + +2004-04-19 Sven Neumann <sven@gimp.org> + + * menus/Makefile.am + * menus/gtkuimanager.dtd: added a DTD (basically copied from the + GTK+ API docs). Added a "validate" rule that allows to easily + validate the XML files. + + * menus/*.xml: added a DOCTYPE declaration that refers to the + newly added DTD. + + * app/widgets/gimpenumstore.[ch]: + * app/widgets/gimpenumcombobox.c: documented the new API. + +2004-04-19 Michael Natterer <mitch@gimp.org> + + * app/actions/Makefile.am + * app/actions/actions-types.h: oops, forgot to commit this one. + +2004-04-19 Michael Natterer <mitch@gimp.org> + + * menus/Makefile.am + * menus/toolbox-menu.xml: added the toolbox menu. + +2004-04-19 Michael Natterer <mitch@gimp.org> + + More GtkAction stuff (still unused): + + * configure.in: added new directories menus/ and app/actions/ + + * Makefile.am: build menus/ + + * menus/.cvsignore + * menus/Makefile.am + * menus/*-menu.xml: new files: XML menu descriptions for each menu + which is now defined in gui/*-menu.c. + + * app/widgets/widgets-types.h: some typedefs for GimpActionGroup. + + * app/widgets/gimpactiongroup.[ch]: added a "Gimp" construct-only + property. Added APIs to set actions visible/sensitive/active + and an unimplemented stub for setting the action's color. + + * app/Makefile.am: build actions/ and link libappactions.a + + * app/actions/.cvsignore + * app/actions/Makefile.am + * app/actions/*-actions.[ch]: new files: GtkActions for each + *-commands.c file in gui/. Ported all "update" functions from the + *-menu.c files. + (everything completely unused, untested and partly #if 0'ed) + + * app/core/gimpimage.[ch]: for reasons of (action-) symmetry, added + API to raise/lower channels/vectors to top/bottom. + + * app/gui/channels-commands.[ch] + * app/gui/vectors-commands.[ch]: added callbacks for the new + to top/bottom functions. + + * app/gui/Makefile.am + * app/gui/dockable-commands.[ch]: new files split out of + dialogs-commands.[ch]. + + * app/gui/dialogs-commands.[ch] + * app/gui/dialogs-menu.c: changed accordingly. + + * app/gui/edit-commands.[ch]: added edit_paste_into_cmd_callback() + and remove usage of "guint action". + + * app/gui/image-menu.c: changed accordingly. + + * app/gui/palette-editor-commands.[ch]: split + +palette_editor_new_color_cmd_callback() into separate callbacks + for adding from FG and BG. + + * app/gui/palette-editor-menu.c: changed accordingly. + +2004-04-19 Henrik Brix Andersen <brix@gimp.org> + + * plug-ins/script-fu/scripts/gimp-headers.scm + * plug-ins/script-fu/scripts/gimp-labels.scm: applied a patch from + William Skaggs which changes the sub menu title for the gimp web + theme to classic.gimp.org. Fixes bug #137036. + +2004-04-19 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpdrawabletreeview.c: removed unused includes. + +2004-04-19 Sven Neumann <sven@gimp.org> + + * app/widgets/gimppropwidgets.[ch] + * app/gui/preferences-dialog.c: replaced + gimp_prop_boolean_option_menu_new() with + gimp_prop_boolean_combo_box_new(). + +2004-04-19 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpenumstore.[ch]: avoid unnecessary casts. + + * app/widgets/gimpenumcombobox.[ch]: added an API that inserts a + GtkTreeModelFilter to make items invisible. This is a kludge to + workaround bug #135875. + + * app/tools/gimpcurvestool.c + * app/tools/gimplevelstool.c + * app/widgets/gimphistogrameditor.c: use the new function to hide + channels that are not available. + +2004-04-18 Henrik Brix Andersen <brix@gimp.org> + + * app/widgets/gimptemplateeditor.c + (gimp_template_editor_constructor): use g_signal_connect_object() + instead of g_signal_connect(). Fixes bug #140315. + +2004-04-18 Pedro Gimeno <pggimeno@wanadoo.es> + + * plug-ins/common/gauss_rle.c (gauss_rle): Oops, fixed my fix. + +2004-04-18 Pedro Gimeno <pggimeno@wanadoo.es> + + * plug-ins/common/gauss_iir.c: Change tabs to spaces all over the + file, in preparation for other changes. Minor cleanup. + + * plug-ins/common/gauss_rle.c (gauss_rle): Plug a leak with the + returned value from make_curve(). + + * plug-ins/common/tga.c (load_image): Fix a condition which was + preventing GRAYA images from loading. + +2004-04-18 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpenummenu.[ch]: removed GimpEnumMenu. + + * app/widgets/gimpenumwidgets.[ch]: moved widget constructors that + don't use GimpEnumMenu from gimpenummenu.[ch] to these new files. + + * app/widgets/gimpenumcombobox.[ch]: added a GtkComboBox widget + using GimpEnumStore; replaces GimpEnumMenu. + + * app/widgets/gimpenumstore.[ch]: added new function + gimp_enum_store_lookup_by_value(). + + * app/widgets/gimppropwidgets.[ch]: replaced + gimp_prop_enum_option_menu_new() with gimp_prop_enum_combo_box_new(). + + * app/gui/brush-select.[ch] + * app/gui/convert-dialog.c + * app/gui/layers-commands.c + * app/gui/preferences-dialog.c + * app/gui/resize-dialog.c + * app/tools/gimpblendoptions.c + * app/tools/gimpcolorbalancetool.c + * app/tools/gimpcroptool.c + * app/tools/gimpcurvestool.c + * app/tools/gimplevelstool.c + * app/tools/gimpmagnifytool.c + * app/tools/gimppaintoptions-gui.c + * app/tools/gimpselectionoptions.c + * app/tools/gimptransformoptions.c + * app/widgets/gimpcolorframe.c + * app/widgets/gimpeditor.c + * app/widgets/gimpgrideditor.c + * app/widgets/gimphistogrameditor.c + * app/widgets/gimpstrokeeditor.c + * app/widgets/gimptemplateeditor.c + * app/widgets/gimptexteditor.c: ported to GimpEnumComboBox. + +2004-04-18 Sven Neumann <sven@gimp.org> + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpenumstore.[ch]: added (yet unused) GimpEnumStore, + a GtkListStore for enum values. + +2004-04-18 Sven Neumann <sven@gimp.org> + + * plug-ins/print/gimp_main_window.c: replaced wrong use of + gimp_option_menu with gimp_int_option_menu. + +2004-04-18 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/script-fu-scripts.c: use a GtkComboBox for + SF-OPTION. + +2004-04-18 Sven Neumann <sven@gimp.org> + + * plug-ins/winicon/icodialog.c + * plug-ins/winicon/icosave.c: ported GtkOptionMenu to GtkComboBox. + +2004-04-17 Sven Neumann <sven@gimp.org> + + * app/widgets/gimpwidgets-constructors.[ch]: + s/GtkSignalFunc/GCallback/ + +2004-04-17 Henrik Brix Andersen <brix@gimp.org> + + * app/tools/gimphuesaturationtool.c + (gimp_hue_saturation_tool_dialog): resolved conflicting + mnemonic. Fixes bug #139868. + +2004-04-17 Henrik Brix Andersen <brix@gimp.org> + + * plug-ins/common/jpeg.c (save_dialog): live preview doesn't + modify the undo history of the image anymore, label changed + accordingly. Fixes bug #140296. + +2004-04-16 Pedro Gimeno <pggimeno@wanadoo.es> + + * plug-ins/common/tile.c (tile): changed a call to + gimp_image_undo_enable to _undo_disable which was obviously the + intention of the author. Added a call to gimp_drawable_update to + get the previews refreshed. + +2004-04-16 Sven Neumann <sven@gimp.org> + + * app/tools/gimpcolorpickertool.c + * app/tools/gimpmeasuretool.c: don't use gtk_window_present() to + raise the tool dialog since it also moves the focus away from the + image window. Fixes the problem described in bug #139349. + +2004-04-16 Sven Neumann <sven@gimp.org> + + * app/tools/gimpcroptool.c: some code cleanup that I forgot to do + when applying the patch. + +2004-04-16 Sven Neumann <sven@gimp.org> + + * plug-ins/helpbrowser/dialog.c (browser_dialog_load): present the + help browser window. + +2004-04-16 Sven Neumann <sven@gimp.org> + + * plug-ins/helpbrowser/dialog.c: use a GtkComboBox instead of + GtkCombo and keep the history in a GtkListStore. + +2004-04-16 Michael Natterer <mitch@gimp.org> + + * app/core/gimpmarshal.list: new marshaller VOID:STRING + + * app/widgets/Makefile.am + * app/widgets/widgets-types.h + * app/widgets/gimpactiongroup.[ch] + * app/widgets/gimpenumaction.[ch] + * app/widgets/gimpstringaction.[ch]: added some completely unused + GtkAction infrastructure. + +2004-04-15 Manish Singh <yosh@gimp.org> + + * tools/Makefile.am + * app/Makefile.am + * configure.in: app, tools, and user dir bumped to version 2.1 names. + + * app/text/gimpfontlist.c: since we now depend on pango 1.4, we can + use pango_fc_font_description_from_pattern() instead of our + cut-n-paste function, gimp_font_list_font_desc_from_pattern(). + +2004-04-15 Tor Lillqvist <tml@iki.fi> + + * app/plug-in/plug-in-message.c (plug_in_handle_proc_install) + * app/plug-in/plug-in-proc.h (struct _PlugInProcDef) + * app/plug-in/plug-in-rc.c (plug_in_rc_write) + * app/plug-in/plug-ins.c (plug_ins_init): Make PDB procedures + (including their menu entries) installed during a plug-ins init() + phase show up. Add a flag to PlugInProcDef that tells whether the + proc was installed during the init() phase. Such procs aren't + saved to the pluginrc. Move the code that initializes plug-ins + that need initialization earlier, before the procs are added to + the PDB and menus are built. Fixes bug #139969. + +2004-04-16 Sven Neumann <sven@gimp.org> + + * plug-ins/common/Makefile.am + * plug-ins/common/plugin-defs.pl + * plug-ins/common/AlienMap.c: removed the AlienMap plug-in since + AlienMap2 duplicates its functionality. + + * plug-ins/common/AlienMap2.c: applied patch from William Skaggs + with a couple of user interface improvements (bug #140079). + +2004-04-15 Tor Lillqvist <tml@iki.fi> + + * libgimpthumb/Makefile.am: For Win32, install gimpthumb.def, like + the .def files of the other libgimp* libs. + + * app/Makefile.am (INCLUDES): Add PANGOFT2_CFLAGS. + + * gimp-zip.in: Put also libgimpthumb in the developer package. + +2004-04-15 Sven Neumann <sven@gimp.org> + + * plug-ins/winicon/icodialog.c: fixed gtk+ includes, added a + warning that deprecated widgets are being used. + +2004-04-15 Sven Neumann <sven@gimp.org> + + * configure.in + * plug-ins/Makefile.am + * plug-ins/winicon/Makefile.am + * plug-ins/winicon/icodialog.[ch] + * plug-ins/winicon/icoload.[ch] + * plug-ins/winicon/icosave.[ch] + * plug-ins/winicon/main.[ch]: added plug-in to load and save + Windows icon files. Plug-in written by Christian Kreibich, port to + GIMP-2.0 API by Gregor Riepl, massive code cleanup by me. Fixes + bug #139160. + +2004-04-15 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpdnd.c (gimp_dnd_data_source_add) + (gimp_dnd_data_source_remove): use the new dynamic GtkTargetList + based API for changing the widget's drag source types. + + * app/widgets/gimpdocumentview.c (gimp_document_view_new): simply + call gimp_dnd_file_source_add() instead of duplicating the whole + GtkTargetEntry array insanity just for adding one source type. + +2004-04-15 Michael Natterer <mitch@gimp.org> + + * plug-ins/FractalExplorer/Dialogs.c + * plug-ins/flame/flame.c + * plug-ins/gfig/gfig.c: first plug-ins ported to GtkFileChooser. + +2004-04-15 Michael Natterer <mitch@gimp.org> + + * app/display/gimpdisplayshell-callbacks.c + * app/display/gimpdisplayshell.c + * app/widgets/gimpcontainertreeview.c: removed runtime version + checks and workarounds for bugs which are fixed in GTK+ 2.4. + + * app/widgets/gimpfiledialog.c + (gimp_file_dialog_selection_changed): added runtime check for GTK+ + 2.4.1 and work around GtkFileChooser's missing "update_preview" + functionality for multiple selections if the dependency is not + met. + + * app/widgets/gimpwidgets-utils.c (gimp_menu_position) + (gimp_menu_button_position): call gtk_menu_set_monitor() until + bug #139187 is fixed. + +2004-04-15 Michael Natterer <mitch@gimp.org> + + * app/widgets/gimpfiledialog.[ch]: derive it from GtkFileChooser + instead of GtkFileSelection. + + * app/gui/file-dialog-utils.c + * app/gui/file-open-dialog.c + * app/gui/file-save-dialog.c + * app/widgets/gimpthumbbox.c: changed accordingly. + + * app/gui/gradients-commands.c + * app/gui/vectors-commands.c + * app/tools/gimpimagemaptool.c + * app/widgets/gimperrorconsole.c + * app/widgets/gimptexteditor.c + * libgimpwidgets/gimpfileentry.c: use file choosers instead of + file selectors. + +2004-04-15 Michael Natterer <mitch@gimp.org> + + * configure.in: depend on glib 2.4.0, gtk+ 2.4.0, pangoft2 1.4.0 + + * app/sanity.c: changed accordingly. + +2004-04-15 Sven Neumann <sven@gimp.org> + + * app/tools/gimpcropoptions.[ch] + * app/tools/gimpcroptool.[ch]: applied a patch from Jordi Gay that + allows to keep the aspect ratio fixed. + +2004-04-15 Michael Natterer <mitch@gimp.org> + + * app/core/gimplayermask.c (gimp_layer_mask_class_init): set + translate_desc to "Move Layer Mask". + + * app/tools/gimpeditselectiontool.c: take the undo desc + from the moved item's class instead of duplicating all + strings here. + +2004-04-15 Sven Neumann <sven@gimp.org> + + * app/core/gimppalette-import.[ch] + * app/gui/palette-import-dialog.c: added palette import from RIFF + palette files based on a patch from ÃRDI Gergõ (bug #129788). + +2004-04-15 Michael Natterer <mitch@gimp.org> + + * app/xcf/xcf.c (xcf_save_invoker) (xcf_load_invoker): forgot + to add context parameters to this non-generated PDB invokers. + Fixes XCF loading/saving. + +2004-04-15 Michael Natterer <mitch@gimp.org> + + * app/core/gimpitem.[ch]: added "const gchar *stroke_desc" to + the GimpItemClass struct and always push an undo group + around GimpItem::stroke(). + + * app/core/gimpchannel.c + * app/core/gimpselection.c + * app/vectors/gimpvectors.c: set the stroke_desc accordingly + and don't push undo groups. + + * app/text/gimptextlayer.c (gimp_text_layer_class_init): set + all of GimpItemClass' undo_descs. + + * app/text/gimptextlayer-transform.c: don't push undo groups here. + +2004-04-15 Sven Neumann <sven@gimp.org> + + * libgimpcolor/gimpcolorspace.c (gimp_rgb_to_hsv): applied patch + from Marco Munari that removes a redundant "if" (bug #133540). + +2004-04-15 Sven Neumann <sven@gimp.org> + + * plug-ins/ifscompose/ifscompose.c: applied patch from Yeti that + adds spinbuttons instead of simple text entries (bug #138132). + +2004-04-15 Sven Neumann <sven@gimp.org> + + * plug-ins/common/Makefile.am + * plug-ins/common/plugin-defs.pl + * plug-ins/common/gicon.c: removed the GIcon plug-in (addresses + one aspect of bug #139160). + +2004-04-15 Michael Natterer <mitch@gimp.org> + + Context cleanup continued: + + * app/core/gimpitem.[ch]: added context parameter to + GimpItem::stroke(). + + * app/core/gimpchannel.c (gimp_channel_stroke) + * app/vectors/gimpvectors.c (gimp_vectors_stroke): use it to get + default values from instead of gimp_get_user_context(). + + * app/core/gimpselection.c + * app/gui/stroke-dialog.c + * tools/pdbgen/pdb/edit.pdb + * tools/pdbgen/pdb/paths.pdb: changed accordingly. + + * app/pdb/edit_cmds.c + * app/pdb/paths_cmds.c: regenerated. + + * app/plug-in/plug-in.[ch]: added GimpContext member to the PlugIn + struct. Added context parameter to plug_in_new(), + plug_in_call_query() and plug_in_call_init(). + + * app/plug-in/plug-in-run.[ch]: added context parameters to + plug_in_run() and plug_in_repeat(). + + * app/gui/plug-in-commands.c + * app/gui/vectors-commands.c + * app/pdb/procedural_db.c + * app/widgets/gimphelp.c: pass a context to plug_in_run() and + plug_in_repeat(). + + * app/plug-in/plug-in-message.c (plug_in_handle_proc_run): call + procedures with the plug-in's context. + + * app/plug-in/plug-ins.c: use a temporary context for running the + plug-ins' query() and init() functions. Use the same context for + running automatic extensions. This temporarily separates the main + Script-Fu extension from the user context (i.e. scripts have no + way of setting/getting the global FG, BG, brush etc.). + +2004-04-15 Sven Neumann <sven@gimp.org> + + * NEWS + * README: mention that this is the development branch. + +2004-04-15 Sven Neumann <sven@gimp.org> + + * app/paint-funcs/paint-funcs.[ch]: + * app/paint-funcs/paint-funcs-generic.h: header cleanup, added + some const qualifiers, converted tabs to spaces. Fixes bug #140115 + for the HEAD branch. + +2004-04-15 Michael Natterer <mitch@gimp.org> + + Get rid of the "current_context" which was in fact just a bunch of + global variables. Instead, pass the needed context all the way + from the GUI and the PDB to the core. This is a prerequisite for + macro recording and generally helps separating the various + subsystems from each other. Work in progress... + + * app/core/gimp.[ch]: removed member "current_context" and + gimp_[get|set]_current_context(). + + * app/core/gimp-edit.[ch] + * app/core/gimpdrawable-blend.[ch] + * app/core/gimpdrawable-bucket-fill.[ch] + * app/core/gimpdrawable-offset.[ch] + * app/core/gimpdrawable-transform.[ch] + * app/core/gimpimage-crop.[ch] + * app/core/gimpimage-flip.[ch] + * app/core/gimpimage-merge.[ch] + * app/core/gimpimage-resize.[ch] + * app/core/gimpimage-rotate.[ch] + * app/core/gimpimage.[ch] + * app/core/gimpimagefile.[ch] + * app/core/gimpitem-linked.[ch] + * app/core/gimpitem.[ch] + * app/core/gimplayer.[ch] + * app/core/gimpselection.[ch] + * app/core/gimptemplate.[ch] + * app/file/file-open.[ch] + * app/file/file-save.[ch] + * app/pdb/procedural_db.[ch] + * app/text/gimptext-compat.[ch] + * app/text/gimptextlayer-transform.[ch] + * app/gui/brush-select.[ch] + * app/gui/font-select.[ch] + * app/gui/gradient-select.[ch] + * app/gui/palette-select.[ch] + * app/gui/pattern-select.[ch]: added tons of "GimpContext *context" + parameters and use the passed context instead of + gimp_get_current_context(). + + * app/app_procs.c + * app/batch.c + * app/core/gimpchannel.c + * app/core/gimpdrawable.c + * app/paint/gimperaser.c + * app/paint/gimppaintbrush.c + * app/plug-in/plug-in-message.c + * app/plug-in/plug-ins.c + * app/text/gimptextlayer.c + * app/tools/gimpblendtool.c + * app/tools/gimpbucketfilltool.c + * app/tools/gimpcroptool.c + * app/tools/gimpeditselectiontool.c + * app/tools/gimpfliptool.c + * app/tools/gimpinktool.c + * app/tools/gimptransformtool.c + * app/vectors/gimpvectors.c + * app/gui/convert-dialog.c + * app/gui/drawable-commands.c + * app/gui/edit-commands.c + * app/gui/file-commands.c + * app/gui/file-new-dialog.c + * app/gui/file-open-dialog.c + * app/gui/file-save-dialog.c + * app/gui/image-commands.c + * app/gui/layers-commands.c + * app/gui/offset-dialog.c + * app/gui/select-commands.c + * app/gui/vectors-commands.c + * app/widgets/gimpdnd.c + * app/widgets/gimpdocumentview.c + * app/widgets/gimphelp.c + * app/widgets/gimpthumbbox.c: pass gimp_get_user_context() or + GIMP_CONTEXT(tool_options) or whatever is the right context + to the changed core functions. + + * tools/pdbgen/app.pl: pass "GimpContext *context" to all + generated PDB invokers. + + * tools/pdbgen/pdb/brush_select.pdb + * tools/pdbgen/pdb/brushes.pdb + * tools/pdbgen/pdb/drawable.pdb + * tools/pdbgen/pdb/edit.pdb + * tools/pdbgen/pdb/font_select.pdb + * tools/pdbgen/pdb/gradient_select.pdb + * tools/pdbgen/pdb/gradients.pdb + * tools/pdbgen/pdb/image.pdb + * tools/pdbgen/pdb/layer.pdb + * tools/pdbgen/pdb/paint_tools.pdb + * tools/pdbgen/pdb/palette.pdb + * tools/pdbgen/pdb/palette_select.pdb + * tools/pdbgen/pdb/palettes.pdb + * tools/pdbgen/pdb/paths.pdb + * tools/pdbgen/pdb/pattern_select.pdb + * tools/pdbgen/pdb/patterns.pdb + * tools/pdbgen/pdb/selection.pdb + * tools/pdbgen/pdb/text_tool.pdb + * tools/pdbgen/pdb/transform_tools.pdb: pass the new context + parameter to the changed core functions. + + * app/pdb/*_cmds.c: regenerated. + +2004-04-14 Raphaël Quinet <quinet@gamers.org> + + * plug-ins/script-fu/scripts/copy-visible.scm: New version of the + script that works on a temporary copy of the image instead of + copying the visible layers. Fixes bug #139989. + +2004-04-14 Sven Neumann <sven@gimp.org> + + * plug-ins/common/film.c: fixed typo (bug #140039). + +2004-04-14 Sven Neumann <sven@gimp.org> + + * configure.in: bumped version to 2.1.0, interface age 0, binary + age 0. Changed library versioning to include gimp_minor_version + similar to how gtk+ does it. + +2004-04-14 Sven Neumann <sven@gimp.org> + + * Made 2.0.1 release. + +2004-04-13 Raphaël Quinet <quinet@gamers.org> + + * plug-ins/common/mng.c (query, run): Workaround for bug #139947: + do not register the plug-in for INDEXED* modes and do not declare + that it can handle INDEXED images in gimp_export_image(). This + forces a conversion to RGB instead of generating broken indexed + images. The generation of correct indexed MNG files is likely to + require a newer release of libmng. + (mng_data): Set default compression level to 9 instead of 6. + +2004-04-13 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_cern_parse.c + * plug-ins/imagemap/imap_csim_parse.c + * plug-ins/imagemap/imap_ncsa_parse.c: regenerated using GNU Bison + version 1.875a. Fixes bug #139894. + +2004-04-13 Sven Neumann <sven@gimp.org> + + * tools/gimp-remote.c: reverted last change and go back to the + solution using fork(). Hopefully fixes bug #139158 this time. + +2004-04-13 Sven Neumann <sven@gimp.org> + + * app/core/gimp-utils.[ch] (gimp_get_default_language): added a + category parameter to make this function more flexible. + + * app/text/gimptext.c: changed accordingly. + + * app/widgets/gimphelp.c (gimp_help): localize the help pages + according to the value of LC_MESSAGES. Fixes bug #139917. + +2004-04-13 Michael Natterer <mitch@gimp.org> + + Moved the calls to floating_sel_relax()/rigor() from various + places to two single spots in the core where they are actually + needed. Fixes bug #138356 (which was caused by the projection + being triggered in the middle of changing the floating selection's + size or the size of the drawable it is attached to). This commit + effectively removes floating selection fiddling from the core's + public API. + + * app/core/gimpdrawable.[ch] (gimp_drawable_has_floating_sel): new + function which returns TRUE if there is a floating selection + attached to the drawable. + + * app/core/gimpdrawable.c (gimp_drawable_translate) + (gimp_drawable_set_tiles_full): if the drawable *has* a floating + selection, relax/rigor it before/after modifying the drawable. + + * app/core/gimplayer.c (gimp_layer_translate) + (gimp_layer_set_tiles): if the layer *is* the floating selection, + relax/rigor it before/after modifying it. + + * app/core/gimpdrawable-transform.c + * app/core/gimpimage-convert.c + * app/core/gimpimage-crop.c + * app/core/gimpimage-flip.c + * app/core/gimpimage-resize.c + * app/core/gimpimage-rotate.c + * app/core/gimpimage-scale.c + * app/gui/layers-commands.c + * app/tools/gimpeditselectiontool.c + * tools/pdbgen/pdb/layer.pdb: removed calls to + floating_sel_rigor()/relax() all over the place. Also removed + lots of undo groups which are obsolete now. + + * app/pdb/layer_cmds.c: regenerated. + +2004-04-13 Sven Neumann <sven@gimp.org> + + * plug-ins/imagemap/imap_file.c (do_file_error_dialog): convert + the filename to UTF-8 before displaying it. + +2004-04-13 Michael Natterer <mitch@gimp.org> + + GimpItem undo group cleanup in preparation of fixing bug #138356: + + * app/core/core-enums.[ch]: renamed LAYER_SCALE and LAYER_RESIZE + undo groups to ITEM_SCALE and ITEM_RESIZE. + + * app/core/gimpitem.[ch]: always push undo groups around + GimpItem::translate(), scale(), resize(), flip(), rotate() and + transform(). Added the resp. undo_desc strings to GimpItemClass. + + * app/core/gimpchannel.[ch] + * app/core/gimpdrawable.[ch] + * app/core/gimplayer.c: removed all undo groups from + implementations of the above methods. Removed the undo_desc + strings which were moved to GimpItemClass. + + * app/core/gimpimage-crop.c + * app/core/gimpselection.c + * app/gui/layers-commands.c + * app/vectors/gimpvectors.c + * tools/pdbgen/pdb/layer.pdb: changed accordingly. + + * app/pdb/layer_cmds.c: regenerated. + +2004-04-12 Sven Neumann <sven@gimp.org> + + * configure.in: cleaned up the check for Xmu. Include <gdk/gdkx.h> + when testing for Xmu.h. Fixes bug #139803. + +2004-04-12 Sven Neumann <sven@gimp.org> + + * libgimpmath/Makefile.am: remove test-md5 on make clean. + +2004-04-11 Manish Singh <yosh@gimp.org> + + * plug-ins/pygimp/plug-ins/py-slice.py: When using a separate dir for + images, actually prepend the dir to the img srcs in the html. Allow + only horizontal or vertical guides in an image, do not require both. + A bit smarter path handling. Addresses most of bug #138714. + +2004-04-11 Hans Breuer <hans@breuer.org> + + * app/makefile.msc : build sanity.obj + app/text/makefile.msc : gimptextundo.obj + app/widgets/makefile.msc : gimppatternfactoryview.obj + + * plug-ins/common/winclipboard.c : don't call + gimp_image_undo_enable() when it's not switched off. + Otherwise the undo history would be destroyed with + Gimp-Core-CRITICAL **: file gimpimage.c: line 1579: assertion + `gimage->undo_freeze_count > 0' failed + +2004-04-10 Sven Neumann <sven@gimp.org> + + * app/tools/gimptexttool.c (gimp_text_tool_apply): push an undo + group only when it's needed. This resurrects text undo compression + that broke when bug #137767 got fixed. + +2004-04-10 Sven Neumann <sven@gimp.org> + + * docs/gimp-remote.1.in: updated example URL. + +2004-04-10 Pedro Gimeno <pggimeno@wanadoo.es> + + * app/core/gimpdrawable-transform.c + (gimp_drawable_transform_tiles_affine): Applied patch from William + Skaggs that addresses bug #120490. + + * app/sanity.c (sanity_check): Modified the message that reports + an old version of Fontconfig in an attempt to make it more + informative. + +2004-04-10 Sven Neumann <sven@gimp.org> + + * tools/gimp-remote.c (start_new_gimp): reverted the last change + and did a different fix that involves closing the X display before + starting gimp (bug #139158). + +2004-04-09 Manish Singh <yosh@gimp.org> + + * plug-ins/common/jpeg.c: Uglier workaround for bug #138357, since + the previous one did break error handling. Fixes bug #139571. + +2004-04-09 Henrik Brix Andersen <brix@gimp.org> + + * README.i18n: s/14/20/ plus whitespace clean-up. + +2004-04-08 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/siod-wrapper.c: applied a patch from Kevin + Cozens that makes the Script-Fu PDB marshaller handle NULL + strings. Some minor code cleanup. Fixes bug #139386. + +2004-04-08 Sven Neumann <sven@gimp.org> + + * tools/gimp-remote.c (start_new_gimp): applied a patch from + Michael Matz that calls fork() before starting gimp. This is to + avoid X server authentification problems (bug #139158). + +2004-04-07 Henrik Brix Andersen <brix@gimp.org> + + * configure.in (ALL_LINGUAS): revert addition of "is" until all + .po files are there. + +2004-04-07 Samúel Jón Gunnarsson <sammi@techattack.nu> + + * configure.in: Added "is" to ALL_LINGUAS + +2004-04-06 Iñaki Larrañaga <dooteo@euskalgnu.org> + + * configure.in: Added "eu" (Basque) to ALL_LINGUAS. + +2004-04-05 Pedro Gimeno <pggimeno@wanadoo.es> + + * plug-ins/script-fu/scripts/copy-visible.scm: Use + gimp-image-get-active-layer/channel instead of the passed + drawable for later restoring the initially active layer/channel. + Addresses bug #138662. + + * plug-ins/script-fu/scripts/drop-shadow.scm: Add a call to + gimp-image-set-active-layer in order for it to fail early instead + of failing with the undo group open in case the drawable is not + suitable for applying the effect. + +2004-04-05 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage.c (gimp_image_real_mode_changed): update the + whole image. + + * app/display/gimpdisplay-handlers.c: removed obsolete + "mode_changed" and "colormap_changed" handlers because GimpImage's + default handlers already update the whole image. + +2004-04-05 Pedro Gimeno <pggimeno@wanadoo.es> + + Sanitize rectangle and ellipse selection handling (bug #138237 + and bug #138103): + + * app/tools/gimprectselecttool.h + * app/tools/gimprectselecttool.c (GimpRectSelectTool): new + member "moved" indicating whether the cursor was moved after + the click. + (gimp_rect_select_tool_coords_to_integer): New function for + consistent conversion of the rectangle FP coords to pixels. + (gimp_rect_select_tool_button_press, + gimp_rect_select_tool_button_release, + gimp_rect_select_tool_motion, gimp_rect_select_tool_draw): use + it instead of fiddling with the FP coordinates. Update "moved" + and use it to detect whether the selection needs to be cleared. + + * app/tools/gimpellipseselecttool.c + (gimp_ellipse_select_tool_draw): use the new coords_to_integer + function. + +2004-04-05 Sven Neumann <sven@gimp.org> + + * plug-ins/Lighting/lighting_ui.c: applied the second patch + attached to bug #138788 by William Skaggs. Removes some user + interface elements that have no corresponding implementation and + fixes preview updates. + +2004-04-04 Sven Neumann <sven@gimp.org> + + * Makefile.am + * NEWS.pre-2-0: moved old NEWS to this new file. + + * NEWS: list bugs fixed since 2.0.0. + +2004-04-04 Sven Neumann <sven@gimp.org> + + * Makefile.am + * docs/Makefile.am: don't install gimptool symlinks to + gimptool-2.0 and its manpage. gimp.m4 as installed with gimp-1.2 + looks for gimptool (bug #139024). + +2004-04-04 Sven Neumann <sven@gimp.org> + + * app/display/gimpdisplayshell-callbacks.c + * app/display/gimpdisplayshell-draw.[ch] pass the bounding box of + the exposed area to gimp_display_shell_draw_grid() and draw only + the relevant part of the grid. Fixes bug #138081. + +2004-04-04 Sven Neumann <sven@gimp.org> + + Cache the GC for drawing the grid as suggested in bug #138081: + + * app/display/gimpdisplayshell.[ch]: added a grid_gc member to + GimpDisplayShell. + + * app/display/gimpdisplayshell-handlers.c + (gimp_display_shell_grid_notify_handler) + (gimp_display_shell_disconnect): invalidate the grid GC. + + * app/display/gimpdisplayshell-draw.c (gimp_display_shell_draw_grid): + use the cached grid_gc. Also applied the fix that Pedro Gimeno did + for bug #138606. + +2004-04-04 Sven Neumann <sven@gimp.org> + + * app/core/gimpundo.c (gimp_undo_type_to_name): added a missing + call to gettext(). Fixes bug #139000. + +2004-04-03 Manish Singh <yosh@gimp.org> + + * gimptool-2.0.in: Create any directories in the install path that do + not already exist. Fixes bug #138980. + + * docs/gimptool.1.in: s/dont/don't/g + +2004-04-04 Sven Neumann <sven@gimp.org> + + * app/core/gimpimagemap.c (gimp_image_map_apply): do nothing if the + selection is empty. Fixes bug #138973. + +2004-04-03 Sven Neumann <sven@gimp.org> + + * app/text/gimptextlayer.c (gimp_text_layer_new): create the + initial text layer with a size of 1 x 1 since tile_manager_new() + does not any longer accept 0 x 0. + + * app/core/gimpdrawable.c (gimp_drawable_configure): check that + width and height are > 0. + +2004-04-03 Sven Neumann <sven@gimp.org> + + * plug-ins/Lighting/lighting_main.c + * plug-ins/Lighting/lighting_shade.c: applied the first of two + patches attached to bug #138788 by William Skaggs. + +2004-04-02 Simon Budig <simon@gimp.org> + + * plug-ins/common/whirlpinch.c: set a proper pixelfetcher + edge mode for bigger radii. Avoids getting garbage at the + image borders. + +2004-04-02 Dave Neary <bolsh@gimp.org> + + * plug-ins/common/jpeg.c: Added .jpe to the list of extensions + that the jpeg plug-in recognises. Fixes bug #138776. + +2004-04-01 Sven Neumann <sven@gimp.org> + + * app/gui/user-install-dialog.c: unset the bg_pixmap and tweak + style colors for all states. Sort of ugly but makes the dialog + work better with more obscure themes (bug #138379). + +2004-04-01 Sven Neumann <sven@gimp.org> + + * tools/kernelgen.c: updated a comment. + +2004-04-01 Michael Natterer <mitch@gimp.org> + + * app/core/core-enums.[ch] (enum GimpUndoType): added undo type + GIMP_UNDO_TEXT_LAYER_MODIFIED and undo group types + GIMP_UNDO_GROUP_DRAWABLE and GIMP_UNDO_GROUP_DRAWABLE_MOD. + + * app/core/gimpimage-undo-push.[ch]: added new new function + gimp_image_undo_push_text_layer_modified() which makes + modifications of the text_layer's "modified" boolean undoable. + + * app/core/gimpdrawable.[ch]: added new virtual function + GimpDrawable::push_undo() and moved the actual undo pushing into + the default implementation gimp_drawable_real_push_undo(). + + * app/text/gimptextlayer.c (gimp_text_layer_push_undo): new + function. Pushes the text_layer's modified state to the undo stack + after upchaining and sets modified to TRUE. + + (gimp_text_layer_set_tiles): ditto. + + (gimp_lext_layer_apply_region) + (gimp_text_layer_replace_region): removed because their default + implementations already call gimp_drawable_push_undo(). + + (gimp_text_layer_swap_pixels): removed because swap_pixels() is + used by undo only and doesn't need to care about the text_layer's + modified state. + + (gimp_text_layer_render): don't set modified to FALSE here because + we can't push an undo step here. + + (gimp_text_layer_set): push the modified state to the undo stack + and set it to FALSE here. Also push the layer's tiles if the + layer was modified. + + * app/tools/gimptexttool.c (gimp_text_tool_apply): push "modified" + to the undo stack and set it to FALSE here, too. + + Fixes bug #137767. + +2004-03-31 Simon Budig <simon@gimp.org> + + * app/tools/gimptransformtool.c: One really should use braces + when mixing additions and multiplication and the operator + precedence is not the desired one... + + I feel stupid... :-) + +2004-03-31 Michael Natterer <mitch@gimp.org> + + * app/core/gimp-transform-utils.c + (gimp_transform_matrix_perspective): make sure 0.0/0.0 results + in 1.0, not NaN. + + * app/core/gimpdrawable-transform.c + (gimp_drawable_transform_tiles_affine): instead of returning NULL + if the transformation shrinks the tiles completely away, return at + least the pixel (or the row or column of pixels) which best covers + the sub-pixel area of the transform result: + + - Changed rounding of the transformed coordinates from RINT() + to floor()/ceil() so we don't cut off sub-pixel portions of the + transform result. + - Force the minimal size if the changed rounding didn't help. + + Fixes bug #138117. + + Also added paranoia code which falls back to clip_result if the + passed matrix produces NaN coordinates (copied the FINITE() macro + from image_cmds.c). + +2004-03-30 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/grid-system.scm: define "map" here, + the script used to take the definition from alien-glow-arrow.scm + or beveled-pattern-arrow.scm. Also added an undo group around all + operations. Fixes bug #138524. + +2004-03-30 Michael Natterer <mitch@gimp.org> + + * app/Makefile.am + * app/sanity.[ch]: new files implementing sanity_check() for + run-time checking library versions. Added a check for FreeType but + disabled it until we figured if and how freetype causes some of + the DLL hell bugs. + + * app/main.c (main): call it and abort if it fails. + + * app/app_procs.[ch]: added app_gui_abort() so main.c doesn't + need to #include "gui/gui.h" + + * app/gui/gui.[ch] (gui_libs_init): removed library sanity checking. + + (gui_abort): new function which shows the abort message. + +2004-03-30 Michael Natterer <mitch@gimp.org> + + * configure.in (ALL_LINGUAS): revert addition of "pa" until + all .po files are there. + +2004-03-20 Guntupalli Karunakar <karunakar@freedomink.org> + + * configure.in: Added "pa" for Punjabi to ALL_LINGUAS. + +2004-03-29 Manish Singh <yosh@gimp.org> + + * plug-ins/common/jpeg.c (struct my_error_mgr): Move setjump_buffer + to the beginning of the structure, to make sure it is aligned on a + 16-byte boundary for ia64, even with icc. Fixes #138357. + +2004-03-29 Sven Neumann <sven@gimp.org> + + * app/config/gimpguiconfig.c: changed the default for "help-locales" + from NULL to an empty string. Fixes the generated gimprc man-page. + + * app/config/gimprc-blurbs.h (HELP_LOCALES_BLURB): added missing + whitespace. + + * app/widgets/gimphelp.c: use the user's locale if "help-locales" + is NULL or the empty string. + + * docs/gimprc.5.in + * etc/gimprc: regenerated. + +2004-03-29 Michael Natterer <mitch@gimp.org> + + * app/core/core-enums.[ch] (enum GimpUndoType): added new group + GIMP_UNDO_GROUP_FS_REMOVE. + + * app/core/gimplayer-floating-sel.c (floating_sel_remove): push an + undo group. Fixes undo corruption spotted by Pedro Gimeno. + +2004-03-29 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/guillotine.c (guillotine): Don't just skip + guides at the image edges but any guide which is at a position we + already remembered. Should catch all instances of bug #138312 this + time. + +2004-03-28 Sven Neumann <sven@gimp.org> + + * plug-ins/ifscompose/ifscompose.c: applied patch from David Necas + that updates the sensitivity of the Delete button and menu entry. + Fixes bug #138212. + +2004-03-28 Sven Neumann <sven@gimp.org> + + * plug-ins/MapObject/mapobject_main.c: fixed non-interactive call. + + * plug-ins/script-fu/scripts/spinning-globe.scm: pass -1 as + drawable ID for unused drawables. Fixes bug #138253. + +2004-03-28 Sven Neumann <sven@gimp.org> + + * app/text/gimpfontlist.c (gimp_font_list_add_font): validate the + font name. This should work around the crashes that Windows users + were experiencing on startup (bug #132366). The real problem needs + to be fixed elsewhere though. + +2004-03-28 Michael Natterer <mitch@gimp.org> + + * app/core/gimpimage-undo-push.c (undo_pop_layer): when re-adding + a layer with mask, don't forget to set layer->mask->removed to FALSE. + +2004-03-28 Michael Natterer <mitch@gimp.org> + + * app/core/gimpitem.[ch]: added "gboolean removed" to the GimpItem + struct. Defaults to FALSE. Set it to TRUE in gimp_item_removed(). + Added public function gimp_item_is_removed(). + + * app/core/gimpimage-undo-push.c (undo_pop_layer) + (undo_pop_layer_mask) (undo_pop_channel) (undo_pop_vectors): + set it to FALSE manually when re-adding something from the + undo stack. + + * tools/pdbgen/app.pl + * tools/pdbgen/pdb.pl: don't allow any operation on items which + are removed from the image (and exist on the undo stack only). + Fixes bug #138311. + + * app/pdb/channel_cmds.c + * app/pdb/color_cmds.c + * app/pdb/drawable_cmds.c + * app/pdb/edit_cmds.c + * app/pdb/floating_sel_cmds.c + * app/pdb/image_cmds.c + * app/pdb/layer_cmds.c + * app/pdb/paint_tools_cmds.c + * app/pdb/parasite_cmds.c + * app/pdb/selection_cmds.c + * app/pdb/selection_tools_cmds.c + * app/pdb/transform_tools_cmds.c: regenerated. + +2004-03-28 Sven Neumann <sven@gimp.org> + + * plug-ins/script-fu/scripts/slide.scm: applied a (modified) patch + from Nils Philippsen that fixes bug #138310. + +2004-03-28 Michael Natterer <mitch@gimp.org> + + * plug-ins/common/guillotine.c (guillotine): applied a (modified) + patch from Joao S. O. Bueno which removes any guides from the + cropped images. Fixes bug #138314. + + Skip guides which are at the image's edges because the algorithm + already assumes that there are always guides at these positions. + Fixes bug #138312. + +2004-03-27 Tor Lillqvist <tml@iki.fi> + + * plug-ins/help/Makefile.am (AM_LDFLAGS): Use -mwindows on Windows + to avoid a console window popping up. + +2004-03-26 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/app.pl: don't generate code with tabs. + + * tools/pdbgen/pdb/procedural_db.pdb: convert tabs to spaces in + helper function declaration. + + * app/pdb/procedural_db.c: convert tabs to spaces. + + * app/pdb/*.c: regenerated, no code changes, only tabs->spaces. + +2004-03-26 Manish Singh <yosh@gimp.org> + + * tools/pdbgen/app.pl: kill whitespace in blank lines. + + * app/pdb/*.c: regenerated, no code changes, only whitespace. + +2004-03-26 Michael Natterer <mitch@gimp.org> + + * app/core/gimpdrawable-transform.c + (gimp_drawable_transform_tiles_affine): return NULL tiles if the + matrix would transform the drawable into nothing. Fixes the + core-crashing part of bug #138117 and makes the script fail + with an execution error. + +2004-03-25 Sven Neumann <sven@gimp.org> + + * README: mention the gimp-perl pre-release and provide a link. + +2004-03-25 Michael Natterer <mitch@gimp.org> + + * app/base/tile-manager.c (tile_manager_new): g_return_if_fail() + on width, height or bpp <= 0. Doesn't fix anything but badly + warns (and helps debugging) on bug #138117. + +2004-03-25 Michael Natterer <mitch@gimp.org> + + * app/tools/gimpvectortool.c (gimp_vector_tool_button_release): + fixed condition which triggers the path tool's undo hack. Fixes + bug #138086. Also g_object_unref() the undo step. + + Removed trailing whitespace. + +2004-03-25 Manish Singh <yosh@gimp.org> + + * libgimp/gimp.c + * app/plug-in/plug-in-shm.c: close the shm_open fd in the POSIX + shm case. We were leaking an fd here. + + * app/tools/gimptexttool.c (gimp_text_tool_connect): remove + unnecessary G_OBJECT() cast in g_object_set() call. + +2004-03-23 Michael Natterer <mitch@gimp.org> + + * autogen.sh: be verbose about AUTOGEN_CONFIGURE_ARGS in the + message that is printed if no arguments were passed. + +2004-03-23 Sven Neumann <sven@gimp.org> + Michael Natterer <mitch@gimp.org> + + * Made 2.0.0 release. |